(data stored in ACNUC1104 zone)

EMBL: CP000717

ID   CP000717; SV 1; circular; genomic DNA; STD; PRO; 4424435 BP.
XX
AC   CP000717; AAIX02000000-AAIX02000001;
XX
PR   Project:PRJNA15642;
XX
DT   09-JUN-2007 (Rel. 92, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Mycobacterium tuberculosis F11, complete genome.
XX
KW   .
XX
OS   Mycobacterium tuberculosis F11
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium tuberculosis complex.
XX
RN   [1]
RP   1-4424435
RG   The Broad Institute Genome Sequencing Platform
RA   Birren B., Lander E., Galagan J., Devon K., Nusbaum C., Borowsky M.L.,
RA   Grabherr M., Mauceli E., Brockman W., Young S., LaButti K., Pushparaj V.,
RA   Sykes S., Baldwin J., Fitzgerald M., Bloom T., Zimmer A., Settipalli S.,
RA   Shea T., Arachchi H., Macdonald P., Abouelleil A., Lui A., Priest M.,
RA   Berlin A., Gearin G., Brown A., Aftuck L., Bessette D., Allen N.,
RA   Lubonja R., Lokyitsang T., Matthews C., Dunbar C., Benamara M., Nguyen T.,
RA   Negash T., DeCaprio D., Crawford M., Koehrsen M., Engels R., Montgomery P.,
RA   Pearson M., Howarth C., Kodira C., Zeng Q., Yandava C., O'Leary S.,
RA   Alvarado L., Victor T., Murray M.;
RT   "The Complete Genome Sequence of Mycobacterium tuberculosis F11";
RL   Unpublished.
XX
RN   [2]
RP   1-4424435
RG   The Broad Institute Genome Sequencing Platform
RA   Birren B., Lander E., Galagan J., Devon K., Nusbaum C., Borowsky M.L.,
RA   Grabherr M., Mauceli E., Brockman W., Young S., LaButti K., Sykes S.,
RA   Baldwin J., Fitzgerald M., Bloom T., Zimmer A., Settipalli S., Shea T.,
RA   Arachchi H., Macdonald P., Abouelleil A., Lui A., Priest M., Berlin A.,
RA   Gearin G., Brown A., Aftuck L., Bessette D., Allen N., Lubonja R.,
RA   Lokyitsang T., Matthews C., Dunbar C., Benamara M., Nguyen T., Negash T.,
RA   DeCaprio D., Crawford M., Koehrsen M., Engels R., Montgomery P.,
RA   Pearson M., Howarth C., Kodira C., Zeng Q., Yandava C., O'Leary S.,
RA   Alvarado L., Victor T., Murray M.;
RT   ;
RL   Submitted (10-APR-2007) to the INSDC.
RL   Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA
RL   02142, USA
XX
DR   MD5; 2f4f974b0a8b96eee1b13edeadb85634.
DR   BioSample; SAMN00103286.
DR   EnsemblGenomes-Gn; EBG00001211905.
DR   EnsemblGenomes-Gn; EBG00001211906.
DR   EnsemblGenomes-Gn; EBG00001211907.
DR   EnsemblGenomes-Gn; EBG00001211908.
DR   EnsemblGenomes-Gn; EBG00001211909.
DR   EnsemblGenomes-Gn; EBG00001211910.
DR   EnsemblGenomes-Gn; EBG00001211911.
DR   EnsemblGenomes-Gn; EBG00001211912.
DR   EnsemblGenomes-Gn; EBG00001211913.
DR   EnsemblGenomes-Gn; EBG00001211914.
DR   EnsemblGenomes-Gn; EBG00001211915.
DR   EnsemblGenomes-Gn; EBG00001211916.
DR   EnsemblGenomes-Gn; EBG00001211917.
DR   EnsemblGenomes-Gn; EBG00001211918.
DR   EnsemblGenomes-Gn; EBG00001211919.
DR   EnsemblGenomes-Gn; EBG00001211920.
DR   EnsemblGenomes-Gn; EBG00001211921.
DR   EnsemblGenomes-Gn; EBG00001211922.
DR   EnsemblGenomes-Gn; EBG00001211923.
DR   EnsemblGenomes-Gn; EBG00001211924.
DR   EnsemblGenomes-Gn; EBG00001211925.
DR   EnsemblGenomes-Gn; EBG00001211926.
DR   EnsemblGenomes-Gn; EBG00001211927.
DR   EnsemblGenomes-Gn; EBG00001211928.
DR   EnsemblGenomes-Gn; EBG00001211929.
DR   EnsemblGenomes-Gn; EBG00001211930.
DR   EnsemblGenomes-Gn; EBG00001211931.
DR   EnsemblGenomes-Gn; EBG00001211932.
DR   EnsemblGenomes-Gn; EBG00001211933.
DR   EnsemblGenomes-Gn; EBG00001211934.
DR   EnsemblGenomes-Gn; EBG00001211935.
DR   EnsemblGenomes-Gn; EBG00001211936.
DR   EnsemblGenomes-Gn; EBG00001211937.
DR   EnsemblGenomes-Gn; EBG00001211938.
DR   EnsemblGenomes-Gn; EBG00001211939.
DR   EnsemblGenomes-Gn; EBG00001211940.
DR   EnsemblGenomes-Gn; EBG00001211941.
DR   EnsemblGenomes-Gn; EBG00001211942.
DR   EnsemblGenomes-Gn; EBG00001211943.
DR   EnsemblGenomes-Gn; EBG00001211944.
DR   EnsemblGenomes-Gn; EBG00001211945.
DR   EnsemblGenomes-Gn; EBG00001211946.
DR   EnsemblGenomes-Gn; EBG00001211947.
DR   EnsemblGenomes-Gn; EBG00001211948.
DR   EnsemblGenomes-Gn; EBG00001211949.
DR   EnsemblGenomes-Gn; EBG00001211950.
DR   EnsemblGenomes-Gn; EBG00001211951.
DR   EnsemblGenomes-Gn; EBG00001211952.
DR   EnsemblGenomes-Gn; EBG00001211953.
DR   EnsemblGenomes-Gn; EBG00001211954.
DR   EnsemblGenomes-Gn; EBG00001211955.
DR   EnsemblGenomes-Gn; EBG00001211956.
DR   EnsemblGenomes-Gn; EBG00001211957.
DR   EnsemblGenomes-Gn; EBG00001211958.
DR   EnsemblGenomes-Gn; EBG00001211959.
DR   EnsemblGenomes-Gn; EBG00001211960.
DR   EnsemblGenomes-Gn; EBG00001211961.
DR   EnsemblGenomes-Gn; EBG00001211962.
DR   EnsemblGenomes-Gn; EBG00001211963.
DR   EnsemblGenomes-Gn; EBG00001211964.
DR   EnsemblGenomes-Gn; EBG00001211965.
DR   EnsemblGenomes-Gn; EBG00001211966.
DR   EnsemblGenomes-Gn; EBG00001211967.
DR   EnsemblGenomes-Gn; EBG00001211968.
DR   EnsemblGenomes-Gn; EBG00001211969.
DR   EnsemblGenomes-Gn; EBG00001211970.
DR   EnsemblGenomes-Gn; EBG00001211971.
DR   EnsemblGenomes-Gn; EBG00001211972.
DR   EnsemblGenomes-Gn; EBG00001211973.
DR   EnsemblGenomes-Gn; TBFG_11738.
DR   EnsemblGenomes-Gn; TBFG_11779.
DR   EnsemblGenomes-Gn; TBFG_11805.
DR   EnsemblGenomes-Gn; TBFG_11822.
DR   EnsemblGenomes-Gn; TBFG_12047.
DR   EnsemblGenomes-Gn; TBFG_12055.
DR   EnsemblGenomes-Gn; TBFG_12311.
DR   EnsemblGenomes-Gn; TBFG_12415.
DR   EnsemblGenomes-Gn; TBFG_13130.
DR   EnsemblGenomes-Gn; TBFG_14001.
DR   EnsemblGenomes-Gn; TBFG_14002.
DR   EnsemblGenomes-Gn; TBFG_14003.
DR   EnsemblGenomes-Gn; TBFG_14004.
DR   EnsemblGenomes-Gn; TBFG_14005.
DR   EnsemblGenomes-Gn; TBFG_14006.
DR   EnsemblGenomes-Gn; TBFG_14007.
DR   EnsemblGenomes-Gn; TBFG_14008.
DR   EnsemblGenomes-Gn; TBFG_14009.
DR   EnsemblGenomes-Gn; TBFG_14010.
DR   EnsemblGenomes-Gn; TBFG_14011.
DR   EnsemblGenomes-Gn; TBFG_14012.
DR   EnsemblGenomes-Gn; TBFG_14013.
DR   EnsemblGenomes-Gn; TBFG_14014.
DR   EnsemblGenomes-Gn; TBFG_14015.
DR   EnsemblGenomes-Gn; TBFG_14016.
DR   EnsemblGenomes-Gn; TBFG_14017.
DR   EnsemblGenomes-Gn; TBFG_14018.
DR   EnsemblGenomes-Gn; TBFG_14019.
DR   EnsemblGenomes-Gn; TBFG_14020.
DR   EnsemblGenomes-Gn; TBFG_14021.
DR   EnsemblGenomes-Gn; TBFG_14022.
DR   EnsemblGenomes-Gn; TBFG_14023.
DR   EnsemblGenomes-Gn; TBFG_14024.
DR   EnsemblGenomes-Gn; TBFG_14025.
DR   EnsemblGenomes-Gn; TBFG_14026.
DR   EnsemblGenomes-Gn; TBFG_14027.
DR   EnsemblGenomes-Gn; TBFG_14028.
DR   EnsemblGenomes-Gn; TBFG_14029.
DR   EnsemblGenomes-Gn; TBFG_14030.
DR   EnsemblGenomes-Gn; TBFG_14031.
DR   EnsemblGenomes-Gn; TBFG_14032.
DR   EnsemblGenomes-Gn; TBFG_14033.
DR   EnsemblGenomes-Gn; TBFG_14034.
DR   EnsemblGenomes-Gn; TBFG_14035.
DR   EnsemblGenomes-Gn; TBFG_14036.
DR   EnsemblGenomes-Gn; TBFG_14037.
DR   EnsemblGenomes-Gn; TBFG_14038.
DR   EnsemblGenomes-Gn; TBFG_14039.
DR   EnsemblGenomes-Gn; TBFG_14040.
DR   EnsemblGenomes-Gn; TBFG_14041.
DR   EnsemblGenomes-Gn; TBFG_14042.
DR   EnsemblGenomes-Gn; TBFG_14043.
DR   EnsemblGenomes-Gn; TBFG_14044.
DR   EnsemblGenomes-Gn; TBFG_14045.
DR   EnsemblGenomes-Gn; TBFG_14046.
DR   EnsemblGenomes-Gn; TBFG_14047.
DR   EnsemblGenomes-Gn; TBFG_14048.
DR   EnsemblGenomes-Tr; EBT00001780975.
DR   EnsemblGenomes-Tr; EBT00001780976.
DR   EnsemblGenomes-Tr; EBT00001780977.
DR   EnsemblGenomes-Tr; EBT00001780978.
DR   EnsemblGenomes-Tr; EBT00001780979.
DR   EnsemblGenomes-Tr; EBT00001780980.
DR   EnsemblGenomes-Tr; EBT00001780981.
DR   EnsemblGenomes-Tr; EBT00001780982.
DR   EnsemblGenomes-Tr; EBT00001780983.
DR   EnsemblGenomes-Tr; EBT00001780984.
DR   EnsemblGenomes-Tr; EBT00001780985.
DR   EnsemblGenomes-Tr; EBT00001780986.
DR   EnsemblGenomes-Tr; EBT00001780987.
DR   EnsemblGenomes-Tr; EBT00001780988.
DR   EnsemblGenomes-Tr; EBT00001780989.
DR   EnsemblGenomes-Tr; EBT00001780990.
DR   EnsemblGenomes-Tr; EBT00001780991.
DR   EnsemblGenomes-Tr; EBT00001780992.
DR   EnsemblGenomes-Tr; EBT00001780993.
DR   EnsemblGenomes-Tr; EBT00001780994.
DR   EnsemblGenomes-Tr; EBT00001780995.
DR   EnsemblGenomes-Tr; EBT00001780996.
DR   EnsemblGenomes-Tr; EBT00001780997.
DR   EnsemblGenomes-Tr; EBT00001780998.
DR   EnsemblGenomes-Tr; EBT00001780999.
DR   EnsemblGenomes-Tr; EBT00001781000.
DR   EnsemblGenomes-Tr; EBT00001781001.
DR   EnsemblGenomes-Tr; EBT00001781002.
DR   EnsemblGenomes-Tr; EBT00001781003.
DR   EnsemblGenomes-Tr; EBT00001781004.
DR   EnsemblGenomes-Tr; EBT00001781005.
DR   EnsemblGenomes-Tr; EBT00001781006.
DR   EnsemblGenomes-Tr; EBT00001781007.
DR   EnsemblGenomes-Tr; EBT00001781008.
DR   EnsemblGenomes-Tr; EBT00001781009.
DR   EnsemblGenomes-Tr; EBT00001781010.
DR   EnsemblGenomes-Tr; EBT00001781011.
DR   EnsemblGenomes-Tr; EBT00001781012.
DR   EnsemblGenomes-Tr; EBT00001781013.
DR   EnsemblGenomes-Tr; EBT00001781014.
DR   EnsemblGenomes-Tr; EBT00001781015.
DR   EnsemblGenomes-Tr; EBT00001781016.
DR   EnsemblGenomes-Tr; EBT00001781017.
DR   EnsemblGenomes-Tr; EBT00001781018.
DR   EnsemblGenomes-Tr; EBT00001781019.
DR   EnsemblGenomes-Tr; EBT00001781020.
DR   EnsemblGenomes-Tr; EBT00001781021.
DR   EnsemblGenomes-Tr; EBT00001781022.
DR   EnsemblGenomes-Tr; EBT00001781023.
DR   EnsemblGenomes-Tr; EBT00001781024.
DR   EnsemblGenomes-Tr; EBT00001781025.
DR   EnsemblGenomes-Tr; EBT00001781026.
DR   EnsemblGenomes-Tr; EBT00001781027.
DR   EnsemblGenomes-Tr; EBT00001781028.
DR   EnsemblGenomes-Tr; EBT00001781029.
DR   EnsemblGenomes-Tr; EBT00001781030.
DR   EnsemblGenomes-Tr; EBT00001781031.
DR   EnsemblGenomes-Tr; EBT00001781032.
DR   EnsemblGenomes-Tr; EBT00001781033.
DR   EnsemblGenomes-Tr; EBT00001781034.
DR   EnsemblGenomes-Tr; EBT00001781035.
DR   EnsemblGenomes-Tr; EBT00001781036.
DR   EnsemblGenomes-Tr; EBT00001781037.
DR   EnsemblGenomes-Tr; EBT00001781038.
DR   EnsemblGenomes-Tr; EBT00001781039.
DR   EnsemblGenomes-Tr; EBT00001781040.
DR   EnsemblGenomes-Tr; EBT00001781041.
DR   EnsemblGenomes-Tr; EBT00001781042.
DR   EnsemblGenomes-Tr; EBT00001781043.
DR   EnsemblGenomes-Tr; TBFG_11738.
DR   EnsemblGenomes-Tr; TBFG_11779.
DR   EnsemblGenomes-Tr; TBFG_11805.
DR   EnsemblGenomes-Tr; TBFG_11822.
DR   EnsemblGenomes-Tr; TBFG_12047.
DR   EnsemblGenomes-Tr; TBFG_12055.
DR   EnsemblGenomes-Tr; TBFG_12311.
DR   EnsemblGenomes-Tr; TBFG_12415.
DR   EnsemblGenomes-Tr; TBFG_13130.
DR   EnsemblGenomes-Tr; TBFG_14001-1.
DR   EnsemblGenomes-Tr; TBFG_14002-1.
DR   EnsemblGenomes-Tr; TBFG_14003-1.
DR   EnsemblGenomes-Tr; TBFG_14004-1.
DR   EnsemblGenomes-Tr; TBFG_14005-1.
DR   EnsemblGenomes-Tr; TBFG_14006-1.
DR   EnsemblGenomes-Tr; TBFG_14007-1.
DR   EnsemblGenomes-Tr; TBFG_14008-1.
DR   EnsemblGenomes-Tr; TBFG_14009-1.
DR   EnsemblGenomes-Tr; TBFG_14010-1.
DR   EnsemblGenomes-Tr; TBFG_14011-1.
DR   EnsemblGenomes-Tr; TBFG_14012-1.
DR   EnsemblGenomes-Tr; TBFG_14013-1.
DR   EnsemblGenomes-Tr; TBFG_14014-1.
DR   EnsemblGenomes-Tr; TBFG_14015-1.
DR   EnsemblGenomes-Tr; TBFG_14016-1.
DR   EnsemblGenomes-Tr; TBFG_14017-1.
DR   EnsemblGenomes-Tr; TBFG_14018-1.
DR   EnsemblGenomes-Tr; TBFG_14019-1.
DR   EnsemblGenomes-Tr; TBFG_14020-1.
DR   EnsemblGenomes-Tr; TBFG_14021-1.
DR   EnsemblGenomes-Tr; TBFG_14022-1.
DR   EnsemblGenomes-Tr; TBFG_14023-1.
DR   EnsemblGenomes-Tr; TBFG_14024-1.
DR   EnsemblGenomes-Tr; TBFG_14025-1.
DR   EnsemblGenomes-Tr; TBFG_14026-1.
DR   EnsemblGenomes-Tr; TBFG_14027-1.
DR   EnsemblGenomes-Tr; TBFG_14028-1.
DR   EnsemblGenomes-Tr; TBFG_14029-1.
DR   EnsemblGenomes-Tr; TBFG_14030-1.
DR   EnsemblGenomes-Tr; TBFG_14031-1.
DR   EnsemblGenomes-Tr; TBFG_14032-1.
DR   EnsemblGenomes-Tr; TBFG_14033-1.
DR   EnsemblGenomes-Tr; TBFG_14034-1.
DR   EnsemblGenomes-Tr; TBFG_14035-1.
DR   EnsemblGenomes-Tr; TBFG_14036-1.
DR   EnsemblGenomes-Tr; TBFG_14037-1.
DR   EnsemblGenomes-Tr; TBFG_14038-1.
DR   EnsemblGenomes-Tr; TBFG_14039-1.
DR   EnsemblGenomes-Tr; TBFG_14040-1.
DR   EnsemblGenomes-Tr; TBFG_14041-1.
DR   EnsemblGenomes-Tr; TBFG_14042-1.
DR   EnsemblGenomes-Tr; TBFG_14043-1.
DR   EnsemblGenomes-Tr; TBFG_14044-1.
DR   EnsemblGenomes-Tr; TBFG_14045-1.
DR   EnsemblGenomes-Tr; TBFG_14046-1.
DR   EnsemblGenomes-Tr; TBFG_14047-1.
DR   EnsemblGenomes-Tr; TBFG_14048-1.
DR   EuropePMC; PMC2228276; 18081934.
DR   EuropePMC; PMC2756628; 19823582.
DR   EuropePMC; PMC2976163; 20805400.
DR   EuropePMC; PMC3036846; 21637484.
DR   EuropePMC; PMC3089889; 21584191.
DR   EuropePMC; PMC3497208; 23006760.
DR   EuropePMC; PMC3738908; 23929492.
DR   EuropePMC; PMC4237348; 25409509.
DR   EuropePMC; PMC4425900; 25879806.
DR   EuropePMC; PMC5310062; 28201993.
DR   EuropePMC; PMC6364042; 30583062.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01779; AS1726.
DR   RFAM; RF01780; AS1890.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01783; b55.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01798; g2.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000717.
DR   SILVA-SSU; CP000717.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4424435
FT                   /organism="Mycobacterium tuberculosis F11"
FT                   /strain="F11"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:336982"
FT   gene            102..1625
FT                   /locus_tag="TBFG_10001"
FT                   /old_locus_tag="TBFG_00001"
FT   CDS_pept        102..1625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10001"
FT                   /old_locus_tag="TBFG_00001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /note="Mapped to H37Rv Rv0001"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04344"
FT                   /protein_id="ABR04344.1"
FT                   /translation="MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPA
FT                   TDEADDTTVPPSENPATTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPHNTDSATA
FT                   GVTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAG
FT                   NYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEG
FT                   IQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIA
FT                   ILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVL
FT                   RDLIADANTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLS
FT                   LPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
FT   gene            2153..3361
FT                   /locus_tag="TBFG_10002"
FT                   /old_locus_tag="TBFG_00002"
FT   CDS_pept        2153..3361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10002"
FT                   /old_locus_tag="TBFG_00002"
FT                   /product="DNA polymerase III beta subunit dnaN (DNA
FT                   nucleotidyltransferase)"
FT                   /note="Mapped to H37Rv Rv0002"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04345"
FT                   /protein_id="ABR04345.1"
FT                   /translation="MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGV
FT                   LLTGSDNGLTISGFDYEVSAEAQVGAEIVSPGSVLVSGRLLSDITRALPNKPVDVHVEG
FT                   NRVALTCGNARFSLPTMPVEDYPTLPTLPEETGLLPAELFAEAISQVAIAAGRDDTLPM
FT                   LTGIRVEILGETVVLAATDRFRLAVRELKWSASSPDIEAAVLVPAKTLAEAAKAGIGGS
FT                   DVRLSLGTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELI
FT                   EAIKLVALVADRGAQVRMEFADGSVRLSAGADDVGRAEEDLVVDYAGEPLTIAFNPTYL
FT                   TDGLSSLRSERVSFGFTTAGKPALLRPVSGDDRPVAGLNGNGPFPAVSTDYVYLLMPVR
FT                   LPG"
FT   gene            3381..4538
FT                   /locus_tag="TBFG_10003"
FT                   /old_locus_tag="TBFG_00003"
FT   CDS_pept        3381..4538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10003"
FT                   /old_locus_tag="TBFG_00003"
FT                   /product="DNA replication and repair protein recF
FT                   (single-strand DNA binding protein)"
FT                   /note="Mapped to H37Rv Rv0003"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04346"
FT                   /protein_id="ABR04346.1"
FT                   /translation="MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWY
FT                   STTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRECAVDLEIATGRVNKARLNRSSVRS
FT                   TRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVLRQRTA
FT                   LLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPE
FT                   SRSASIGYRASMDVTGPSEQSDTDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLI
FT                   LRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEPVLLLDDVFAELDVMRRRALA
FT                   TAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP"
FT   gene            4535..5098
FT                   /locus_tag="TBFG_10004"
FT                   /old_locus_tag="TBFG_00004"
FT   CDS_pept        4535..5098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10004"
FT                   /old_locus_tag="TBFG_00004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0004"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04347"
FT                   /protein_id="ABR04347.1"
FT                   /translation="MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGR
FT                   GRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSA
FT                   VVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKIT
FT                   GPAAPSWRKGPRHIAGRGPRDTYG"
FT   gene            5224..7368
FT                   /locus_tag="TBFG_10005"
FT                   /old_locus_tag="TBFG_00005"
FT   CDS_pept        5224..7368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10005"
FT                   /old_locus_tag="TBFG_00005"
FT                   /product="DNA gyrase subunit B gyrB"
FT                   /note="Mapped to H37Rv Rv0005"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04348"
FT                   /protein_id="ABR04348.1"
FT                   /translation="MGKNEARRSALAPDHGTVVCDPLRRLNRMHATPEESIRIVAAQKK
FT                   KAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTV
FT                   NVVLLEDGGVEVADDGRGIPVATHASGILTVDVVMTQLHAGGKFDSDAYAISGGLHGVG
FT                   VSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETT
FT                   EYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTA
FT                   PHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSESV
FT                   HTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISV
FT                   KVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIA
FT                   ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
FT                   LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDG
FT                   QHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLK
FT                   AGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGED
FT                   VDARRSFITRNAKDVRFLDV"
FT   gene            7403..9919
FT                   /locus_tag="TBFG_10006"
FT                   /old_locus_tag="TBFG_00006"
FT   CDS_pept        7403..9919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10006"
FT                   /old_locus_tag="TBFG_00006"
FT                   /product="DNA gyrase subunit A gyrA"
FT                   /note="Mapped to H37Rv Rv0006"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04349"
FT                   /protein_id="ABR04349.1"
FT                   /translation="MTDTTLPPDDSLDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEVR
FT                   DGLKPVHRRVLYAMFDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPWS
FT                   LRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDGRVQEP
FT                   TVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVFWALENHDADEEETLAAVMGR
FT                   VKGPDFPTAGLIVGSQGTADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQVNHD
FT                   NFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQTS
FT                   FGANMLAIVDGVPRTLRLDQLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALD
FT                   ALDEVIALIRASETVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKI
FT                   EAEIADLEDILAKPERQRGIVRDELAEIVDRHGDDRRTRIIAADGDVSDEDLIAREDVV
FT                   VTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVAHFFVCSTHDLILFFTTQGRV
FT                   YRAKAYDLPEASRTARGQHVANLLAFQPEERIAQVIQIRGYTDAPYLVLATRNGLVKKS
FT                   KLTDFDSNRSGGIVAVNLRDNDELVGAVLCSADDDLLLVSANGQSIRFSATDEALRPMG
FT                   RATSGVQGMRFNIDDRLLSLNVVREGTYLLVATSGGYAKRTAIEEYPVQGRGGKGVLTV
FT                   MYDRRRGRLVGALIVDDDSELYAVTSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGDTL
FT                   LAIARNAEESGDDNAVDANGADQTGN"
FT   gene            10015..10929
FT                   /locus_tag="TBFG_10007"
FT                   /old_locus_tag="TBFG_00007"
FT   CDS_pept        10015..10929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10007"
FT                   /old_locus_tag="TBFG_00007"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0007"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04350"
FT                   /protein_id="ABR04350.1"
FT                   /translation="MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPP
FT                   WQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQ
FT                   PDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSG
FT                   GRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAF
FT                   LYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATI
FT                   GAFVYNLITDLIGGIEVTLADRD"
FT   gene            10988..11064
FT                   /locus_tag="TBFG_14001"
FT   tRNA            10988..11064
FT                   /locus_tag="TBFG_14001"
FT                   /product="tRNA-Ile"
FT   gene            11213..11288
FT                   /locus_tag="TBFG_14002"
FT   tRNA            11213..11288
FT                   /locus_tag="TBFG_14002"
FT                   /product="tRNA-Ala"
FT   gene            complement(11975..12412)
FT                   /locus_tag="TBFG_10008"
FT                   /old_locus_tag="TBFG_00008"
FT   CDS_pept        complement(11975..12412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10008"
FT                   /old_locus_tag="TBFG_00008"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0008c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04351"
FT                   /protein_id="ABR04351.1"
FT                   /translation="MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSA
FT                   RSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLW
FT                   IFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRP"
FT   gene            12569..13117
FT                   /locus_tag="TBFG_10009"
FT                   /old_locus_tag="TBFG_00009"
FT   CDS_pept        12569..13117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10009"
FT                   /old_locus_tag="TBFG_00009"
FT                   /product="iron-regulated
FT                   peptidyl-prolyl-cis-trans-isomerase A ppiA"
FT                   /note="Mapped to H37Rv Rv0009"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04352"
FT                   /protein_id="ABR04352.1"
FT                   /translation="MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGL
FT                   AQGTKDYSTQNASGGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPE
FT                   LQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTA
FT                   TDGNDRPTDPVVIESITIS"
FT   gene            complement(13234..13659)
FT                   /locus_tag="TBFG_10010"
FT                   /old_locus_tag="TBFG_00010"
FT   CDS_pept        complement(13234..13659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10010"
FT                   /old_locus_tag="TBFG_00010"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0010c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04353"
FT                   /protein_id="ABR04353.1"
FT                   /translation="MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAAL
FT                   GLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEI
FT                   ETVSGGLLILSRWDLGTDPVEVLDALTAAGYAGRGQR"
FT   gene            complement(13815..14096)
FT                   /locus_tag="TBFG_10011"
FT                   /old_locus_tag="TBFG_00011"
FT   CDS_pept        complement(13815..14096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10011"
FT                   /old_locus_tag="TBFG_00011"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0011c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04354"
FT                   /protein_id="ABR04354.1"
FT                   /translation="MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGL
FT                   IWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH"
FT   gene            14190..14978
FT                   /locus_tag="TBFG_10012"
FT                   /old_locus_tag="TBFG_00012"
FT   CDS_pept        14190..14978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10012"
FT                   /old_locus_tag="TBFG_00012"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0012"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04355"
FT                   /protein_id="ABR04355.1"
FT                   /translation="MRLTHPTPCPENGETMIDRRRSAWRFSVPLVCLLAGLLLAATHGV
FT                   SGGTEIRRSNAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSA
FT                   KLAGVAAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGA
FT                   EAIQMQDQRIIAMSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTLYK
FT                   QYVVRFGLGYREEVHPDLQIVGYADPVRMHFAQPAGPLDY"
FT   gene            15015..15713
FT                   /locus_tag="TBFG_10013"
FT                   /old_locus_tag="TBFG_00013"
FT   CDS_pept        15015..15713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10013"
FT                   /old_locus_tag="TBFG_00013"
FT                   /product="anthranilate synthase component II trpG
FT                   (glutamine amidotransferase)"
FT                   /note="Mapped to H37Rv Rv0013"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04356"
FT                   /protein_id="ABR04356.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAG
FT                   QFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELL
FT                   HGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTG
FT                   LPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTAS
FT                   AGEATGRTSA"
FT   gene            complement(15691..17571)
FT                   /locus_tag="TBFG_10014"
FT                   /old_locus_tag="TBFG_00014"
FT   CDS_pept        complement(15691..17571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10014"
FT                   /old_locus_tag="TBFG_00014"
FT                   /product="transmembrane serine/threonine-protein kinase B
FT                   pknB"
FT                   /note="Mapped to H37Rv Rv0014c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04357"
FT                   /protein_id="ABR04357.1"
FT                   /translation="MTTPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIV
FT                   HTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAI
FT                   ADSGNSVTQTAAVIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPV
FT                   SVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEP
FT                   PEAPKVLTDAERTSLLSSAAGNLSGPRTDPLPRQDLDDTDRDRSIGSVGRWVAVVAVLA
FT                   VLTVVVTIAINTFGGITRDVQVPDVRGQSSADAIATLQNRGFKIRTLQKPDSTIPPDHV
FT                   IGTDPAANTSVSAGDEITVNVSTGPEQREIPDVSTLTYAEAVKKLTAAGFGRFKQANSP
FT                   STPELVGKVIGTNPPANQTSAITNVVIIIVGSGPATKDIPDVAGQTVDVAQKNLNVYGF
FT                   TKFSQASVDSPRPAGEVTGTNPPAGTTVPVDSVIELQVSKGNQFVMPDLSGMFWVDAEP
FT                   RLRALGWTGMLDKGADVDAGGSQHNRVVYQNPPAGTGVNRDGIITLRFGQ"
FT   gene            complement(17568..18863)
FT                   /locus_tag="TBFG_10015"
FT                   /old_locus_tag="TBFG_00015"
FT   CDS_pept        complement(17568..18863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10015"
FT                   /old_locus_tag="TBFG_00015"
FT                   /product="transmembrane serine/threonine-protein kinase A
FT                   pknA"
FT                   /note="Mapped to H37Rv Rv0015c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04358"
FT                   /protein_id="ABR04358.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLK
FT                   SEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGA
FT                   LTVAMKHIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPP
FT                   RPSQTPPPGRAAPAAIPSGTTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRAL
FT                   LWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWT
FT                   ERGETRHSGLQSWVVPPTPHSRASLARYEIAQ"
FT   gene            complement(18860..20335)
FT                   /locus_tag="TBFG_10016"
FT                   /old_locus_tag="TBFG_00016"
FT   CDS_pept        complement(18860..20335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10016"
FT                   /old_locus_tag="TBFG_00016"
FT                   /product="penicillin-binding protein pbpA"
FT                   /note="Mapped to H37Rv Rv0016c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04359"
FT                   /protein_id="ABR04359.1"
FT                   /translation="MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVATDGRFRFLRVYPNPEVYAPVTGFYSLRYSSTALERAE
FT                   DPILNGSDRRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKGAVV
FT                   ALEPSTGKILALVSSPSYDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGS
FT                   TFKVITTAAALAAGATETEQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKS
FT                   CNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLQVAESTVGPIPDSAALGMTSIGQK
FT                   DVALTPLANAEIAATIANGGITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKL
FT                   TELMVGAEKVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGADRLSATGGALAAPIGRAVIEAALQGEP"
FT   gene            complement(20332..21741)
FT                   /locus_tag="TBFG_10017"
FT                   /old_locus_tag="TBFG_00017"
FT   CDS_pept        complement(20332..21741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10017"
FT                   /old_locus_tag="TBFG_00017"
FT                   /product="cell division protein rodA"
FT                   /note="Mapped to H37Rv Rv0017c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04360"
FT                   /protein_id="ABR04360.1"
FT                   /translation="MTTRLQAPVAVTPPLPTRRNAELLLLCFAAVITFAALLVVQANQD
FT                   QGVPWDLTSYGLAFLTLFGSAHLAIRRFAPYTDPLLLPVVALLNGLGLVMIHRLDLVDN
FT                   EIGEHRHPSANQQMLWTLVGVAAFALVVTFLKDHRQLARYGYICGLAGLVFLAVPALLP
FT                   AALSEQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKRGLFTSAGKHLLGMTLPR
FT                   PRDLAPLLAAWVISVGVMVFEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGT
FT                   LVAYFIFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFATGGIFGTGLGNGQPDTVPAA
FT                   STDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQL
FT                   FIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYILLAILARISHGARRPLRTRPRNKSPI
FT                   TAAGTEVIERV"
FT   gene            complement(21738..23282)
FT                   /locus_tag="TBFG_10018"
FT                   /old_locus_tag="TBFG_00018"
FT   CDS_pept        complement(21738..23282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10018"
FT                   /old_locus_tag="TBFG_00018"
FT                   /product="serine/threonine phosphatase ppp"
FT                   /note="Mapped to H37Rv Rv0018c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04361"
FT                   /protein_id="ABR04361.1"
FT                   /translation="MARVTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAA
FT                   GEVASQLVIAALAHLDDDEPGGDLLAKLDAAVRAGNSAIAAQVEMEPDLEGMGTTLTAI
FT                   LFAGNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITPEEAHSHPQRSLIM
FT                   RALTGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETILEALQIPEVAESAHRLIELA
FT                   LRGGGPDNVTVVVADVVDYDYGQTQPILAGAVSGDDDQLTLPNTAAGRASAISQRKEIV
FT                   KRVPPQADTFSRPRWSGRRLAFVVALVTVLMTAGLLIGRAIIRSNYYVADYAGSVSIMR
FT                   GIQGSLLGMSLHQPYLMGCLSPRNELSQISYGQSGGPLDCHLMKLEDLRPPERAQVRAG
FT                   LPAGTLDDAIGQLRELAANSLLPPCPAPRATSPPGRPAPPTTSETTEPNVTSSPASPSP
FT                   TTSASAPTGTTPAIPTSASPAAPASPPTPWPVTSSPTMAALPPPPPQPGIDCRAAA"
FT   gene            complement(23371..23838)
FT                   /locus_tag="TBFG_10019"
FT                   /old_locus_tag="TBFG_00019"
FT   CDS_pept        complement(23371..23838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10019"
FT                   /old_locus_tag="TBFG_00019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0019c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04362"
FT                   /protein_id="ABR04362.1"
FT                   /translation="MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGL
FT                   ALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP"
FT   gene            complement(23962..25545)
FT                   /locus_tag="TBFG_10020"
FT                   /old_locus_tag="TBFG_00020"
FT   CDS_pept        complement(23962..25545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10020"
FT                   /old_locus_tag="TBFG_00020"
FT                   /product="conserved hypothetical protein TB39.8"
FT                   /note="Mapped to H37Rv Rv0020c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04363"
FT                   /protein_id="ABR04363.1"
FT                   /translation="MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAA
FT                   DGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPELKSTGFARDLADYIQEQGWQTYGDV
FT                   VVRFEQSSNLHTGQFRARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNSSYR
FT                   GGQGQGRPDEYYDDRYARPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPD
FT                   QGDYPEQIGYPDQGGYPEQRGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPV
FT                   SPGPAAGYGAPGYDQGYRQSGGYGPSPGGGQPGYGGYGEYGRGPARHEEGSYVPSGPPG
FT                   PPEQRPAYPDQGGYDQGYQQGATTYGRQDYGGGADYTRYTESPRVPGYAPQGGGYAEPA
FT                   GRDYDYGQSGAPDYGQPAPGGYSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIG
FT                   RGQDAQFRLPDTGVSRRHLEIRWDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRL
FT                   GHSEIIVRMH"
FT   gene            25745..25830
FT                   /locus_tag="TBFG_14003"
FT   tRNA            25745..25830
FT                   /locus_tag="TBFG_14003"
FT                   /product="tRNA-Leu"
FT   gene            complement(26014..26982)
FT                   /locus_tag="TBFG_10021"
FT                   /old_locus_tag="TBFG_00021"
FT   CDS_pept        complement(26014..26982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10021"
FT                   /old_locus_tag="TBFG_00021"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0021c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04364"
FT                   /protein_id="ABR04364.1"
FT                   /translation="MVLSTAFSQMFGIDYPIVSAPMDLIAGGELAAAVSGAGGLGLIGG
FT                   GYGDRDWLARQFDLAAGAPVGCGFITWSLARQPQLLDLALQYEPVAVMLSFGDPAVFAD
FT                   AIKSAGTRLVCQIQNRTQAERALQVGADVLVAQGTEAGGHGHGPRSTLTLVPEIVDLVT
FT                   ARGTDIPVIAAGGIADGRGLAAALMLGAAGVLVGTRFYATVEALSTPQARDPLLAATGD
FT                   DMCRTTIYDQLRRYPWPQGHTMSVLSNALTDQFEDTELDILHREEAMARYWRAVAARDY
FT                   SIANVTAGQAAGLVNAVLPAADVITGMAQQAARTLTAMRAV"
FT   gene            complement(27124..27543)
FT                   /locus_tag="TBFG_10022"
FT                   /old_locus_tag="TBFG_00022"
FT   CDS_pept        complement(27124..27543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10022"
FT                   /old_locus_tag="TBFG_00022"
FT                   /product="transcriptional regulatory protein whib-like
FT                   whiB5"
FT                   /note="Mapped to H37Rv Rv0022c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04365"
FT                   /protein_id="ABR04365.1"
FT                   /translation="MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRC
FT                   PLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLP
FT                   DNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA"
FT   gene            27696..28466
FT                   /locus_tag="TBFG_10023"
FT                   /old_locus_tag="TBFG_00023"
FT   CDS_pept        27696..28466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10023"
FT                   /old_locus_tag="TBFG_00023"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0023"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04366"
FT                   /protein_id="ABR04366.1"
FT                   /translation="MSRESAGAAIRALRESRDWSLADLAAATGVSTMGLSYLERGARKP
FT                   HKSTVQKVENGLGLPPGTYSRLLVAADPDAELARLIAAQPSNPTAVRRAGAVVVDRHSD
FT                   TDVLEGYAEAQLDAIKSVIDRLPATTSNEYETYILSVIAQCVKAEMLAASSWRVAVNAG
FT                   ADSTGRLMEHLRALEATRGALLERMPTSLSARFDRACAQSSLPEAVVAALIGVGADEMW
FT                   DIRNRGVIPAGALPRVRAFVDAIEASHDADEGQQ"
FT   gene            28463..29308
FT                   /locus_tag="TBFG_10024"
FT                   /old_locus_tag="TBFG_00024"
FT   CDS_pept        28463..29308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10024"
FT                   /old_locus_tag="TBFG_00024"
FT                   /product="hypothetical secreted protein (P60-related
FT                   protein)"
FT                   /note="Mapped to H37Rv Rv0024"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04367"
FT                   /protein_id="ABR04367.1"
FT                   /translation="MNYSEVELLSRAHQLFAGDSRRPGLDAGTTPYGDLLSRAADLNVG
FT                   AGQRRYQLAVDHSRAALLSAARTDAAAGAVITGAQRDRAWARRSTGTVLDEARSDTTVT
FT                   AVMPIAQREAIRRRVARLRAQRAHVLTARRRARRHLAALRALRYRVAHGPGVALAKLRL
FT                   PSPSGRAGIAVHAALSRLGRPYVWGATGPNQFDCSGLVQWAYAQAGVHLDRTTYQQINE
FT                   GIPVPRSQVRPGDLVFPHPGHVQLAIGNNLVVEAPHAGASVRVSSLGNNVQIRRPLSGR
FT                   "
FT   gene            29346..29708
FT                   /locus_tag="TBFG_10025"
FT                   /old_locus_tag="TBFG_00025"
FT   CDS_pept        29346..29708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10025"
FT                   /old_locus_tag="TBFG_00025"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0025"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04368"
FT                   /protein_id="ABR04368.1"
FT                   /translation="MSEQAGSSVAVIQERQALLARQHDAVAEADRELADVLASAHAAMR
FT                   ESVRRLDAIAAELDRAVPDQDQLAVDTPMGAREFQTFLVAKQREIVAVVAAAHELDRAK
FT                   SAVLKRLRAQYTEPAR"
FT   gene            29823..31169
FT                   /locus_tag="TBFG_10026"
FT                   /old_locus_tag="TBFG_00026"
FT   CDS_pept        29823..31169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10026"
FT                   /old_locus_tag="TBFG_00026"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0026"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04369"
FT                   /protein_id="ABR04369.1"
FT                   /translation="MAFDAAMSTHEDLLATIRYVRDRTGDPNAWQTGLTPTEVTAVVTS
FT                   TTRSEQLDAILRKIRQRHSNLYYPAPPDREQGDAARAIADAEAALAHQNSATAQLDLQV
FT                   VSAILNAHLKTVEGGESLHELQQEIEAAVRIRSDLDTPAGARDFQRFLIGKLKDIREVV
FT                   ATASLDAASKSALMAAWTSLYDASKGDRGDADDRGPASVGSGGAPARGAGQQPELPTRA
FT                   EPDCLLDSLLLEDPGLLADDLQVPGGTSAAIPSASSTPSLPNLGGATMPGGGATPALVP
FT                   GVSAPGGLPLSGLLRGVGDEPELTDFDERGQEVRDPADYEHSNEPDERRADDREGADED
FT                   AGLGKSESPPQAPTTVTLPNGETVTAASPQLAAAIKAAASGTPIADAFQQQGIAIPLPG
FT                   TAVANPVDPARISAGDVGVFTATPLPLALAKLFWTARFNTSQPCEGQTF"
FT   gene            31290..31607
FT                   /locus_tag="TBFG_10027"
FT                   /old_locus_tag="TBFG_00027"
FT   CDS_pept        31290..31607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10027"
FT                   /old_locus_tag="TBFG_00027"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0027"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04370"
FT                   /protein_id="ABR04370.1"
FT                   /translation="MTDRIHVQPAHLRQAAAHHQQTADYLRTVPSSHDAIRESLDSLGP
FT                   IFSELRDTGRELLELRKQCYQQQADNHADIAQNLRTSAAMWEQHERAASRSLGNIIDGS
FT                   R"
FT   gene            31615..31920
FT                   /locus_tag="TBFG_10028"
FT                   /old_locus_tag="TBFG_00028"
FT   CDS_pept        31615..31920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10028"
FT                   /old_locus_tag="TBFG_00028"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0028"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04371"
FT                   /protein_id="ABR04371.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
FT   gene            32158..33255
FT                   /locus_tag="TBFG_10029"
FT                   /old_locus_tag="TBFG_00029"
FT   CDS_pept        32158..33255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10029"
FT                   /old_locus_tag="TBFG_00029"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0029"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04372"
FT                   /protein_id="ABR04372.1"
FT                   /translation="MAIFGRWSARQRLRRATRESLTIPTFSSSLDCTTRVIGGLWPAEL
FT                   SSNTAETATLAEHLKADLHRIVGSANDELMVIWRAGMADSTRRAEEDRVIDRARASAMR
FT                   RVESAMRELRQITGRVPVEIPRMRGAGGSDLDTTRLMPAVTVVQPADQACTDWPVAAAE
FT                   DDEARLQRLLAFVARQEPRLNWAVGVHADGTTVLVTDVAHGWIPPGIALPEGVRLLAPA
FT                   RRAGRAPELVGITTCCKTYTPGDSLRRAVDSTAPTSSVQPRALPAIAGLSVELGIATQR
FT                   HDGLPKIVHAMATAAGNGAAAEEVDLLRVHVDTALHHVLAQYPRVDPALLLNCMLLAAT
FT                   ERSVTGDPIAANYHFAWFRELDSRR"
FT   gene            33325..33900
FT                   /locus_tag="TBFG_10030"
FT                   /old_locus_tag="TBFG_00030"
FT   CDS_pept        33325..33900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10030"
FT                   /old_locus_tag="TBFG_00030"
FT                   /product="transposase"
FT                   /note="Mapped to H37Rv Rv0029"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04373"
FT                   /protein_id="ABR04373.1"
FT                   /translation="MVSGSDSRSEPSQLSDRDLVESVLRDLSEAADKWEALVTQAETVT
FT                   YSVDLGDVRAVANSDGRLLELTLHPGVMTGYAHGELADRVNLAITALRDEVEAENRARY
FT                   GGRLQGHRYLRGSSPFAGKAFRRGAQGPQPGRGHPESRYPSLAPGWHPDPEAAMRIRCV
FT                   RANRSHEPPINSEEPGGAGSIRGTACLT"
FT   gene            34396..36711
FT                   /locus_tag="TBFG_10031"
FT                   /old_locus_tag="TBFG_00031"
FT   CDS_pept        34396..36711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10031"
FT                   /old_locus_tag="TBFG_00031"
FT                   /product="8-amino-7-oxononanoate synthase bioF2"
FT                   /note="Mapped to H37Rv Rv0032"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04374"
FT                   /protein_id="ABR04374.1"
FT                   /translation="MPTGLGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVC
FT                   FDLATTDRKLTPAWRTTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLA
FT                   GQMDQLAHDDGSDFLMIRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEAL
FT                   GCLSHKRRLPLKTSLEFRERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNP
FT                   EFFAACSRHLHGRSRLWLFRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLY
FT                   RAALMLSLKDAISRDKRRMEMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARM
FT                   MMHNIQRPTLPDDMSEEFCRWEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFY
FT                   PRFTGPQRSTVKAAELGEIVLLGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNG
FT                   TLDLHVSLEQELACFLGKPAAVLCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAA
FT                   RLSGADFTLYRHNDMDHLARVLRRTEGRRRIIVVDAVFSMEGTVADLATIAELADRHGC
FT                   RVYVDESHALGVLGPDGRGASAALGVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIR
FT                   HNGSGHVFSASLPPAAAAATHAALRVSRREPDRRARVLAAAEYMATGLARQGYQAEYHG
FT                   TAIVPVILGNPTVAHAGYLRLMRSGVYVNPVAPPAVPEERSGFRTSYLADHRQSDLDRA
FT                   LHVFAGLAEDLTPQGAAL"
FT   gene            36708..36971
FT                   /locus_tag="TBFG_10032"
FT                   /old_locus_tag="TBFG_00032"
FT   CDS_pept        36708..36971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10032"
FT                   /old_locus_tag="TBFG_00032"
FT                   /product="acyl carrier protein acpA"
FT                   /note="Mapped to H37Rv Rv0033"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04375"
FT                   /protein_id="ABR04375.1"
FT                   /translation="MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELED
FT                   EFDIAISFRDAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA"
FT   gene            36968..37363
FT                   /locus_tag="TBFG_10033"
FT                   /old_locus_tag="TBFG_00033"
FT   CDS_pept        36968..37363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10033"
FT                   /old_locus_tag="TBFG_00033"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0034"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04376"
FT                   /protein_id="ABR04376.1"
FT                   /translation="MTDDADLDLVRRTFAAFARGDLAELTQCFAPDVEQFVPGKHALAG
FT                   VFRGVDNVVACLGDTAAAADGTMTVTLEDVLSNTDGQVIAVYRLRASRAGKVLDQREAI
FT                   LVTVAGGRITRLSEFYADPAATESFWA"
FT   gene            37360..39048
FT                   /locus_tag="TBFG_10034"
FT                   /old_locus_tag="TBFG_00034"
FT   CDS_pept        37360..39048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10034"
FT                   /old_locus_tag="TBFG_00034"
FT                   /product="fatty-acid-CoA ligase fadD34"
FT                   /note="Mapped to H37Rv Rv0035"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04377"
FT                   /protein_id="ABR04377.1"
FT                   /translation="MTAALLSPAIAWQQISACTDRTLTITCEDSEVISYQDLIARAAAC
FT                   IPPLRRLDLKRGEPVLITAHTNLEFLSCFLGLMLHGAVPVPIPPREALKTTERFMTRLG
FT                   PLLRHHRVLICTPAEHDEIRAAASTDCQISRFTALAEAGDEQFGRATAQQLADTATADW
FT                   PLCTLDDDAYVQYTSGSTAAPRGVVITYRNLLSNMRAMAVGSQFQHGDVMGSWLPLHHD
FT                   MGLVGSLFAALFNSVSAVFTTPHRFLYDPLGFLRLLTSSGATHTFMPNFALEWLINAYH
FT                   RRGADIEGIDLHKMRRLIIASEPVHAEGMRRFAATFAGVGLAPTALGSGYGLAEATVAV
FT                   SMSAPNTGFRTETHAAAEVVTGGRVLPGYEVRIDAAPGARAGTIKLRGDSVAAKAYVGG
FT                   KKLDALDEEGFCDTHDLGFLVDDEIVILGRQDEVFIVHGENRFPYDIEFIIRGESEQHR
FT                   TKVACFGVNERVVVVLESPLDSIIDKAEADRLRCQVVAATGLQLDELITVRRGAIPTTT
FT                   SGKLKRRAVAQAYRDGTLPRLATHAWTADPDSAPKTTRSSLEGAH"
FT   gene            complement(39157..39930)
FT                   /locus_tag="TBFG_10035"
FT                   /old_locus_tag="TBFG_00035"
FT   CDS_pept        complement(39157..39930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10035"
FT                   /old_locus_tag="TBFG_00035"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0036c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04378"
FT                   /protein_id="ABR04378.1"
FT                   /translation="MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQI
FT                   GHLLWTDRVALTAVTDEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRG
FT                   RLHEELLAVPDGRKLAWFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSI
FT                   AHLGVRTRDYAFIVNNLTPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVT
FT                   QRRALSTLDVNAVGEDAQRWLTIAQAFAGPPGRGR"
FT   gene            complement(39978..41303)
FT                   /locus_tag="TBFG_10036"
FT                   /old_locus_tag="TBFG_00036"
FT   CDS_pept        complement(39978..41303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10036"
FT                   /old_locus_tag="TBFG_00036"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0037c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04379"
FT                   /protein_id="ABR04379.1"
FT                   /translation="MPRVEVGLVIHSRMHARAPVDVWRSVRSLPDFWRLLQVRVASQFG
FT                   DGLFQAGLAGALLFNPDRAADPMAIAGAFAVLFLPYSLLGPFAGALMDRWDRRWVLVGA
FT                   NTGRLALIAGVGTILAVGAGDVPLLVGALVANGLARFVASGLSAALPHVVPREQVVTMN
FT                   SVAIASGAVSAFLGANFMLLPRWLLGSGDEGASAIVFLVAIPVSIALLWSLRFGPRVLG
FT                   PDDTERAIHGSAVYAVVTGWLHGARTVVQLPTVAAGLSGLAAHRMVVGINSLLILLLVR
FT                   HVTARAVGGLGTALLFFAATGLGAFLANVLTPTAIRRWGRYATANGALAAAATIQVAAA
FT                   GLLVPVMVVCGFLLGVAGQVVKLCADSAMQMDVDDALRGHVFAVQDALFWVSYILSITV
FT                   AAALIPEHGHAPVFVLFGSAIYLAGLVVHTIVGRRGQPVIGR"
FT   gene            41405..42013
FT                   /locus_tag="TBFG_10037"
FT                   /old_locus_tag="TBFG_00037"
FT   CDS_pept        41405..42013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10037"
FT                   /old_locus_tag="TBFG_00037"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0038"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04380"
FT                   /protein_id="ABR04380.1"
FT                   /translation="MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVE
FT                   HNDGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADP
FT                   EGVPGLRHVAGRLVMVDLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLS
FT                   ALPSDVLVGPRADLWGQVLRRQPLPLSLLATHPIDLSRN"
FT   gene            complement(42105..42452)
FT                   /locus_tag="TBFG_10038"
FT                   /old_locus_tag="TBFG_00038"
FT   CDS_pept        complement(42105..42452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10038"
FT                   /old_locus_tag="TBFG_00038"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0039c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04381"
FT                   /protein_id="ABR04381.1"
FT                   /translation="MFLAGVLCMCAAAASALFGSWSLCHTPTADPTALALRAMAPTQLA
FT                   AAVMLAAGGVVAVAAPGHTALMVVIVCIAGAVGTLAAGSWQSAQYALRRETASPTANCV
FT                   GSCAVCTQACH"
FT   gene            complement(42534..43466)
FT                   /locus_tag="TBFG_10039"
FT                   /old_locus_tag="TBFG_00039"
FT   CDS_pept        complement(42534..43466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10039"
FT                   /old_locus_tag="TBFG_00039"
FT                   /product="secreted proline rich protein mtc28 (proline rich
FT                   28 kda antigen)"
FT                   /note="Mapped to H37Rv Rv0040c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04382"
FT                   /protein_id="ABR04382.1"
FT                   /translation="MIQIARTWRVFAGGMATGFIGVVLVTAGKASADPLLPPPPIPAPV
FT                   SAPATVPPVQNLTALPGGSSNRFSPAPAPAPIASPIPVGAPGSTAVPPLPPPVTPAISG
FT                   TLRDHLREKGVKLEAQRPHGFKALDITLPMPPRWTQVPDPNVPDAFVVIADRLGNSVYT
FT                   SNAQLVVYRLIGDFDPAEAITHGYIDSQKLLAWQTTNASMANFDGFPSSIIEGTYREND
FT                   MTLNTSRRHVIATSGADKYLVSLSVTTALSQAVTDGPATDAIVNGFQVVAHAAPAQAPA
FT                   PAPGSAPVGLPGQAPGYPPAGTLTPVPPR"
FT   gene            43663..46572
FT                   /locus_tag="TBFG_10040"
FT                   /old_locus_tag="TBFG_00040"
FT   CDS_pept        43663..46572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10040"
FT                   /old_locus_tag="TBFG_00040"
FT                   /product="leucyl-tRNA synthetase leuS"
FT                   /note="Mapped to H37Rv Rv0041"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04383"
FT                   /protein_id="ABR04383.1"
FT                   /translation="MTESPTAGPGGVPRADDADSDVPRYRYTAELAARLERTWQENWAR
FT                   LGTFNVPNPVGSLAPPDGAAVPDDKLFVQDMFPYPSGEGLHVGHPLGYIATDVYARYFR
FT                   MVGRNVLHALGFDAFGLPAEQYAVQTGTHPRTRTEANVVNFRRQLGRLGFGHDSRRSFS
FT                   TTDVDFYRWTQWIFLQIYNAWFDTTANKARPISELVAEFESGARCLDGGRDWAKLTAGE
FT                   RADVIDEYRLVYRADSLVNWCPGLGTVLANEEVTADGRSDRGNFPVFRKRLRQWMMRIT
FT                   AYADRLLDDLDVLDWPEQVKTMQRNWIGRSTGAVALFSARAASDDGFEVDIEVFTTRPD
FT                   TLFGATYLVLAPEHDLVDELVAASWPAGVNPLWTYGGGTPGEAIAAYRRAIAAKSDLER
FT                   QESREKTGVFLGSYAINPANGEPVPIFIADYVLAGYGTGAIMAVPGHDQRDWDFARAFG
FT                   LPIVEVIAGGNISESAYTGDGILVNSDYLNGMSVPAAKRAIVDRLESAGRGRARIEFKL
FT                   RDWLFARQRYWGEPFPIVYDSDGRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSP
FT                   PLAKATEWVHVDLDLGDGLKPYSRDTNVMPQWAGSSWYELRYTDPHNSERFCAKENEAY
FT                   WMGPRPAEHGPDDPGGVDLYVGGAEHAVLHLLYSRFWHKVLYDLGHVSSREPYRRLVNQ
FT                   GYIQAYAYTDARGSYVPAEQVIERGDRFVYPGPDGEVEVFQEFGKIGKSLKNSVSPDEI
FT                   CDAYGADTLRVYEMSMGPLEASRPWATKDVVGAYRFLQRVWRLVVDEHTGETRVADGVE
FT                   LDIDTLRALHRTIVGVSEDFAALRNNTATAKLIEYTNHLTKKHRDAVPRAAVEPLVQML
FT                   APLAPHIAEELWLRLGNTTSLAHGPFPKADAAYLVDETVEYPVQVNGKVRGRVVVAADT
FT                   DEETLKAAVLTDEKVQAFLAGATPRKVIVVAGRLVNLVI"
FT   gene            complement(46682..47308)
FT                   /locus_tag="TBFG_10041"
FT                   /old_locus_tag="TBFG_00041"
FT   CDS_pept        complement(46682..47308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10041"
FT                   /old_locus_tag="TBFG_00041"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   marR-family"
FT                   /note="Mapped to H37Rv Rv0042c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04384"
FT                   /protein_id="ABR04384.1"
FT                   /translation="MSVVRSIGKKMQRISGPNALAVKGRPTQVYGHTHVRLDCRFMADS
FT                   EFTAPEVTQLAEGLHRALSKLISMLRRGDPNGAAAGDLTLAQLSILVTLLDQGPIRMTD
FT                   LAAHERVRTPTTTVAIRRLEKIGLVKRSRDPSDLRAVLVDITPQGRAVHGESLANRRAA
FT                   LAALLSQLPRSDLETLRKALAPLERLASGEPASGPASNSPARKRA"
FT   gene            complement(47467..48201)
FT                   /locus_tag="TBFG_10042"
FT                   /old_locus_tag="TBFG_00042"
FT   CDS_pept        complement(47467..48201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10042"
FT                   /old_locus_tag="TBFG_00042"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0043c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04385"
FT                   /protein_id="ABR04385.1"
FT                   /translation="MPKKYGVKEKDQVVAHILNLLLTGKLRSGDRVDRNEIAHGLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFIERFDVATILEHHELDGLLNGIASARAAANPTPR
FT                   ILGQLDAVMRSLRNSKESRAFAECVWEYRRTVNDEYAGPRLHATIRASQNLIPRVFWMT
FT                   YQNSRDDVLPFYEEENAAIHRREPEAARAACIGRSELMAQTMLAELFRRRVLVPPEGAC
FT                   PGPFGAPIPGFARSYQPSSPVP"
FT   gene            complement(48334..49128)
FT                   /locus_tag="TBFG_10043"
FT                   /old_locus_tag="TBFG_00043"
FT   CDS_pept        complement(48334..49128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10043"
FT                   /old_locus_tag="TBFG_00043"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0044c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10043"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04386"
FT                   /protein_id="ABR04386.1"
FT                   /translation="MTSLVRPDLPVRIGVQLQPQHAPHYRAVRDAVRRCEDIGVDIAFT
FT                   WDHFFPLYGDPDGPHFECWTVLGAWAEQTSHIEIGALVTCNSYRNPELLADMARTVDHI
FT                   SGGRLILGIGSGWKQKDYDEYGYRFGTAGSRLDDLAAALPRIKARLGKLNPPPTRDIPV
FT                   LIGGGGERKTLRLVAEYADIWHSFTAGDSYLAKSAVLSTHCSTVGRNPATIERSAAVDG
FT                   GGLIASAEALAGLGVTLLTVGCDGPDYDLSAAAALCRWRDGR"
FT   gene            complement(49144..50040)
FT                   /locus_tag="TBFG_10044"
FT                   /old_locus_tag="TBFG_00044"
FT   CDS_pept        complement(49144..50040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10044"
FT                   /old_locus_tag="TBFG_00044"
FT                   /product="hypothetical hydrolase"
FT                   /note="Mapped to H37Rv Rv0045c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10044"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04387"
FT                   /protein_id="ABR04387.1"
FT                   /translation="MLSDDELTGLDEFALLAENAEQAGVNGPLPEVERVQAGAISALRW
FT                   GGSAPRVIFLHGGGQNAHTWDTVIVGLGEPALAVDLPGHGHSAWREDGNYSPQLNSETL
FT                   APVLRELAPGAEFVVGMSLGGLTAIRLAAMAPDLVGELVLVDVTPSALQRHAELTAEQR
FT                   GTVALMHGEREFPSFQAMLDLTIAAAPHRDVKSLRRGVFHNSRRLDNGNWVWRYDAIRT
FT                   FGDFAGLWDDVDALSAPITLVRGGSSGFVTDQDTAELHRRATHFRGVHIVEKSGHSVQS
FT                   DQPRALIEIVRGVLDTR"
FT   gene            complement(50122..51225)
FT                   /locus_tag="TBFG_10045"
FT                   /old_locus_tag="TBFG_00045"
FT   CDS_pept        complement(50122..51225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10045"
FT                   /old_locus_tag="TBFG_00045"
FT                   /product="myo-inositol-1-phosphate synthase ino1"
FT                   /note="Mapped to H37Rv Rv0046c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04388"
FT                   /protein_id="ABR04388.1"
FT                   /translation="MSEHQSLPAPEASTEVRVAIVGVGNCASSLVQGVEYYYNADDTST
FT                   VPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTNVIVQ
FT                   RGPTLDGIGKYYADTIELSDAEPVDVVQALKEAKVDVLVSYLPVGSEEADKFYAQCAID
FT                   AGVAFVNALPVFIASDPVWAKKFTDARVPIVGDDIKSQVGATITHRVLAKLFEDRGVQL
FT                   DRTMQLNVGGNMDFLNMLERERLESKKISKTQAVTSNLKREFKTKDVHIGPSDHVGWLD
FT                   DRKWAYVRLEGRAFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPA
FT                   SAYLMKSPPEQLPDDIARAQLEEFIIG"
FT   gene            complement(51286..51828)
FT                   /locus_tag="TBFG_10046"
FT                   /old_locus_tag="TBFG_00046"
FT   CDS_pept        complement(51286..51828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10046"
FT                   /old_locus_tag="TBFG_00046"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0047c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04389"
FT                   /protein_id="ABR04389.1"
FT                   /translation="MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRR
FT                   MQADGLIAENAAPAGTPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVHLAFF
FT                   NRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWL
FT                   NELIAAERAAPNPAEQT"
FT   gene            complement(51929..52798)
FT                   /locus_tag="TBFG_10047"
FT                   /old_locus_tag="TBFG_00047"
FT   CDS_pept        complement(51929..52798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10047"
FT                   /old_locus_tag="TBFG_00047"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0048c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04390"
FT                   /protein_id="ABR04390.1"
FT                   /translation="MAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEH
FT                   RERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASVLLGV
FT                   GIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTM
FT                   GYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDATSSAKSIADVSVVDLSKFDAKTA
FT                   VGIMRGAPETLGLKQSDVKSMYLIVEPVKDPTTPAALSLSLYVSSDYGGGYLVFAGDGT
FT                   IKHVSYPS"
FT   gene            52932..53345
FT                   /locus_tag="TBFG_10048"
FT                   /old_locus_tag="TBFG_00048"
FT   CDS_pept        52932..53345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10048"
FT                   /old_locus_tag="TBFG_00048"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0049"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04391"
FT                   /protein_id="ABR04391.1"
FT                   /translation="MDYTLRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFHGKPSRVI
FT                   CPICRKEQLTLVSWVFGEHLGAVSGSARTAEELILLATRFSEFAVHVVEVCRTCSWNHL
FT                   VKSYVLGAARPARPPRGSGGTRTARNGARTASE"
FT   gene            53338..55803
FT                   /locus_tag="TBFG_10049"
FT                   /old_locus_tag="TBFG_00049"
FT   CDS_pept        53338..55803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10049"
FT                   /old_locus_tag="TBFG_00049"
FT                   /product="bifunctional penicillin-binding protein 1A/1B
FT                   ponA1: penicillin-insensitive transglycosylase +
FT                   penicillin-sensitive transpeptidase"
FT                   /note="Mapped to H37Rv Rv0050"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04392"
FT                   /protein_id="ABR04392.1"
FT                   /translation="MNSDGRHHQSSSGAPRGPANPGQRGQVPPDDRLTAILPPVTDDRS
FT                   APHADSIEAVKAALDGAPPMPPPRDPLEEVTAALAAPPGKPPRGDQLGGRRRPPGPPGP
FT                   PGSSGQPAGRLPQPRVDLPRVGQINWKWIRRSLYLTAAVVILLPMVTFTMAYLIVDVPK
FT                   PGDIRTNQVSTILASDGSEIAKIVPPEGNRVDVNLSQVPMHVRQAVIAAEDRNFYSNPG
FT                   FSFTGFARAVKNNLFGGDLQGGSTITQQYVKNALVGSAQHGWSGLMRKAKELVIATKMS
FT                   GEWSKDDVLQAYLNIIYFGRGAYGISAASKAYFDKPVEQLTVAEGALLAALIRRPSTLD
FT                   PAVDPEGAHARWNWVLDGMVETKALSPNDRAAQVFPETVPPDLARAENQTKGPNGLIER
FT                   QVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSID
FT                   PHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDG
FT                   IKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVA
FT                   HTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLF
FT                   DASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANK
FT                   DAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNET
FT                   FPKPTEVGGYAGVPPPPPPPSEVPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAP
FT                   PAATPTPPP"
FT   gene            55800..57482
FT                   /locus_tag="TBFG_10050"
FT                   /old_locus_tag="TBFG_00050"
FT   CDS_pept        55800..57482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10050"
FT                   /old_locus_tag="TBFG_00050"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0051"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04393"
FT                   /protein_id="ABR04393.1"
FT                   /translation="MTGALSQSSNISPLPLAADLRSADNRDCPSRTDVLGAALANVVGG
FT                   PVGRHALIGRTRLMTPLRVMFAIALVFLALGWSTKAACLQSTGTGPGDQRVANWDNQRA
FT                   YYQLCYSDTVPLYGAELLSQGKFPYKSSWIETDSNGTPQLRYDGQIAVRYMEYPVLTGI
FT                   YQYLSMAIAKTYTALSKVAPLPVVAEVVMFFNVAAFGLALAWLTTVWATSGLAGRRIWD
FT                   AALVAASPLVIFQIFTNFDALATGLATSGLLAWARRRPVLAGVLIGLGSAAKLYPLLFL
FT                   YPLLLLGIRAGRLNALARTMAAAAATWLLVNLPVMLLFPRGWSEFFRLNTRRGDDMDSL
FT                   YNVVKSFTGWRGFDPTLGFWEPPLVLNTVVTLLFVLCCAAIAYIALTAPHRPRVAQLTF
FT                   LTVASFLLVNKVWSPQFSLWLVPLAVLALPHRRILLAWMTIDALVWVPRMYYLYGNPSR
FT                   SLPEQWFTTTVLLRDIAVMVLCGLVVWQIYRPGRDLVRTGGPGALPACGGVDDPVGGVF
FT                   ANAADAPPGRLPSWLRPRLGDEHARERTPDAGRDRTFSGQHRA"
FT   gene            57514..58077
FT                   /locus_tag="TBFG_10051"
FT                   /old_locus_tag="TBFG_00051"
FT   CDS_pept        57514..58077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10051"
FT                   /old_locus_tag="TBFG_00051"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0052"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04394"
FT                   /protein_id="ABR04394.1"
FT                   /translation="MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGG
FT                   IGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNS
FT                   LGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPV
FT                   DAGSLAKASPATHRLALEFYQHRL"
FT   gene            58296..58586
FT                   /locus_tag="TBFG_10052"
FT                   /old_locus_tag="TBFG_00052"
FT   CDS_pept        58296..58586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10052"
FT                   /old_locus_tag="TBFG_00052"
FT                   /product="30S ribosomal protein S6 rpsF"
FT                   /note="Mapped to H37Rv Rv0053"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04395"
FT                   /protein_id="ABR04395.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGK
FT                   RRLAYEIAKHAEGIYVVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH"
FT   gene            58690..59184
FT                   /locus_tag="TBFG_10053"
FT                   /old_locus_tag="TBFG_00053"
FT   CDS_pept        58690..59184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10053"
FT                   /old_locus_tag="TBFG_00053"
FT                   /product="single-strand binding protein ssb
FT                   (helix-destabilizing protein)"
FT                   /note="Mapped to H37Rv Rv0054"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04396"
FT                   /protein_id="ABR04396.1"
FT                   /translation="MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTG
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVD
FT                   EIGPSLRYATAKVNKASRSGGFGSGSRPAPAQTSSASGDDPWGSAPASGSFGGGDDEPP
FT                   F"
FT   gene            59226..59480
FT                   /locus_tag="TBFG_10054"
FT                   /old_locus_tag="TBFG_00054"
FT   CDS_pept        59226..59480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10054"
FT                   /old_locus_tag="TBFG_00054"
FT                   /product="30S ribosomal protein S18-1 rpsR1"
FT                   /note="Mapped to H37Rv Rv0055"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04397"
FT                   /protein_id="ABR04397.1"
FT                   /translation="MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR"
FT   gene            59513..59971
FT                   /locus_tag="TBFG_10055"
FT                   /old_locus_tag="TBFG_00055"
FT   CDS_pept        59513..59971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10055"
FT                   /old_locus_tag="TBFG_00055"
FT                   /product="50S ribosomal protein L9 rplI"
FT                   /note="Mapped to H37Rv Rv0056"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04398"
FT                   /protein_id="ABR04398.1"
FT                   /translation="MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQK
FT                   QADEIRRARETKSVRDLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAI
FT                   KKAGGPNLDKRIVRLPKTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS"
FT   gene            60000..60521
FT                   /locus_tag="TBFG_10056"
FT                   /old_locus_tag="TBFG_00056"
FT   CDS_pept        60000..60521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10056"
FT                   /old_locus_tag="TBFG_00056"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0057"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04399"
FT                   /protein_id="ABR04399.1"
FT                   /translation="MPVVTAVGRRRGFAMPWVSTARSGAVMLANYSAGVCGRVSSPGLN
FT                   VRKMCLKANTPGAVTWLDTPKRFLSTQTASRCMAVNSSDVVTGRIDPQVLHTPLNTDVD
FT                   GYAHAMHSSINSGPLEYLPATFSVFPALGDVGDLGGGVGAATYALDRLSNMRSGACVGG
FT                   GESPWRSLMT"
FT   gene            60500..63124
FT                   /locus_tag="TBFG_10057"
FT                   /old_locus_tag="TBFG_00057"
FT   CDS_pept        60500..63124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10057"
FT                   /old_locus_tag="TBFG_00057"
FT                   /product="replicative DNA helicase dnaB"
FT                   /note="Mapped to H37Rv Rv0058"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04400"
FT                   /protein_id="ABR04400.1"
FT                   /translation="MAVVDDLAPGMDSSPPSEDYGRQPPQDLAAEQSVLGGMLLSKDAI
FT                   ADVLERLRPGDFYRPAHQNVYDAILDLYGRGEPADAVTVAAELDRRGLLRRIGGAPYLH
FT                   TLISTVPTAANAGYYASIVAEKALLRRLVEAGTRVVQYGYAGAEGADVAEVVDRAQAEI
FT                   YDVADRRLSEDFVALEDLLQPTMDEIDAIASSGGLARGVATGFTELDEVTNGLHPGQMV
FT                   IVAARPGVGKSTLGLDFMRSCSIRHRMASVIFSLEMSKSEIVMRLLSAEAKIKLSDMRS
FT                   GRMSDDDWTRLARRMSEISEAPLFIDDSPNLTMMEIRAKARRLRQKANLKLIVVDYLQL
FT                   MTSGKKYESRQVEVSEFSRHLKLLAKELEVPVVAISQLNRGPEQRTDKKPMLADLRESG
FT                   CLTASTRILRADTGAEVAFGELMRSGERPMVWSLDERLRMVARPMINVFPSGRKEVFRL
FT                   RLASGREVEATGSHPFMKFEGWTPLAQLKVGDRIAAPRRVPEPIDTQRMPESELISLAR
FT                   MIGDGSCLKNQPIRYEPVDEANLAAVTVSAAHSDGAAIRDDYLAARVPSLRPARQRLPR
FT                   GRCTPIAAWLAGLGLFTKRSHEKCVPEAVFRAPNDQVALFLRHLWSAGGSVRWDPTNGQ
FT                   GRVYYGSTSRRLIDDVAQLLLRVGIFSWITHAPKLGGHDSWRLHIHGAKDQVRFLRHVG
FT                   VHGAEAVAAQEMLRQLKGPVRNPNLDSAPKKVWAQVRNRLSAKQMMDIQLHEPTMWKHS
FT                   PSRSRPHRAEARIEDRAIHELARGDAYWDTVVEITSIGDQHVFDGTVSGTHNFVANGIS
FT                   LHNSLEQDADVVILLHRPDAFDRDDPRGGEADFILAKHRNGPTKTVTVAHQLHLSRFAN
FT                   MAR"
FT   gene            63304..63996
FT                   /locus_tag="TBFG_10058"
FT                   /old_locus_tag="TBFG_00058"
FT   CDS_pept        63304..63996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10058"
FT                   /old_locus_tag="TBFG_00058"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0059"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04401"
FT                   /protein_id="ABR04401.1"
FT                   /translation="MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGR
FT                   LLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKG
FT                   HSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLC
FT                   QRQWHNTDDDPNRQSRRAAEILVYGHVLFELVSYVCCYNTETMTRVRTLLDPVGGVRKY
FT                   VIKPGMYY"
FT   gene            64013..65071
FT                   /locus_tag="TBFG_10059"
FT                   /old_locus_tag="TBFG_00059"
FT   CDS_pept        64013..65071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10059"
FT                   /old_locus_tag="TBFG_00059"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0060"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04402"
FT                   /protein_id="ABR04402.1"
FT                   /translation="MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTA
FT                   YEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIR
FT                   ELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLR
FT                   MTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRY
FT                   GPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVS
FT                   AAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDR
FT                   IGVALDRILMTA"
FT   gene            complement(65116..65496)
FT                   /locus_tag="TBFG_10060"
FT                   /old_locus_tag="TBFG_00060"
FT   CDS_pept        complement(65116..65496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10060"
FT                   /old_locus_tag="TBFG_00060"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0060"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04403"
FT                   /protein_id="ABR04403.1"
FT                   /translation="MESAESIQRLTEFEMKLKFARLSTAILGCAAALVFPASVASADPP
FT                   DPHQPDMTKGYCPGGRWGFGDLAVCDGEKYPDGSFWHQWMQTWFTGPQFYFDCVSGGEP
FT                   LPGPPPPGGCGGAIPSEQPNAP"
FT   gene            65656..66798
FT                   /locus_tag="TBFG_10061"
FT                   /old_locus_tag="TBFG_00061"
FT   CDS_pept        65656..66798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10061"
FT                   /old_locus_tag="TBFG_00061"
FT                   /product="cellulase celA1"
FT                   /note="Mapped to H37Rv Rv0062"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04404"
FT                   /protein_id="ABR04404.1"
FT                   /translation="MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMS
FT                   SAIGSVARWIVPLLGVAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPASAA
FT                   MVAARNANPPNAELTSVANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYG
FT                   IPHRDCGSYASGGFATGTDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQER
FT                   FDLVRYAVDTLTRDPAAAVYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTT
FT                   DEEIGYGEAISGLTNGSHYVIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHA
FT                   DAYLWIKRPGESDGTCGRGEPQAGRFVSQYAIDLAHNAGQ"
FT   gene            67027..68466
FT                   /locus_tag="TBFG_10062"
FT                   /old_locus_tag="TBFG_00062"
FT   CDS_pept        67027..68466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10062"
FT                   /old_locus_tag="TBFG_00062"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0063"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04405"
FT                   /protein_id="ABR04405.1"
FT                   /translation="MAREISRQTFLRGAAGALAAGAVFGSVRATADPAASGWEALSSAL
FT                   GGKVLQPDDGPQFATAKQVFNTNYNGYTPAVIVTPTSQLDVQKAMAFAAANNLKVAPRG
FT                   GGHSYVGASTANGAMVLDLRQLPGDINYDATTGRVTVTPATGLYAMHQVLAAAGRGIPT
FT                   GTCPTVGVAGHALGGGLGANSRHAGLLCDQLTSASVVLPSGQAVTASATDHPDLFWALR
FT                   GGGGGNFGVTTSLTFATFPSGDLDVVNLNFPPQSFAQVLVGWQNWLRTADRGSWALADA
FT                   TVDPLGTHCRILATCPAGSGGSVAAAIVSAVGTQPTGTENHTFNYLDLVRYLAVGNLNP
FT                   SPLGYVGGSDVFTTITPATAQGIASAVDAFPRGAGRMLAIMHALDGALATVSPGATAFP
FT                   WRRQSALVQWYVETSGSPSEATSWLNTAHQAVRAYSVGGYVNYLEVNQPPARYFGPNLS
FT                   RLSAVRQKYDPSRVMFSGLNF"
FT   gene            68724..69764
FT                   /locus_tag="TBFG_10063"
FT                   /old_locus_tag="TBFG_00064"
FT   CDS_pept        68724..69764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10063"
FT                   /old_locus_tag="TBFG_00064"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0064"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04406"
FT                   /protein_id="ABR04406.1"
FT                   /translation="METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLW
FT                   FGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPDEPQRDPVAPL
FT                   RSAVMRRPRLFGWGIAVTLGVVCGLIASFDWLKVQLFVHGGTFGIVDPEFGYDIGFFVF
FT                   DLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRGMLTQAARVQLAVFAGAVVL
FT                   LKAVAYWLDRYELLSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLR
FT                   DLRIPAMAGRTAGAVGDPGRWTVAAADGAVLGASQRRRCRTPIYPTQHRSDPRGVSDRW
FT                   RLGPVP"
FT   gene            69646..71664
FT                   /locus_tag="TBFG_10064"
FT                   /old_locus_tag="TBFG_00064"
FT   CDS_pept        69646..71664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10064"
FT                   /old_locus_tag="TBFG_00064"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0064"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04407"
FT                   /protein_id="ABR04407.1"
FT                   /translation="MEQFSVRPNAADVERPYIQRNIEATREAYRIGGDWVQYRSYPGIG
FT                   TKQPRDVPVDVTTIAKVRLLDPHILSRTFTQQQQLKNFFSFAEILDIDRYRIDGELQDY
FT                   IVGVRELSPKSLTGNQTDWINKHTVYTHGNGFVAAPANRVNAAARDAENISDSNSGYPI
FT                   YAVSDIASLGSGRQVIPVEQPRVYYGEVIAQADPDYAIVGGAPGSAPREYDTDTSKYTY
FT                   TGAGGVSIGNWFNRTVFATKVAQHKFLFSREIGSESKVLIHRDPKERVQRVAPWLTTDD
FT                   NPYPVVVNGRIVWIVDAYTTLDTYPYAQRSSLEGPVTSPTGIVRQGKQVSYVRNSVKAT
FT                   VDAYDGTVTLFQFDRDDPVLRTWMRAFPGTVKSEDQIPDELRAHFRYPEDLFEVQRSLL
FT                   AKYHVDEPREFFTTNAFWSVPSDPTNDANATQPPFYVLVGDQQSAQPSFRLASAMVGYN
FT                   REFLSAYISAHSDPANYGKLTVLELPTDTLTQGPQQIQNSMISDTRVASERTLLERSNR
FT                   IHYGNLLSLPIADGGVLYVEPLYTERISTSPSSSTFPQLSRVLVSVREPRTEGGVRVGY
FT                   APTLAESLDQVFGPGTGRVATAPGGDAASAPPPGAGGPAPPQAVPPPRTTQPPAAPPRG
FT                   PDVPPATVAELRETLADLRAVLDRLEKAIDAAETPGG"
FT   gene            71963..72364
FT                   /locus_tag="TBFG_10065"
FT                   /old_locus_tag="TBFG_00065"
FT   CDS_pept        71963..72364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10065"
FT                   /old_locus_tag="TBFG_00065"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0065"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04408"
FT                   /protein_id="ABR04408.1"
FT                   /translation="MDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVG
FT                   HALRRAVLSDEISEEQARAALDALPYLIDNRYPHSPRLIEYTWQLRHNVTFYDALYVAL
FT                   ATALDVPLLTGDSRLAAAPGLPCEIKLVR"
FT   gene            complement(72416..74653)
FT                   /locus_tag="TBFG_10066"
FT                   /old_locus_tag="TBFG_00066"
FT   CDS_pept        complement(72416..74653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10066"
FT                   /old_locus_tag="TBFG_00066"
FT                   /product="isocitrate dehydrogenase [NADP] icd2"
FT                   /note="Mapped to H37Rv Rv0066c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04409"
FT                   /protein_id="ABR04409.1"
FT                   /translation="MSAEQPTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDIS
FT                   VAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDTNIIKLPNISASVPQLVAAIKELQD
FT                   KGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKHPHS
FT                   MGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGD
FT                   VIDSMFMSKKALCDFYEEQMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAF
FT                   AKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIEDLHRCHEHRPELAMVDSARGI
FT                   SNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNG
FT                   QFDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDVATGEVLLTENVEAGDI
FT                   WRMCIVKDAPIRDWVKLAVTRARISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGL
FT                   DIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPILELGTSAKMLSVVPLMA
FT                   GGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKT
FT                   LDAAIGKLLDNDKSPSRKTGELDNRGSQFYLAMYWAQELAAQTDDQQLAEHFASLADVL
FT                   TKNEDVIVRELTEVQGEPVDIGGYYAPDSDMTTAVMRPSKTFNAALEAVQG"
FT   gene            complement(74771..75340)
FT                   /locus_tag="TBFG_10067"
FT                   /old_locus_tag="TBFG_00067"
FT   CDS_pept        complement(74771..75340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10067"
FT                   /old_locus_tag="TBFG_00067"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0067c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04410"
FT                   /protein_id="ABR04410.1"
FT                   /translation="MAPTDRRVRADAARNRARVLEVAYQTFAADGLSVPVDEIARRAGV
FT                   GAGTVYRHFPTKEALFQAVIADRMHRIIDKGHALLKSKHPGDALFAFLRSMVLQWGATD
FT                   RGLVEALAGVGIEISSAAPEAEADFLDLLTDLLRAAQRAGTVRPDVDVLEVKTLLVGCQ
FT                   AMQSYNAELAAKVTDVALDGLRANRK"
FT   gene            75443..76354
FT                   /locus_tag="TBFG_10068"
FT                   /old_locus_tag="TBFG_00068"
FT   CDS_pept        75443..76354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10068"
FT                   /old_locus_tag="TBFG_00068"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0068"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04411"
FT                   /protein_id="ABR04411.1"
FT                   /translation="MTKWTAADIPDQTGRTAVITGANTGLGFETAAALAAHGAHVVLAV
FT                   RNLDKGKQAAARITEATPGAEVELQELDLTSLASVRAAAAQLKSDHQRIDLLINNAGVM
FT                   YTPRQTTADGFEMQFGTNHLGHFALTGLLIDRLLPVAGSRVVTISSVGHRIRAAIHFDD
FT                   LQWERRYRRVAAYGQAKLANLLFTYELQRRLAPGGTTIAVASHPGVSNTELVRNMPRPL
FT                   VAVAAILAPLMQDAELGALPTLRAATDPAVRGGQYFGPDGFGEIRGYPKVVASSAQSHD
FT                   EQLQRRLWAVSEELTGVVYPVG"
FT   gene            complement(76379..77764)
FT                   /locus_tag="TBFG_10069"
FT                   /old_locus_tag="TBFG_00069"
FT   CDS_pept        complement(76379..77764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10069"
FT                   /old_locus_tag="TBFG_00069"
FT                   /product="L-serine dehydratase sdaA"
FT                   /note="Mapped to H37Rv Rv0069c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10069"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04412"
FT                   /protein_id="ABR04412.1"
FT                   /translation="MTISVFDLFTIGIGPSSSHTVGPMRAANQFVVALRRRGHLDDLEA
FT                   MRVDLFGSLAATGAGHGTMSAILLGLEGCQPETITTEHKERRLAEIAASGVTRIGGVIP
FT                   VPLTERDIDLHPDIVLPTHPNGMTFTAAGPHGRVLATETYFSVGGGFIVTEQTSGNSGQ
FT                   HPCSVALPYVSAQELLDICDRLDVSISEAALRNETCCRTENEVRAALLHLRDVMVECEQ
FT                   RSIAREGLLPGGLRVRRRAKVWYDRLNAEDPTRKPEFAEDWVNLVALAVNEENASGGRV
FT                   VTAPTNGAAGIVPAVLHYAIHYTSAGAGDPDDVTVRFLLTAGAIGSLFKERASISGAEV
FT                   GCQGEVGSAAAMAAAGLAEILGGTPRQVENAAEIAMEHSLGLTCDPIAGLVQIPCIERN
FT                   AISAGKAINAARMALRGDGIHRVTLDQVIDTMRATGADMHTKYKETSAGGLAINVAVNI
FT                   VEC"
FT   gene            complement(77761..79038)
FT                   /locus_tag="TBFG_10070"
FT                   /old_locus_tag="TBFG_00070"
FT   CDS_pept        complement(77761..79038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10070"
FT                   /old_locus_tag="TBFG_00070"
FT                   /product="serine hydroxymethyltransferase 2 glyA2"
FT                   /note="Mapped to H37Rv Rv0070c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04413"
FT                   /protein_id="ABR04413.1"
FT                   /translation="MNTLNDSLTAFDPDIAALIDGELRRQESGLEMIASENYAPLAVMQ
FT                   AQGSVLTNKYAEGYPGRRYYGGCEFVDGVEQLAIDRVKALFGAEYANVQPHSGATANAA
FT                   TMHALLNPGDTILGLSLAHGGHLTHGMRINFSGKLYHATAYEVSKEDYLVDMDAVAEAA
FT                   RTHRPKMIIAGWSAYPRQLDFARFRAIADEVDAVLMVDMAHFAGLVAAGVHPSPVPHAH
FT                   VVTSTTHKTLGGPRGGIILCNDPAIAKKINSAVFPGQQGGPLEHVIAAKATAFKMAAQP
FT                   EFAQRQQRCLDGARILAGRLTQPDVAERGIAVLTGGTDVHLVLVDLRDAELDGQQAEDR
FT                   LAAVDITVNRNAVPFDPRPPMITSGLRIGTPALAARGFSHNDFRAVADLIAAALTATND
FT                   DQLGPLRAQVQRLAARYPLYPELHRT"
FT   gene            79628..80326
FT                   /locus_tag="TBFG_10071"
FT                   /old_locus_tag="TBFG_00071"
FT   CDS_pept        79628..80326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10071"
FT                   /old_locus_tag="TBFG_00071"
FT                   /product="hypothetical maturase"
FT                   /note="Mapped to H37Rv Rv0071"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04414"
FT                   /protein_id="ABR04414.1"
FT                   /translation="MSSITVSVDPVDPVDPVDPVDAVVAAGSDGLTVARIESEIGALEF
FT                   LNELRTELKSGQFRPQPVRERKIPKPGGLGKVRRLGIPTVADRVVQAALKLVLEPIFET
FT                   DFEPVSYGFRPARRAHDTIAEIHLFGTQEYRWVLDADIKACFDRIDHADLMDRVRHRIK
FT                   DKRVLRLVNWQRIRHRWNWTDVRRWLTDPTGRWHPISADGITLFNPAAVPIRRYRYRGN
FT                   TIPTPWTQAV"
FT   gene            80757..81806
FT                   /locus_tag="TBFG_10072"
FT                   /old_locus_tag="TBFG_00072"
FT   CDS_pept        80757..81806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10072"
FT                   /old_locus_tag="TBFG_00072"
FT                   /product="hypothetical glutamine-transport transmembrane
FT                   protein ABC transporter"
FT                   /note="Mapped to H37Rv Rv0072"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04415"
FT                   /protein_id="ABR04415.1"
FT                   /translation="MLFAALRDMQWRKRRLVITIISTGLIFGMTLVLTGLANGFRVEAR
FT                   HTVDSMGVDVFVVRSGAAGPFLGSIPFPDVDLARVAAEPGVMAAAPLGSVGTIMKEGTS
FT                   TRNVTVFGAPEHGPGMPRVSEGRSPSKPDEVAASSTMGRHLGDTVEVGARRLRVVGIVP
FT                   NSTALAKIPNVFLTTEGLQKLAYNGQPNITSIGIIGMPRQLPEGYQTFDRVGAVNDLVR
FT                   PLKVAVNSISIVAVLLWIVAVLIVGSVVYLSALERLRDFAVFKAIGTPTRSIMAGLALQ
FT                   ALVIALLAAVVGVVLAQVLAPLFPMIVAVPVGAYLALPVAAIVIGLFASVAGLKRVVTV
FT                   DPAQAFGGP"
FT   gene            81809..82801
FT                   /locus_tag="TBFG_10073"
FT                   /old_locus_tag="TBFG_00073"
FT   CDS_pept        81809..82801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10073"
FT                   /old_locus_tag="TBFG_00073"
FT                   /product="hypothetical glutamine-transport ATP-binding
FT                   protein ABC transporter"
FT                   /note="Mapped to H37Rv Rv0073"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10073"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04416"
FT                   /protein_id="ABR04416.1"
FT                   /translation="MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCG
FT                   KTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVE
FT                   NVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPP
FT                   LILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAET
FT                   NRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEI
FT                   GVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND"
FT   gene            82881..84116
FT                   /locus_tag="TBFG_10074"
FT                   /old_locus_tag="TBFG_00074"
FT   CDS_pept        82881..84116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10074"
FT                   /old_locus_tag="TBFG_00074"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0074"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04417"
FT                   /protein_id="ABR04417.1"
FT                   /translation="MGDLSISQVSARPGRIGIRARQMFDGYRFQRGPVLVVVEDGRISA
FT                   VDFAGSACPDMNLVDLGESTLLPGLVDAHAHLCWDPDGRPEDLAGDPHAVLVGRARRHA
FT                   AAALRSGITTIRDLGDRDYAALALREEYRQKTTVGPELVVSGPPLTRSGGHCWFLGGVA
FT                   DSVEELVDAVQERAARGADWIKVMATGGFVTTASDPWQPQYGSGQLAAVVAAAEQVGLP
FT                   VTAHAHATAGIAAAVAAGVDGIEHCTFLSEGSAAASPDVVEAIVAQGVWCGMTIPRVYP
FT                   EMPENLVAVVQDGWRNIRRLIDAGARVALSTDAGVAPGRRHDVLPDDLVYLSRHGFTST
FT                   EVLTGATAAAAASCGLGHRKGRIAPGYDADLLAVAAGVDHDPAGLCDVKAVWRSGTQVP
FT                   LQASAVGYNTPS"
FT   gene            84129..85301
FT                   /locus_tag="TBFG_10075"
FT                   /old_locus_tag="TBFG_00075"
FT   CDS_pept        84129..85301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10075"
FT                   /old_locus_tag="TBFG_00075"
FT                   /product="hypothetical aminotransferase"
FT                   /note="Mapped to H37Rv Rv0075"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04418"
FT                   /protein_id="ABR04418.1"
FT                   /translation="MQDSIFNLLTEEQLRGRNTLKWNYFGPDVVPLWLAEMDFPTAPAV
FT                   LDGVRACVDNEEFGYPPLGEDSLPRATADWCRQRYGWCPRPDWVRVVPDVLKGMEVVVE
FT                   FLTRPESPVALPVPAYMPFFDVLHVTGRQRVEVPMVQQDSGRYLLDLDALQAAFVRGAG
FT                   SVIICNPNNPLGTAFTEAELRAIVDIAARHGARVIADEIWAPVVYGSRHVAAASVSEAA
FT                   AEVVVTLVSASKGWNLPGLMCAQVILSNRRDAHDWDRINMLHRMGASTVGIRANIAAYH
FT                   HGESWLDELLPYLRANRDHLARALPELAPGVEVNAPDGTYLSWVDFRALALPSEPAEYL
FT                   LSKAKVALSPGIPFGAAVGSGFARLNFATTRAILDRAIEAIAAALRDIID"
FT   gene            complement(85316..85705)
FT                   /locus_tag="TBFG_10076"
FT                   /old_locus_tag="TBFG_00076"
FT   CDS_pept        complement(85316..85705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10076"
FT                   /old_locus_tag="TBFG_00076"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0076c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04419"
FT                   /protein_id="ABR04419.1"
FT                   /translation="MPAVTTPSNHWGDERRKLSHQPPVRGQILGRRQARRLSQHFARVG
FT                   VEAPPKRLQEMLLGAPAADEEWTDVKFALIVTQLNHEKRVAKFHRLQRRATHSLICLGL
FT                   VLVALNFLICLAYIFFSLTQHAAAL"
FT   gene            complement(85769..86599)
FT                   /locus_tag="TBFG_10077"
FT                   /old_locus_tag="TBFG_00077"
FT   CDS_pept        complement(85769..86599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10077"
FT                   /old_locus_tag="TBFG_00077"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0077c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04420"
FT                   /protein_id="ABR04420.1"
FT                   /translation="MSTIDISAGTIHYEATGPETGRPVVFVHGYMMGGQLWRRVSERLA
FT                   GRGLRCIAPTWPLGAHPKPLRPGADQTIGGVAGIVADVLAALELKDVVLVGNDTGGVVT
FT                   QLVAVHYPERLGALVLTSCDAFEHFPPPILKPVILAAKSATLFRAAIQVMRAPAARNRA
FT                   YAGLSHHNIDHLTRAWVRPALSNPAIAEDLRQLSLSLRTEVTTAVAARLPEFDKPALIA
FT                   WSADDVFFALENGQRLAATIPRARFEVIEGARTFSMVDSPDRLADQLSTVAVRT"
FT   gene            86661..87266
FT                   /locus_tag="TBFG_10078"
FT                   /old_locus_tag="TBFG_00078"
FT   CDS_pept        86661..87266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10078"
FT                   /old_locus_tag="TBFG_00078"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0078"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04421"
FT                   /protein_id="ABR04421.1"
FT                   /translation="MEIKRRTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAG
FT                   VTRGAMYHQFADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVS
FT                   GDPEVRQLILLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQPVRPLAQVL
FT                   IGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLNG"
FT   gene            complement(87341..87934)
FT                   /locus_tag="TBFG_10079"
FT                   /old_locus_tag="TBFG_00079"
FT   CDS_pept        complement(87341..87934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10079"
FT                   /old_locus_tag="TBFG_00079"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0078A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04422"
FT                   /protein_id="ABR04422.1"
FT                   /translation="MNAVESTLRRVAKDLTGLRQRWALVGGFAVSARSEPRFTRDVDIV
FT                   VAVANDDAAESLVRQLLTQQYHLLASVEQDAARRLAAVRLGATADTAANVVVDLLFASC
FT                   GIEPEIAEAAEEIEILPDLVAPVATTAHLIAMKLLARDDDRRPQDRSDLRALVDAASPQ
FT                   DIQDARKAIELITLRGFHRDRDLAAEWTRLAAKW"
FT   gene            88337..89158
FT                   /locus_tag="TBFG_10080"
FT                   /old_locus_tag="TBFG_00080"
FT   CDS_pept        88337..89158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10080"
FT                   /old_locus_tag="TBFG_00080"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0079"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04423"
FT                   /protein_id="ABR04423.1"
FT                   /translation="MEPKRSRLVVCAPEPSHAREFPDVAVFSGGRANASQAERLARAVG
FT                   RVLADRGVTGGARVRLTMANCADGPTLVQINLQVGDTPLRAQAATAGIDDLRPALIRLD
FT                   RQIVRASAQWCPRPWPDRPRRRLTTPAEALVTRRKPVVLRRATPLQAIAAMDAMDYDVH
FT                   LFTDAETGEDAVVYRAGPSGLRLARQHHVFPPGWSRCRAPAGPPVPLIVNSRPTPVLTE
FT                   AAAVDRAREHGLPFLFFTDQATGRGQLLYSRYDGNLGLITPTGDGVADGLA"
FT   gene            89155..89613
FT                   /locus_tag="TBFG_10081"
FT                   /old_locus_tag="TBFG_00081"
FT   CDS_pept        89155..89613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10081"
FT                   /old_locus_tag="TBFG_00081"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0080"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04424"
FT                   /protein_id="ABR04424.1"
FT                   /translation="MSPGSRRASPQSAREVVELDRDEAMRLLASVDHGRVVFTRAALPA
FT                   IRPVNHLVVDGRVIGRTRLTAKVSVAVRSSADAGVVVAYEADDLDPRRRTGWSVVVTGL
FT                   ATEVSDPEQVARYQRLLHPWVNMAMDTVVAIEPEIVTGIRIVADSRTP"
FT   gene            89708..90052
FT                   /locus_tag="TBFG_10082"
FT                   /old_locus_tag="TBFG_00082"
FT   CDS_pept        89708..90052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10082"
FT                   /old_locus_tag="TBFG_00082"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0081"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04425"
FT                   /protein_id="ABR04425.1"
FT                   /translation="MESEPLYKLKAEFFKTLAHPARIRILELLVERDRSVGELLSSDVG
FT                   LESSNLSQQLGVLRRAGVVAARRDGNAMIYSIAAPDIAELLAVARKVLARVLSDRVAVL
FT                   EDLRAGGSAT"
FT   gene            90057..90536
FT                   /locus_tag="TBFG_10083"
FT                   /old_locus_tag="TBFG_00083"
FT   CDS_pept        90057..90536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10083"
FT                   /old_locus_tag="TBFG_00083"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0082"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10083"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04426"
FT                   /protein_id="ABR04426.1"
FT                   /translation="MGWVAKIFRVGRVVEPAAPLPAAIAEPPAGVRGSLQIRHVDAGSC
FT                   NGCEVEISGAFGPVYDAERFGARLVASPRHADALLVTGVVTHNMAGPLRKTLEATPRPR
FT                   VVIACGDCALNRGVFADAYGVVGAVGEVVPVDVEIAGCPPTPAAIMAALRSVTGK"
FT   gene            90533..92455
FT                   /locus_tag="TBFG_10084"
FT                   /old_locus_tag="TBFG_00084"
FT   CDS_pept        90533..92455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10084"
FT                   /old_locus_tag="TBFG_00084"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0083"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10084"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04427"
FT                   /protein_id="ABR04427.1"
FT                   /translation="MTAAPTAGGVVTSGVGVAGVGVGLLGMFGPVRVVHVGWLLPLSGV
FT                   HIELDRLGGFFMALTGAVAAPVGCYLIGYVRREHLGRVPMAVVPLFVAAMLLVPAAGSV
FT                   TTFLLAWELMAIASLILVLSEHARPQVRSAGLWYAVMTQLGFIAILVGLVVLAAAGGSD
FT                   RFAGLGAVCDGVRAAVFMLTLVGFGSKAGLVPLHAWLPRAHPEAPSPVSALMSAAMVNL
FT                   GIYGIVRFDLQLLGPGPRWWGLALLAVGGTSALYGVLQASVAADLKRLLAYSTTENMGL
FT                   ITLALGAATLFADTGAYGPASIAAAAAMLHMIAHAAFKSLAFMAAGSVLAATGLRDLDL
FT                   LGGLARRMPATTVFFGVAALGACGLPLGAGFVSEWLLVQSLIHAAPGHDPIVALTTPLA
FT                   VGVVALATGLSVAAMTKAFGIGFLARPRSTQAEAAREAPASMRAGMAIAAGACLVLAVA
FT                   PLLVAPMVRRAAATLPAAQAVKFTGLGAVVRLPAMSGSIAPGVIAAAVLAAALAVAVLA
FT                   RWRFRRRPAPARLPLWACGAADLTVRMQYTATSFAEPLQRVFGDVLRPDTDIEVTHTAE
FT                   SRYMAERITYRTAVADAIEQRLYTPVVGAVAAMAELLRRAHTGSVHRYLAYGALGVLIV
FT                   LVVAR"
FT   gene            92461..93411
FT                   /locus_tag="TBFG_10085"
FT                   /old_locus_tag="TBFG_00085"
FT   CDS_pept        92461..93411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10085"
FT                   /old_locus_tag="TBFG_00085"
FT                   /product="formate hydrogenlyase hycD"
FT                   /note="Mapped to H37Rv Rv0084"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04428"
FT                   /protein_id="ABR04428.1"
FT                   /translation="MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRD
FT                   LLKQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPSADLFAVVGLL
FT                   FLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTILLAVFALSIPAGSANLGALVAS
FT                   TIDHPGHVVSLAGVLAFVALVIVIVAETGRLPVDNPATHLELTMVHEAMVLEYAGPRLA
FT                   LVEWAAGMRLTVLLALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEV
FT                   FLAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA"
FT   gene            93422..94084
FT                   /locus_tag="TBFG_10086"
FT                   /old_locus_tag="TBFG_00086"
FT   CDS_pept        93422..94084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10086"
FT                   /old_locus_tag="TBFG_00086"
FT                   /product="hydrogenase hycP"
FT                   /note="Mapped to H37Rv Rv0085"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10086"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04429"
FT                   /protein_id="ABR04429.1"
FT                   /translation="MSNANFSILVDFAAGGLVLASVLIVWRRDLRAIVRLLAWQGAALA
FT                   AIPLLRGIRDNDRALIAVGIAVLALRALVLPWLLARAVGAEAAAQREATPLVNTASSLL
FT                   ITAGLTLTAFAITQPVVNLEPGVTINAVPAAFAVVLIALFVMTTRLHAVSQAAGFLMLD
FT                   NGIAATAFLLTAGVPLIVELGASLDVLFAVIVIGVLTGRLRRIFGDADLDKLRELRD"
FT   gene            94084..95550
FT                   /locus_tag="TBFG_10087"
FT                   /old_locus_tag="TBFG_00087"
FT   CDS_pept        94084..95550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10087"
FT                   /old_locus_tag="TBFG_00087"
FT                   /product="hydrogenase hycQ"
FT                   /note="Mapped to H37Rv Rv0086"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04430"
FT                   /protein_id="ABR04430.1"
FT                   /translation="MTGLLLAAILAPLAASIASLITGWRRTTATLTALSATTVLACAVA
FT                   MGFWMGSGAQFGLGGLLRADALTVVMLVVIGIVGTLATAASIGYIDTELAHGHIDGRSA
FT                   RLYGVLTPAFLCAMVLAVCANNIGVIWVAIEATTVITAFLVGHRRTRTALEATWKYVVI
FT                   CSVGIAVAFLGTVLLYFAARDSGAAAAGALNLDILAEHAAGLDPGVARLAGGLLLIGYG
FT                   AKAGLFPFHTWLADAHSQAPAPVSALMSGVLLAVAFSVLIRLRPILDAVSGPAYLRNGL
FT                   LVVGLATLLVAVLMLTVTGDVKRMLAYSSMEHMGLIAIAAAAGTTLAIAALLLHVLAHG
FT                   IGKTVLFLAGGQLQAAHDSTAIADITGVMRRSRLIGVSFAVGLIVLLGLPPFAMFASEL
FT                   AIARSLANERLAWVLGAALLLIAIGFTALARNSGRMLLGTPAAGAPAITVPATAAAALM
FT                   VGIVVSAALGITAGPLADLLGIAASNVGLP"
FT   gene            95547..97025
FT                   /locus_tag="TBFG_10088"
FT                   /old_locus_tag="TBFG_00088"
FT   CDS_pept        95547..97025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10088"
FT                   /old_locus_tag="TBFG_00088"
FT                   /product="formate hydrogenase hycE"
FT                   /note="Mapped to H37Rv Rv0087"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10088"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04431"
FT                   /protein_id="ABR04431.1"
FT                   /translation="MMSASWLRHRVSERGLIATAEQLWADSFRLALVAAHDDGDSLRVV
FT                   YLFLAGYPDRRVELEYVVPADNPEIRSLAYLSFPAGRFEREMADLYGIRPVGHPKPRRL
FT                   VRHAHWPDWHPMRTDAGPAPEFTDTGAFPFLAVEGPGVYEIPVGPVHAGLIEPGHFRFS
FT                   VAGETIVRLKARLWFVHRGIEKLFHGRPATAAVDLAERISGDTSAAHALAHSLAIEDAL
FT                   GIELPHEVHRLRALIVELERLYNHAADLGALANDVGYSLANAHAQRIRENLLRRNAAVT
FT                   GHRLLRGAIRAGGVALRALPDTDELAALAVDLAEVATLTLANSVVYDRFAGTAVLHPDD
FT                   ASALGCLGYVARASGLRSDARVEHPTIVLPITEIGAPDGDVLARYTVRRDEFAASAALA
FT                   QHIVESHTGPIEYAATLHPVGAPSSGIGIVEGWRGTIVHRVEIDVDGRITRAKVVDPSW
FT                   FNWPALPVAMADTIVPDFPLANKSFNQSYAGNDL"
FT   gene            97060..97734
FT                   /locus_tag="TBFG_10089"
FT                   /old_locus_tag="TBFG_00089"
FT   CDS_pept        97060..97734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10089"
FT                   /old_locus_tag="TBFG_00089"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0088"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04432"
FT                   /protein_id="ABR04432.1"
FT                   /translation="MSVYKHAPSRVRLRQTRSTVVKGRSGSLSWRRVRTGDLGLAVWGG
FT                   REEYRAVKPGTPGIQPKGDMMTVTVVDAGPGRVSRSVEVAAPAAELFAIVADPRRHREL
FT                   DGSGTVRGNIKVPAKLVVGSKFSTKMKLFGLPYRITSRVTALKPNELVEWSHPLGHRWR
FT                   WEFESLSPTLTRVTETFDYHAAGAIKNGLKFYEMTGFAKSNAAGIEATLAKLSDQYARG
FT                   RA"
FT   gene            97891..98484
FT                   /locus_tag="TBFG_10090"
FT                   /old_locus_tag="TBFG_00090"
FT   CDS_pept        97891..98484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10090"
FT                   /old_locus_tag="TBFG_00090"
FT                   /product="hypothetical methyltransferase"
FT                   /note="Mapped to H37Rv Rv0089"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04433"
FT                   /protein_id="ABR04433.1"
FT                   /translation="MDQPWNANIHYDALLDAMVPLGTQCVLDVGCGDGLLAARLARRIP
FT                   YVTAVDIDAPVLRRAQTRFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTA
FT                   LSRLGGLVTPGGTLAVVTFVTPSLRNGLWHLTSWVACGMANRVKGKWEHSAPIKWPPPQ
FT                   TLHELRSHVRALLPGACIRRLLYGRVLVTWRAPV"
FT   gene            98613..99383
FT                   /locus_tag="TBFG_10091"
FT                   /old_locus_tag="TBFG_00091"
FT   CDS_pept        98613..99383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10091"
FT                   /old_locus_tag="TBFG_00091"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0090"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04434"
FT                   /protein_id="ABR04434.1"
FT                   /translation="MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEV
FT                   WRCLRCGDFALGGPQGRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAV
FT                   WEFRGARGAIQATLDRDLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYA
FT                   VLQAVEGVGLWLLKRWGEYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLL
FT                   ISKRLFGVRGGRKAYDVERRGEQLLDLERAAMLT"
FT   gene            99817..100584
FT                   /locus_tag="TBFG_10092"
FT                   /old_locus_tag="TBFG_00092"
FT   CDS_pept        99817..100584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10092"
FT                   /old_locus_tag="TBFG_00092"
FT                   /product="bifunctional mta/sah nucleosidase mtn:
FT                   5-methylthioadenosine nucleosidase + S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /note="Mapped to H37Rv Rv0091"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04435"
FT                   /protein_id="ABR04435.1"
FT                   /translation="MAVTVGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRV
FT                   VLAAAGMGKVNTGLTATLLADRFGCRTIVFTGVAGGLDPELCIGDIVIADRVVQHDFGL
FT                   LTDERLRPYQPGHIPFIEPTERLGYPVDPAVIDRVKHRLDGFTLAPLSTAAGGGGRQPR
FT                   IYYGTILTGDQYLHCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLA
FT                   GADSGVDFNRFVGEVAASSARVLLRLLPVLTAC"
FT   gene            100716..103001
FT                   /locus_tag="TBFG_10093"
FT                   /old_locus_tag="TBFG_00093"
FT   CDS_pept        100716..103001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10093"
FT                   /old_locus_tag="TBFG_00093"
FT                   /product="cation transporter ATPase A ctpA"
FT                   /note="Mapped to H37Rv Rv0092"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10093"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04436"
FT                   /protein_id="ABR04436.1"
FT                   /translation="MTTAVTGEHHASVQRIQLRISGMSCSACAHRVESTLNKLPGVRAA
FT                   VNFGTRVATIDTSEAVDAAALCQAVRRAGYQADLCTDDGRSASDPDADHARQLLIRLAI
FT                   AAVLFVPVADLSVMFGVVPATRFTGWQWVLSALALPVVTWAAWPFHRVAMRNARHHAAS
FT                   METLISVGITAATIWSLYTVFGNHSPIERSGIWQALLGSDAIYFEVAAGVTVFVLVGRY
FT                   FEARAKSQAGSALRALAALSAKEVAVLLPDGSEMVIPADELKEQQRFVVRPGQIVAADG
FT                   LAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGRLIVEAAAVGADTQFAGMVRL
FT                   VEQAQAQKADAQRLADRISSVFVPAVLVIAALTAAGWLIAGGQPDRAVSAALAVLVIAC
FT                   PCALGLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAV
FT                   TAAPGWEADQVLALAATVEAASEHSVALAIAAATTRRDAVTDFRAIPGRGVSGTVSGRA
FT                   VRVGKPSWIGSSSCHPNMSAARRHAESLGETAVFVEVDGEPCGVIAVADAVKDSARDAV
FT                   AALADRGLRTMLLTGDNPESAAAVATRVGIDEVIADILPEGKVDVIEQLRDRGHVVAMV
FT                   GDGINDGPALARADLGMAIGRGTDVAIGAADIILVRDHLDVVPLALDLARATMRTVKLN
FT                   MVWAFGYNIAAIPVAAAGLLNPLVAGAAMAFSSFFVVSNSLRLRKFGRYPLGCGTVGGP
FT                   QMTAPSSA"
FT   gene            complement(102948..103796)
FT                   /locus_tag="TBFG_10094"
FT                   /old_locus_tag="TBFG_00094"
FT   CDS_pept        complement(102948..103796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10094"
FT                   /old_locus_tag="TBFG_00094"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0093c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04437"
FT                   /protein_id="ABR04437.1"
FT                   /translation="MLAQATTAGSFNHHASTVLQGCRGVPAAMWSEPAGAIRRHCATID
FT                   GMDCEVAREALSARLDGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRP
FT                   VVPPVGRLGIRRAPRRQHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAG
FT                   THLLNESTSWSIALGVIMVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTR
FT                   ILTHLPVVIGAVLAIMVWRSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSA
FT                   A"
FT   gene            complement(103843..104796)
FT                   /locus_tag="TBFG_10095"
FT                   /old_locus_tag="TBFG_00095"
FT   CDS_pept        complement(103843..104796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10095"
FT                   /old_locus_tag="TBFG_00095"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0094c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04438"
FT                   /protein_id="ABR04438.1"
FT                   /translation="MSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDTER
FT                   ARKRGITLSNQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGATNPDDHTPVIDTTPDA
FT                   AAIDRDTRSQAQRNHDGLLAGLRALLASGKLGQHNGLPVSIVVTTTLTDLQTGAGKGFT
FT                   GGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLFAN
FT                   DRGCTKPGCDAPAYHSQAHHVTAWTSTGRTDITELTLACDPDNRLAEKGWTTHKNTHGH
FT                   TEWLPPPHLDHGQPRTNTFHHPERFLHNQDDDDKPD"
FT   gene            complement(104567..105349)
FT                   /locus_tag="TBFG_10096"
FT                   /old_locus_tag="TBFG_00095"
FT   CDS_pept        complement(104567..105349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10096"
FT                   /old_locus_tag="TBFG_00095"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0095c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04439"
FT                   /protein_id="ABR04439.1"
FT                   /translation="MRYLPVSTRRIWVNPLCHFSFTVISGALFVSARRYDSNMLANSRE
FT                   ELVEVFDALDADLDRLDEVSFEVLSTPERLRSLERLECLARRLPAAQHTLINQLDTQAS
FT                   EEELGGTLCCALANRLRITKPEAGRRIADAADLGPRRALTGEPLAPQLTATATAQRQGL
FT                   IGEAHIKVIRALFRPPARRGGCVHPPGRRSRPGRQSRSISSRRAGPLRPAGHGLATPRR
FT                   RPHRHRTRPQTRHHPEQPAIRRHVTAKWLPDPPSAGHL"
FT   gene            105458..106849
FT                   /locus_tag="TBFG_10097"
FT                   /old_locus_tag="TBFG_00096"
FT   CDS_pept        105458..106849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10097"
FT                   /old_locus_tag="TBFG_00096"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0096"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04440"
FT                   /protein_id="ABR04440.1"
FT                   /translation="MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQL
FT                   LGEVQASSWQGTAATQYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTP
FT                   AELAANHAIHGVLIATNFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVP
FT                   STQPAPPIRAPGGDAADTRLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTV
FT                   VLALVALQLYDFLWYPYYASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAA
FT                   LGPGDQWGANLAVAVTPATAAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLA
FT                   PPGVSSGPKAGTKSPDTAADTLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATA
FT                   TVDAATDVPAPANAAGSQGAGTLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWT
FT                   TDAEQ"
FT   gene            106868..107737
FT                   /locus_tag="TBFG_10098"
FT                   /old_locus_tag="TBFG_00097"
FT   CDS_pept        106868..107737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10098"
FT                   /old_locus_tag="TBFG_00097"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0097"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04441"
FT                   /protein_id="ABR04441.1"
FT                   /translation="MTLKVKGEGLGAQVTGVDPKNLDDITTDEIRDIVYTNKLVVLKDV
FT                   HPSPREFIKLGRIIGQIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDYMFMP
FT                   EPFAFSMVLPLAVPGHDRGTYFIDLARVWQSLPAAKRDPARGTVSTHDPRRHIKIRPSD
FT                   VYRPIGEVWDEINRTTPPIKWPTVIRHPKTGQEILYICATGTTKIEDKDGNPVDPEVLQ
FT                   ELMAATGQLDPEYQSPFIHTQHYQVGDIILWDNRVLMHRAKHGSAAGTLTTYRLTMLDG
FT                   LKTPGYAA"
FT   gene            107734..108285
FT                   /locus_tag="TBFG_10099"
FT                   /old_locus_tag="TBFG_00098"
FT   CDS_pept        107734..108285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10099"
FT                   /old_locus_tag="TBFG_00098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0098"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04442"
FT                   /protein_id="ABR04442.1"
FT                   /translation="MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQ
FT                   YSATEDSVLAYGNFTIGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRG
FT                   WSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEF
FT                   WDENGGAASGEIELAALNIP"
FT   gene            108290..109912
FT                   /locus_tag="TBFG_10100"
FT                   /old_locus_tag="TBFG_00099"
FT   CDS_pept        108290..109912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10100"
FT                   /old_locus_tag="TBFG_00099"
FT                   /product="fatty-acid-CoA ligase fadD10"
FT                   /note="Mapped to H37Rv Rv0099"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04443"
FT                   /protein_id="ABR04443.1"
FT                   /translation="MGGKKFQAMPQLPSTVLDRVFEQARQQPEAIALRRCDGTSALRYR
FT                   ELVAEVGGLAADLRAQSVSRGSRVLVISDNGPETYLSVLACAKLGAIAVMADGNLPIAA
FT                   IERFCQITDPAAALVAPGSKMASSAVPEALHSIPVIAVDIAAVTRESEHSLDAASLAGN
FT                   ADQGSEDPLAMIFTSGTTGEPKAVLLANRTFFAVPDILQKEGLNWVTWVVGETTYSPLP
FT                   ATHIGGLWWILTCLMHGGLCVTGGENTTSLLEILTTNAVATTCLVPTLLSKLVSELKSA
FT                   NATVPSLRLVGYGGSRAIAADVRFIEATGVRTAQVYGLSETGCTALCLPTDDGSIVKIE
FT                   AGAVGRPYPGVDVYLAATDGIGPTAPGAGPSASFGTLWIKSPANMLGYWNNPERTAEVL
FT                   IDGWVNTGDLLERREDGFFYIKGRSSEMIICGGVNIAPDEVDRIAEGVSGVREAACYEI
FT                   PDEEFGALVGLAVVASAELDESAARALKHTIAARFRRESEPMARPSTIVIVTDIPRTQS
FT                   GKVMRASLAAAATADKARVVVRG"
FT   gene            109917..110153
FT                   /locus_tag="TBFG_10101"
FT                   /old_locus_tag="TBFG_00100"
FT   CDS_pept        109917..110153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10101"
FT                   /old_locus_tag="TBFG_00100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0100"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04444"
FT                   /protein_id="ABR04444.1"
FT                   /translation="MRDRILAAVCDVLYIDEADLIDGDETDLRDLGLDSVRFVLLMKQL
FT                   GVNRQSELPSRLAANPSIAGWLRELEAVCTEFG"
FT   gene            110135..117673
FT                   /locus_tag="TBFG_10102"
FT                   /old_locus_tag="TBFG_00101"
FT   CDS_pept        110135..117673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10102"
FT                   /old_locus_tag="TBFG_00101"
FT                   /product="peptide synthetase nrp"
FT                   /note="Mapped to H37Rv Rv0101"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04445"
FT                   /protein_id="ABR04445.1"
FT                   /translation="MHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAA
FT                   LHATVLDNPVQLCVLENSGADYPDLVPRLRFGDIVRVGSADEHLQSTWCSGILGKPLVR
FT                   HTVHTDPNGYVTGLDVHTHHILLDGGATGTIEADLARYLTTDPAGETPSVGAGLAKLRE
FT                   AHRRETAKVEESRGRLSAVVQRELADEAYHGGHGHSVSDAPGTAAKGVLHESATICGNA
FT                   FDAILTLSEAQRVPLNVLVAAAAVAVDASLRQNTETLLVHTVDNRFGDSDLNVATCLVN
FT                   SVAQTVRFPPFASVSDVVRTLDRGYVKAVRRRWLREEHYRRMYLAINRTSHVEALTLNF
FT                   IREPCAPGLRPFLSEVPIATDIGPVEGMTVASVLDEEQRTLNLAIWNRADLPACKTHPK
FT                   VAERIAAALESMAAMWDRPIAMIVNDWFGIGPDGTRCQGDWPARQPSTPAWFLDSARGV
FT                   HQFLGRRRFVYPWVAWLVQRGAAPGDVLVFTDDDTDKTIDLLIACHLAGCGYSVCDTAD
FT                   EISVRTNAITEHGDGILVTVVDVAATQLAVVGHDELRKVVDERVTQVTHDALLATKTAY
FT                   IMPTSGTTGQPKLVRISHGSLAVFCDAISRAYGWGAHDTVLQCAPLTSDISVEEIFGGA
FT                   ACGARLVRSAAMKTGDLAALVDDLVARETTIVDLPTAVWQLLCADGDAIDAIGRSRLRQ
FT                   IVIGGEAIRCSAVDKWLESAASQGISLLSSYGPTEATVVATFLPIVCDQTTMDGALLRL
FT                   GRPILPNTVFLAFGEVVIVGDLVADGYLGIDGDGFGTVTAADGSRRRAFATGDRVTVDA
FT                   EGFPVFSGRKDAVVKISGKRVDIAEVTRRIAEDPAVSDVAVELHSGSLGVWFKSQRTRE
FT                   GEQDAAAATRIRLVLVSLGVSSFFVVGVPNIPRKPNGKIDSDNLPRLPQWSAAGLNTAE
FT                   TGQRAAGLSQIWSRQLGRAIGPDSSLLGEGIGSLDLIRILPETRRYLGWRLSLLDLIGA
FT                   DTAANLADYAPTPDAPTGEDRFRPLVAAQRPAAIPLSFAQRRLWFLDQLQRPAPVYNMA
FT                   VALRLRGYLDTEALGAAVADVVGRHESLRTVFPAVDGVPRQLVIEARRADLGCDIVDAT
FT                   AWPADRLQRAIEEAARHSFDLATEIPLRTWLFRIADDEHVLVAVAHHIAADGWSVAPLT
FT                   ADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQREILGDLDDSDSPIAAQLAYWENALAG
FT                   MPERLRLPTARPYPPVADQRGASLVVDWPASVQQQVRRIARQHNATSFMVVAAGFAVLL
FT                   SKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVLRVNLAGDPSFAELLGQVRARSLA
FT                   AYENQDVPFEVLVDRLKPTRALTHHPLIQVMLAWQDNPVGQLNLGDLQATPMPIDTRTA
FT                   RMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAIDVLIERLRKVLVAVAAAPERTV
FT                   SSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAAQVARIPEAEAVCCGDASMTY
FT                   RELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMVAVLKTGAAYLPIDPANPPP
FT                   RVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAYPGTPPPMPAAVNLAYILY
FT                   TSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYGFDASAWEIWGALLGGGR
FT                   LVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLESVALVVAGEACPAALV
FT                   DRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSGAALFVLDSWLRPVPAG
FT                   VAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTGDLVCWRADGQLEFLGR
FT                   TDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKRLVGYATEIAPGAVDPA
FT                   GLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEYGDTNGYRAPAGPVEKT
FT                   VAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNADLPVRALLHASSTRGL
FT                   SQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTLATAVNLPGPSPELRTV
FT                   LLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSGDPELLRHFK
FT                   ELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAFPYHELFGPNVAGT
FT                   AELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISPTRTVDGGWAGGYGTSK
FT                   WAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVTRMVLSLMATGIAPRSF
FT                   YEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEY
FT                   VDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPMLLASNSQRLQPLKPTR
FT                   GCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQLLGLL"
FT   gene            117848..119833
FT                   /locus_tag="TBFG_10103"
FT                   /old_locus_tag="TBFG_00102"
FT   CDS_pept        117848..119833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10103"
FT                   /old_locus_tag="TBFG_00102"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0102"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04446"
FT                   /protein_id="ABR04446.1"
FT                   /translation="MGTHGATKSATSAVPTPRSNSMAMVRLAIGLLGVCAVVAAFGLVS
FT                   GARRYAEAGNPYPGAFVSVAEPVGFFAASLAGALCLGALIHVVMTAKPEPDGLIDAAAF
FT                   RIHLLAERVSGLWLGLAATMVVIQAAHDTGVGPARLLASGALSDSVAASEMARGWIVAA
FT                   ICALVVATALRLYTRWLGHVVLLVPTVLAVVATAVTGNPGQGPDHDYATSAAIVFAVAF
FT                   ATLTGLKIAAALAGTTPSRAVLVTQVTCGALALAYGAMLLYLFIPGWAVDSDFARLGLL
FT                   AGVILTSVWLFDCWRLLVRPPHAGRRRGGGSGAALAMMAAMASIAAMAVMTAPRFLTHA
FT                   FTAWDVFLGYELPQPPTIARVLTVWRFDSLIGAAGVVLAIGYAAGFAALRRRGNSWPVG
FT                   RLIAWLTGCAALVFTSGSGVRAYGSAMFSVHMAEHMTLNMFIPVLLVLGGPVTLALRVL
FT                   PVTGDGRPPGAREWLTWLLHSRVTTFLSHPITAFVLFVASPYIVYFTPLFDTFVRYHWG
FT                   HEFMAIHFLVVGYLFYWAIIGIDPGPRRLPYPGRIGLLFAVMPFHAFFGIALMTMSSTV
FT                   GATFYRSVNLPWLSSIIADQHLGGGIAWSLTELPVIMVIVALVTQWARQDRRVASREDR
FT                   HADSDYADDELEAYNAMLRELSRMRR"
FT   gene            complement(120049..122307)
FT                   /locus_tag="TBFG_10104"
FT                   /old_locus_tag="TBFG_00103"
FT   CDS_pept        complement(120049..122307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10104"
FT                   /old_locus_tag="TBFG_00103"
FT                   /product="cation transporter ATPase B ctpB"
FT                   /note="Mapped to H37Rv Rv0103c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04447"
FT                   /protein_id="ABR04447.1"
FT                   /translation="MAAPVVGDADLQSVRRIRLDVSGMSCAACASRVETKLNKIPGVRA
FT                   SVNFATRVATIDAVGMAADELCGVVEKAGYHAAPHTETTVLDKRTKDPDGAHARRLLRR
FT                   LLVAAVLFVPLADLSTLFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNARHR
FT                   TTSMETLISVGIVAATAWSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLA
FT                   GRYFEARAKSKAGSALRALAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIA
FT                   ADGVVVDGSAAIDMSAMTGEAKPVRAYPAASVVGGTVVMDGRLVIEATAVGADTQFAAM
FT                   VRLVEQAQTQKARAQRLADHIAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLV
FT                   IACPCALGLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAV
FT                   STVTMAGSGTSERDREEVLGLAAAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVS
FT                   GEVGGHHVEVGKPSWITRTTPCHDAALVSARLDGESRGETVVFVSVDGVVRAALTIADT
FT                   LKDSAAAAVAALRSRGLRTILLTGDNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLR
FT                   EEGHTVAMVGDGINDGPALVGADLGLAIGRGTDVALGAADIILVRDDLNTVPQALDLAR
FT                   ATMRTIRMNMIWAFGYNVAAIPIAAAGLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ"
FT   gene            122451..123965
FT                   /locus_tag="TBFG_10105"
FT                   /old_locus_tag="TBFG_00104"
FT   CDS_pept        122451..123965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10105"
FT                   /old_locus_tag="TBFG_00104"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0104"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04448"
FT                   /protein_id="ABR04448.1"
FT                   /translation="MTPVTTFPLVDAILAGRDRNLDGVILIAAQHLLQTTHAMLRSLFR
FT                   VGLDPRNVAVIGKCYSTHPGVVDAMRADGIYVDDCSDAYAPHESFDTQYTRHVERFFAE
FT                   SWARLTAGRTARVVLLDDGGSLLAVAGAMLDASADVIGIEQTSAGYAKIVGCALGFPVI
FT                   NIARSSAKLLYESPIIAARVTQTAFERTAGIDSSAAILITGAGAIGTALADVLRPLHDR
FT                   VDVYDTRSGCMTPIDLPNAIGGYDVIIGATGATSVPASMHELLRPGVLLMSASSSDREF
FT                   DAVALRRRTTPNPDCHADLRVADGSVDATLLNSGFPVNFDGSPMCGDASMALTMALLAA
FT                   AVLYASVAVADEMSSDHPHLGLIDQGDIVASFLNIDVPLQALSRLPLLSIDGYRRLQVR
FT                   SGYTLFRQGERADHFFVIESGELEALVDGKVILRLGAGDHFGEACLLGGMRRIATVRAC
FT                   EPSVLWELDGKAFGDALHGDAAMREIAYGVARTRLMHAGASESLMV"
FT   gene            complement(124114..124398)
FT                   /locus_tag="TBFG_10106"
FT   CDS_pept        complement(124114..124398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10106"
FT                   /product="50S ribosomal protein L28-1 rpmB1"
FT                   /note="Mapped to H37Rv Rv0105c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10106"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04449"
FT                   /protein_id="ABR04449.1"
FT                   /translation="MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDR
FT                   RIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL"
FT   gene            124508..125704
FT                   /locus_tag="TBFG_10107"
FT                   /old_locus_tag="TBFG_00105"
FT   CDS_pept        124508..125704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10107"
FT                   /old_locus_tag="TBFG_00105"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0106"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04450"
FT                   /protein_id="ABR04450.1"
FT                   /translation="MRTPVILVAGQDHTDEVTGALLRRTGTVVVEHRFDGHVVRRMTAT
FT                   LSRGELITTEDALEFAHGCVSCTIRDDLLVLLRRLHRRDNVGRIVVHLAPWLEPQPICW
FT                   AIDHVRVCVGHGYPDGPAALDVRVAAVVTCVDCVRWLPQSLGEDELPDGRTVAQVTVGQ
FT                   AEFADLLVLTHPEPVAVAVLRRLAPRARITGGVDRVELALAHLDDNSRRGRTDTPHTPL
FT                   LAGLPPLAADGEVAIVEFSARRPFHPQRLHAAVDLLLDGVVRTRGRLWLANRPDQVMWL
FT                   ESAGGGLRVASAGKWLAAMAASEVAYVDLERRLFADLMWVYPFGDRHTAMTVLVCGADP
FT                   TDIVNALNAALLSDDEMASPQRWQSYVDPFGDWHDDPCHEMPDAAGEFSAHRNSGESR"
FT   gene            complement(125799..130676)
FT                   /locus_tag="TBFG_10108"
FT                   /old_locus_tag="TBFG_00106"
FT   CDS_pept        complement(125799..130676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10108"
FT                   /old_locus_tag="TBFG_00106"
FT                   /product="cation transporter ATPase I ctpI"
FT                   /note="Mapped to H37Rv Rv0107c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04451"
FT                   /protein_id="ABR04451.1"
FT                   /translation="MKIPGVATVLGGVTNGVAQTVRAGARLPGSAAAAVQTLASPVLEL
FT                   TGPVVQSVVQTTGRAIGVRGSHNESPDGMTPPVRWRSGRRVHFDLDPLLPFPRWHEHAA
FT                   MVEEPVRRIPGVAEAHVEGSLGRLVVELEPDADSDIAVDEVRDVVSAVAADIFLAGSVS
FT                   SPNSAPFADPGNPLAILVPLTAAAMDLVAMGATVTGWVARLPAAPQTTRALAALINHQP
FT                   RMVSLMESRLGRVGTDIALAATTAAANGLTQSLGTPLLDLVQRSLQISEAAAHRRVWRD
FT                   REPALASPRRPQAPVVPIISSAGAKSQEPRHSWAAAAAGEASHVVVGGSIDAAIDTAKG
FT                   SRAGPVEQYVNQAANGSLIAAASALVAGGGTEDAAGAILAGVPRAAHMGRQAFAAVLGR
FT                   GLANTGQLVLDPGALRRLDRVRVVVIDGAALRGDNRAVLHAQGDEPGWDDDRVYEVADA
FT                   LLHGEQAPEPDPDELPATGARLRWAPAQGPSATPAQGLEHADLVVDGQCVGSVDVGWEV
FT                   DPYAIPLLQTAHRTGARVVLRHVAGTEDLSASVGSTHPPGTPLLKLVRELRADRGPVLL
FT                   ITAVHRDFASTDTLAALAIADVGVALDDPRGATPWTADLITGTDLAAAVRILSALPVAR
FT                   AASESAVHLAQGGTTLAGLLLVTGEQDKTTNPASFRRWLNPVNAAAATALVSGMWSAAK
FT                   VLRMPDPTPQPLTAWHALDPEIVYSRLAGGSRPLAVEPGIPAWRRILDDLSYEPVMAPL
FT                   RGPARTLAQLAVATRHELADPLTPILAVGAAASAIVGSNIDALLVAGVMTVNAITGGVQ
FT                   RLRAEAAAAELFAEQDQLVRRVVVPAVATTRRRLEAARHATRTATVSAKSLRVGDVIDL
FT                   AAPEVVPADARLLVAEDLEVDESFLTGESLPVDKQVDPVAVNDPDRASMLFEGSTIVAG
FT                   HARAIVVATGVGTAAHRAISAVADVETAAGVQARLRELTSKVLPMTLAGGAAVTALALL
FT                   RRASLRQAVADGVAIAVAAVPEGLPLVATLSQLAAAQRLTARGALVRSPRTIEALGRVD
FT                   TICFDKTGTLTENRLRVVCALPSSTAAERDPLPQTTDAPSAEVLRAAARASTQPHNGEG
FT                   HAHATDEAILAAASALAGSLSSQGDSEWVVLAEVPFESSRGYAAAIGRVGTDGIPMLML
FT                   KGAPETILPRCRLADPGVDHEHAESVVRHLAEQGLRVLAVAQRTWDNGTTHDDETDADA
FT                   VDAVAHDLELIGYVGLADTARSSSRPLIEALLDAERNVVLITGDHPITARAIARQLGLP
FT                   ADARVVTGAELAVLDEEAHAKLAADMQVFARVSPEQKVQIVAALQRCGRVTAMVGDGAN
FT                   DAAAIRMADVGIGVSGRGSSAARGAADIVLTDDDLGVLLDALVEGRSMWAGVRDAVTIL
FT                   VGGNVGEVLFTVIGTAFGAGRAPVGTRQLLLVNLLTDMFPALAVAVTSQFAEPDDAEYP
FT                   TDDAAERAQREHRRAVLIGPTPSLDAPLLRQIVNRGVVTAAGATAAWAIGRWTPGTERR
FT                   TATMGLTALVMTQLAQTLLTRRHSPLVIATALGSAGVLVGIIQTPVISHFFGCTPLGPV
FT                   AWTGVFSATAGATAVSALAPKWLASTVGVVQPDERPDDAEDSDAGG"
FT   gene            complement(131030..131263)
FT                   /locus_tag="TBFG_10109"
FT                   /old_locus_tag="TBFG_00107"
FT   CDS_pept        complement(131030..131263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10109"
FT                   /old_locus_tag="TBFG_00107"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0108c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04452"
FT                   /protein_id="ABR04452.1"
FT                   /translation="MESNGNPDLVPVETLHSGDPITDVNGGGQRYIVLESKTVGDSCVV
FT                   LELESRVNHQLQVIEKSFPAGYHVGRAHHRIL"
FT   gene            131407..133008
FT                   /locus_tag="TBFG_10110"
FT                   /old_locus_tag="TBFG_00108"
FT   CDS_pept        131407..133008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10110"
FT                   /old_locus_tag="TBFG_00108"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0109"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04453"
FT                   /protein_id="ABR04453.1"
FT                   /translation="MRVGQPNPRNWRNVPRKPRYIWLLATRQLARKRQRSLMSLLITSP
FT                   ATVAAAATHLAGIGSALSTANAAAAAPTTALSVAGADEVSVLIAALFEAYAQEYQALSA
FT                   QALAFHDQFVQALNMGAVCYAAAETANATPLQALQTVQQNVLTVVNAPTQALLGRPIIG
FT                   NGANGLPNTGQDGGPGGLLFGNGGNGGSGGVDQAGGNGGAAGLIGNGGSGGVGGPGIAG
FT                   SAGGAGGAGGLLFGNGGPGGAGGIGTTGDGGPGGAGGNAIGLFGSGGTGGMGGVGGMGG
FT                   VGNGGNAGNGGTAGLFGHGGAGGAGGIGSADGGLGGGGGNGRFMGNGGVGGAGGYGASG
FT                   DGGNAGNGGLGGVFGDGGAGGTGGLGDVNGGLAGIGGNAGFVGNGGAGGNGQLGSGAVS
FT                   SAGGMGGNGGLVFGNGGPGGLGGPGTSAGNGGMGGNAVGLFGQGGAGGAGGSGFGAGIP
FT                   GGRGGDGGSGGLIGDGGTGGGAGAGDAAASAGGNGGNARLIGNGGDGGPGMFGGPGGAG
FT                   GSGGTIFGFAGTPGPS"
FT   gene            133051..133905
FT                   /locus_tag="TBFG_10111"
FT                   /old_locus_tag="TBFG_00109"
FT   CDS_pept        133051..133905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10111"
FT                   /old_locus_tag="TBFG_00109"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0110"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04454"
FT                   /protein_id="ABR04454.1"
FT                   /translation="MSGASSSESPTCYRHPGRRTYVRCTRCDRYICGECMRVGPVGHQC
FT                   AECVREGARAVRQPRTPFGGRQRSATPVVTYTLISLNALVFVMQVTVMGLERQLALWPP
FT                   AVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGPPLEMWLGRLRFGALYAVSALGGSV
FT                   LVYLIAPLNTATAGASGAVFGLFGATFMVARRLHLDVRWVVALIVINLAFTFLAPAISW
FT                   QGHVGGLVTGALVAATYVYAPRERRNLIQATVTITVLVAFVVLIGWRTVDLLALFGGRL
FT                   NLS"
FT   gene            134086..136143
FT                   /locus_tag="TBFG_10112"
FT                   /old_locus_tag="TBFG_00110"
FT   CDS_pept        134086..136143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10112"
FT                   /old_locus_tag="TBFG_00110"
FT                   /product="hypothetical transmembrane acyltransferase"
FT                   /note="Mapped to H37Rv Rv0111"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10112"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04455"
FT                   /protein_id="ABR04455.1"
FT                   /translation="MPARSVPRPRWVAPVRRVGRLAVWDRPERRSGIPALDGLRAIAVA
FT                   LVLASHGGIPGMGGGFIGVDAFFVLSGFLITSLLLDELGRTGRIDLSGFWIRRARRLLP
FT                   ALVLMVLTVSAARALFPDQALTGLRSDAIAAFLWTANWRFVAQNTDYFTQGAPPSPLQH
FT                   TWSLGVEEQYYVVWPLLLIGATLLLAARARRRCRRATVGGVRFAAFLIASLGTMASATA
FT                   AVAFTSAATRDRIYFGTDTRAQALLIGSAAAALLVRDWPSLNRGWCLIRTRWGRRIARL
FT                   LPFVGLAGLAVTTHVATGSVGEFRHGLLIVVAGAAVIVVASVAMEQRGAVARILAWRPL
FT                   VWLGTISYGVYLWHWPIFLALNGQRTGWSGPALFAARCAATVVLAGASWWLIEQPIRRW
FT                   RPARVPLLPLAAATVASAAAVTMLVVPVGAGPGLREIGLPPGVSAVAAVSPSPPEASQP
FT                   APGPRDPNRPFTVSVFGDSIGWTLMHYLPPTPGFRFIDHTVIGCSLVRGTPYRYIGQTL
FT                   EQRAECDGWPARWSAQVNRDQPDVALLIVGRWETVDRVNEGRWTHIGDPTFDAYLNAEL
FT                   QRALSIVGSTGVRVMVTTVPYSRGGEKPDGRLYPEDQPERVNKWNAMLHNAISQHSNVG
FT                   MIDLNKKLCPDGVYTAKVDGIKVRSDGVHLTQEGVKWLIPWLEDSVRVAS"
FT   gene            136425..137381
FT                   /locus_tag="TBFG_10113"
FT                   /old_locus_tag="TBFG_00111"
FT   CDS_pept        136425..137381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10113"
FT                   /old_locus_tag="TBFG_00111"
FT                   /product="GDP-mannose 4,6-dehydratase gca"
FT                   /note="Mapped to H37Rv Rv0112"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04456"
FT                   /protein_id="ABR04456.1"
FT                   /translation="MKVWITGAGGMMGSHLAEMLLAAGHDVYATYCRPTIDPSDLQFNG
FT                   AEVDITDWCSVYDSIATFRPDAVFHLAAQSYPAVSWARPVETLTTNMVGTAIVFEALRR
FT                   VRPHAKIIVAGSSAEYGFVDPSEVPINERRELRPLHPYGVSKAATDMLAYQYHKSYGMH
FT                   TVVARIFNCTGPRKVGDALSDFVRRCTWLEHHPEQSAIRVGNLKTKRTIVDVRDLNRAL
FT                   MLMLDKGEAGADYNVGGSIAYEMGDVLKQVIAACKRDDIVPEVDPALLRPTDEKIIYGD
FT                   CSKLAAITGWQQEICLTQTIADMFDYWRSKSESALMV"
FT   gene            137455..138045
FT                   /locus_tag="TBFG_10114"
FT                   /old_locus_tag="TBFG_00112"
FT   CDS_pept        137455..138045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10114"
FT                   /old_locus_tag="TBFG_00112"
FT                   /product="sedoheptulose-7-phosphate isomerase gmhA"
FT                   /note="Mapped to H37Rv Rv0113"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04457"
FT                   /protein_id="ABR04457.1"
FT                   /translation="MCTARTAEEIFVETIAVKTRILNDRVLLEAARAIGDRLIAGYRAG
FT                   ARVFMCGNGGSAADAQHFAAELTGHLIFDRPPLGAEALHANSSHLTAVANDYDYDTVFA
FT                   RALEGSARPGDTLFAISTSGNSMSVLRAAKTARELGVTVVAMTGESGGQLAEFADFLIN
FT                   VPSRDTGRIQESHIVFIHAISEHVEHALFAPRQ"
FT   gene            138077..138649
FT                   /locus_tag="TBFG_10115"
FT                   /old_locus_tag="TBFG_00113"
FT   CDS_pept        138077..138649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10115"
FT                   /old_locus_tag="TBFG_00113"
FT                   /product="D-alpha,beta-D-heptose-1,7-biphosphate
FT                   phosphatase gmhB"
FT                   /note="Mapped to H37Rv Rv0114"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04458"
FT                   /protein_id="ABR04458.1"
FT                   /translation="MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARAL
FT                   KKLRAWAPYIVVVTNQQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQ
FT                   RCGCRKPRPGLVLDWLGRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGAS
FT                   SGGVADASFDSLWEFAVAVGHARGERG"
FT   gene            138649..139809
FT                   /locus_tag="TBFG_10116"
FT                   /old_locus_tag="TBFG_00114"
FT   CDS_pept        138649..139809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10116"
FT                   /old_locus_tag="TBFG_00114"
FT                   /product="D-alpha-D-heptose-7-phosphate kinase hddA"
FT                   /note="Mapped to H37Rv Rv0115"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04459"
FT                   /protein_id="ABR04459.1"
FT                   /translation="MAILRGRAPLRLGLGGGGTDVEPYSSQFGGRILSVTIDKYAYAFA
FT                   ERGTGDEIAFRSPDRDRAGQASIDDLASLEEDFPLHVAVYRRVIAEFNGGTPFPLQLAT
FT                   QVDAPPGSGLGSSSALVVAMLLTTCALIGSSPGPYELARLAWEIERVDLGMAGGWQDHY
FT                   AAAFGGFNFMESRPNGEVVVNPLRIRREVIAELEASLLLYFGGVSRLSSEVIADQQRNV
FT                   VERDADALAATHSICAEALEMKDLLVVGDIPGFADSLLRGWQAKKRTSTRISNPAIEHA
FT                   YQVAQSSGMVAGKVSGAGGGGFLMMIVDPRRRIEVARSLERECGGSVAPCLFTKGGAVT
FT                   WHIPESTAPVRRGVADAVASALGNAGILLCAGCVLATSHSTWRVPV"
FT   gene            complement(140403..141158)
FT                   /locus_tag="TBFG_10117"
FT                   /old_locus_tag="TBFG_00115"
FT   CDS_pept        complement(140403..141158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10117"
FT                   /old_locus_tag="TBFG_00115"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0116c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04460"
FT                   /protein_id="ABR04460.1"
FT                   /translation="MRRVVRYLSVVVAITLMLTAESVSIATAAVPPLQPIPGVASVSPA
FT                   NGAVVGVAHPVVVTFTTPVTDRRAVERSIRISTPHNTTGHFEWVASNVVRWVPHRYWPP
FT                   HTRVSVGVQELTEGFETGDALIGVASISAHTFTVSRNGEVLRTMPASLGKPSRPTPIGS
FT                   FHAMSKERTVVMDSRTIGIPLNSSDGYLLTAHYAVRVTWSGVYVHSAPWSVNSQGYANV
FT                   SHGCINLSPDNAAWYFDAVTVGDPIEVVG"
FT   gene            141336..142280
FT                   /locus_tag="TBFG_10118"
FT                   /old_locus_tag="TBFG_00116"
FT   CDS_pept        141336..142280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10118"
FT                   /old_locus_tag="TBFG_00116"
FT                   /product="oxidative stress response regulatory protein
FT                   oxyS"
FT                   /note="Mapped to H37Rv Rv0117"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04461"
FT                   /protein_id="ABR04461.1"
FT                   /translation="MLFRQLEYFVAVAQERHFARAAEKCYVSQPALSSAIAKLERELNV
FT                   TLINRGHSFEGLTREGERLVVWAKRILAEHAAFKAEVDAVRSGITGTLRLGTVPTASTT
FT                   ASLVLSAFCSAHPLAKVQVCSRLAATELYRRLREFELDAVIVHPETQDSDDVDLVPLYE
FT                   EQYVLLSPADMLPPGTSTLVWRDAAQLPLALLTADMRDRQVIDAAFADHAVSAIPQVET
FT                   DSVASLFAQVATGNWASIVPHTWLWAMPMSGPTGGEIRAVELVDPVLKAQIALATNALG
FT                   PGSPVARALITCAQALALNEFFDTQLRGITRRR"
FT   gene            complement(142264..144012)
FT                   /locus_tag="TBFG_10119"
FT                   /old_locus_tag="TBFG_00117"
FT   CDS_pept        complement(142264..144012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10119"
FT                   /old_locus_tag="TBFG_00117"
FT                   /product="oxalyl-CoA decarboxylase oxcA"
FT                   /note="Mapped to H37Rv Rv0118c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04462"
FT                   /protein_id="ABR04462.1"
FT                   /translation="MTTRSASPCTVLTDGCHLVVDALKANDVDTIYGVVGIPITDLARA
FT                   AQASGIRYIGFRHEASAGNAAAAAGFLTARPGVCLTTSGPGFLNGLPALANATTNCFPM
FT                   IQISGSSSRPMVDLQRGDYQDLDQLNAARPFVKAAYRIGQVQDIGRGVARAIRTATSGR
FT                   PGGVYLDIPGDVLGQAVEASAASGAIWRPVDPAPRLLPAPEAIDRALDVLAQAQRPLLV
FT                   LSKGAAYAQADNVIREFVEHTGIPFLPMSMAKGLLPDSHPQSAAAARSLAMARADVVLL
FT                   VGARLNWLLGNGESPQWSADAKFIQVDIEASEFDSNRPIVAPLTGDIGSVMSALLEAAA
FT                   DRSSVASAAWTGELADRKARNSAKMRRRLADDHHPMRFYNALGAIRSVLQRNPDVYVVN
FT                   EGANALDLARNIIDMHLPRHRLDSGTWGVMGIGMGYAIAAAVETGRPVVAIEGDSAFGF
FT                   SGMEFETICRYRLPVTVVILNNGGVYRGDEATIFRSAAPVWRHDPAPTVLNAHARHELI
FT                   AEAFGGKGYHVSTPTELESALTDALASNGPSLIDCELDPADGVESGHLAKLNTTSAATP
FT                   AISGDG"
FT   gene            144134..145762
FT                   /locus_tag="TBFG_10120"
FT                   /old_locus_tag="TBFG_00118"
FT   CDS_pept        144134..145762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10120"
FT                   /old_locus_tag="TBFG_00118"
FT                   /product="fatty-acid-CoA ligase fadD7"
FT                   /note="Mapped to H37Rv Rv0119"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10120"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04463"
FT                   /protein_id="ABR04463.1"
FT                   /translation="MLIVPNPHTEHMEGAFAMASDFGPRIADLVEVAATRLPEAPALVV
FT                   TADRIAISHRDLARLVDELAGQLTRSGLLPGDRVALRMGSNAEFVVALLAASRADLVVV
FT                   PLDPALPITEQRVRSQAAGARVVLIDADGPHDRAEPTTRWWPLTVNVGGDSGPSGGTLS
FT                   VHLDAATEPNPATSTPEGLRPDDAMIMFTGGTTGLPKMVPWTHANIASSVRAIITGYRL
FT                   SPRDATVAVMPLYHGHGLIASLLATLASGGAVSLPARGRFSAHTFWEDIKAVGATWYTA
FT                   VPTIHQILLERSATEPSGRKPAALRFIRSCSAPLTAQAALALQTEFAAPVVCAFGMTEA
FT                   THQVTTTQIEGIDQTETPVVSTGLVGRSTGAQIRIVGSDGLPLPAGAVGEIWLRGTTVV
FT                   RGYLGDPTITAANFTDGWLRTGDLGSLSAAGDLSIRGRIKELINRGGEKISPERVEGVL
FT                   ASHPNVMEAAVFGVPHQLYGEAVAAVIVPRESAPPTREELVQFCRERLAAFEIPASFQE
FT                   ASGLPHTAKGSLDRRAVAERFGHSV"
FT   gene            complement(145763..147907)
FT                   /locus_tag="TBFG_10121"
FT                   /old_locus_tag="TBFG_00119"
FT   CDS_pept        complement(145763..147907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10121"
FT                   /old_locus_tag="TBFG_00119"
FT                   /product="elongation factor G (EF-G) fusA2"
FT                   /note="Mapped to H37Rv Rv0120c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04464"
FT                   /protein_id="ABR04464.1"
FT                   /translation="MADRVNASQGAAAAPTANGPGGVRNVVLVGPSGGGKTTLIEALLV
FT                   AAKVLSRPGSVTEGTTVCDFDEAEIRQQRSVGLAVASLAYDGIKVNLVDTPGYADFVGE
FT                   LRAGLRAADCALFVIAANEGVDEPTKSLWQECSQVGMPRAVVITKLDHARANYREALTA
FT                   AQDAFGDKVLPLYLPSGDGLIGLLSQALYEYADGKRTTRTPAESDTERIEEARGALIEG
FT                   IIEESEDESLMERYLGGETIDESVLIQDLEKAVARGSFFPVIPVCSSTGVGTLELLEVA
FT                   TRGFPSPMEHPLPEVFTPQGVPHAELACDNDAPLLAEVVKTTSDPYVGRVSLVRVFSGT
FT                   IRPDTTVHVSGHFSSFFGGGTSNTHPDHDEDERIGVLSFPLGKQQRPAAAVVAGDICAI
FT                   GKLSRAETGDTLSDKAEPLVLKPWTMPEPLLPIAIAAHAKTDEDKLSVGLGRLAAEDPT
FT                   LRIEQNQETHQVVLWCMGEAHAGVVLDTLANRYGVSVDTIELRVPLRETFAGNAKGHGR
FT                   HIKQSGGHGQYGVCDIEVEPLPEGSGFEFLDKVVGGAVPRQFIPSVEKGVRAQMDKGVH
FT                   AGYPVVDIRVTLLDGKAHSVDSSDFAFQMAGALALREAAAATKVILLEPIDEISVLVPD
FT                   DFVGAVLGDLSSRRGRVLGTETAGHDRTVIKAEVPQVELTRYAIDLRSLAHGAASFTRS
FT                   FARYEPMPESAAARVKAGAG"
FT   gene            complement(148044..148478)
FT                   /locus_tag="TBFG_10122"
FT                   /old_locus_tag="TBFG_00120"
FT   CDS_pept        complement(148044..148478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10122"
FT                   /old_locus_tag="TBFG_00120"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0121c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04465"
FT                   /protein_id="ABR04465.1"
FT                   /translation="MGEFDPKLRFAQSPVARLATSTPDGTPHLVPVVFALGARRPAEAT
FT                   GADVIYTAVDAKRKTTQRLRRLANLEHNPRASVLVDSYADDWTQLWWVRADGVAAIHRD
FT                   GEVMRAAYRLLRAKYAQYQSVPLNGPVIAIAVQRWASWHA"
FT   gene            148627..148995
FT                   /locus_tag="TBFG_10123"
FT                   /old_locus_tag="TBFG_00121"
FT   CDS_pept        148627..148995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10123"
FT                   /old_locus_tag="TBFG_00121"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0122"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04466"
FT                   /protein_id="ABR04466.1"
FT                   /translation="MAGSVSAAAGIGWVGLNVTETNRDQCYRVERTTVDALTHPEYRVH
FT                   TRGVQRVRVTRNARKHRVSKHRIVAAMRHCGVPVIQEDGSLYYQGRDTSGRLTEVVAVE
FT                   ADDGDLIITHAMPKEWKR"
FT   gene            148992..149360
FT                   /locus_tag="TBFG_10124"
FT                   /old_locus_tag="TBFG_00122"
FT   CDS_pept        148992..149360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10124"
FT                   /old_locus_tag="TBFG_00122"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0123"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04467"
FT                   /protein_id="ABR04467.1"
FT                   /translation="MTKKPRNPADYVIGDDVEVSDVDLKQEEVYVDGERLTDERVEQMA
FT                   SESLRLAREREANLIPGGKSLSGGSAHSPAVQVVVSKATHAKLKELARSRKMSVSKLLR
FT                   PVLDEFVQRETGRILPRR"
FT   gene            149627..151312
FT                   /locus_tag="TBFG_10125"
FT                   /old_locus_tag="TBFG_00123"
FT   CDS_pept        149627..151312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10125"
FT                   /old_locus_tag="TBFG_00123"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0124"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10125"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04468"
FT                   /protein_id="ABR04468.1"
FT                   /translation="MFAGGGAGGLGRCVMSFVSVAPEIVVAAATDLAGIGSAISAANAA
FT                   AAAPTTAVLAAGADEVSAAIAALFSGHAQAYQALSAQAAAFHQQFVQTLAGGAGAYAAA
FT                   EAQVEQQLLAAINAPTQALLGRPLIGNGADGAPGTGQAGGAGGILYGNGGNGGSGAAGQ
FT                   AGGAGGPAGLIGHGGSGGAGGSGAAGGAGGHGGWLWGNGGVGGSGGAGVGAGVAGGHGG
FT                   AGGAAGLWGAGGGGGNGGNGADANIVSGGDGGLGGAGGGGGWLYGDGGAGGHGGQGAIG
FT                   LGGGAGGDGGQGGAGRGLWGTGGAGGHGGQGGGTGGPPLPGQAGMGAAGGAGGLIGNGG
FT                   AGGDGGVGASGGVAGVGGAGGNAMLIGHGGAGGAGGDSSFANGAAGGAGGAGGHLFGNG
FT                   GSGGHGGAVTAGNTGIGGAGGVGGDARLIGHGGAGGAGGDRAGALVGRDGGPGGNGGAG
FT                   GQLYGNGGDGGPGGQGGQAFGANNIGGTGGAGGNGGPAILSGNGGNGGAGGAGGAGGAG
FT                   GGAGGVGGAGGAPGTGGTLQAAVSGLVTALFGAPGQPGDTGQPG"
FT   gene            151464..152531
FT                   /locus_tag="TBFG_10126"
FT                   /old_locus_tag="TBFG_00124"
FT   CDS_pept        151464..152531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10126"
FT                   /old_locus_tag="TBFG_00124"
FT                   /product="serine protease pepA"
FT                   /note="Mapped to H37Rv Rv0125"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04469"
FT                   /protein_id="ABR04469.1"
FT                   /translation="MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADF
FT                   PALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDIN
FT                   AFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQG
FT                   GTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGM
FT                   NTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNG
FT                   ARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSG
FT                   GTRTGNVTLAEGPPA"
FT   gene            152640..154445
FT                   /locus_tag="TBFG_10127"
FT                   /old_locus_tag="TBFG_00125"
FT   CDS_pept        152640..154445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10127"
FT                   /old_locus_tag="TBFG_00125"
FT                   /product="trehalose synthase treS"
FT                   /note="Mapped to H37Rv Rv0126"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04470"
FT                   /protein_id="ABR04470.1"
FT                   /translation="MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFK
FT                   HAVFYEVLVRAFFDASADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIR
FT                   DFYKVLPEFGTVDDFVALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGPYGDY
FT                   YVWSDTSERYTDARIIFVDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMID
FT                   VIRFWLGLGIDGFRLDAVPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEA
FT                   NQWPGDVVEYFGDPNTGGDECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMA
FT                   QWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELF
FT                   TALLLSLPGSPVLYYGDEIGMGDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPP
FT                   SQDPVYGYQAVNVEAQRDTSTSLLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYV
FT                   RQVAGDDGDTVLCVNNLSRFPQPIELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPG
FT                   HGFYWFQLTTHEVGAPPTCGGERRL"
FT   gene            154548..155915
FT                   /locus_tag="TBFG_10128"
FT                   /old_locus_tag="TBFG_00126"
FT   CDS_pept        154548..155915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10128"
FT                   /old_locus_tag="TBFG_00126"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0127"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04471"
FT                   /db_xref="GOA:A5WII2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WII2"
FT                   /protein_id="ABR04471.1"
FT                   /translation="MTRSDTLATKLPWSDWLPRQRWYAGRNRELATVKPGVVVALRHNL
FT                   DLVLVDVTYTDGATERYQVLVGWDFEPASEYGTKAAIGVADDRTGFDALYDVAGPQFLL
FT                   SLIVSSAVCGTSTGEVTFTREPDVELPFAAQPRVCDAEQSNTSVIFDRRAILKVFRRVS
FT                   SGINPDIELNRVLTRAGNPHVARLLGAYQFGRPNRSPTDALAYALGMVTEYEANAAEGW
FT                   AMATASVRDLFAEGDLYAHEVGGDFAGESYRLGEAVASVHATLADSLGTAQATFPVDRM
FT                   LARLSSTVAVVPELREYAPTIEQQFQKLAAEAITVQRVHGDLHLGQVLRTPESWLLIDF
FT                   EGEPGQPLDERRAPDSPLRDVAGVLRSFEYAAYGPLVDQATDKQLAARAREWVERNRAA
FT                   FCDGYAVASGIDPRDSALLLGAYELDKAVYETGYETRHRPGWLPIPLRSIARLTAS"
FT   gene            155983..156762
FT                   /locus_tag="TBFG_10129"
FT                   /old_locus_tag="TBFG_00127"
FT   CDS_pept        155983..156762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10129"
FT                   /old_locus_tag="TBFG_00127"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0128"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04472"
FT                   /protein_id="ABR04472.1"
FT                   /translation="MQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQR
FT                   AVLGLFGDDAWMSVTASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGV
FT                   DIMLGGWHESMLDFVPILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHL
FT                   AGGKVEDWLGYFLLHASFVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRR
FT                   GLVNQKRPQPGKRLFRALRRGELDSGTSTPATNYGSS"
FT   gene            complement(156894..157916)
FT                   /locus_tag="TBFG_10130"
FT                   /old_locus_tag="TBFG_00128"
FT   CDS_pept        complement(156894..157916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10130"
FT                   /old_locus_tag="TBFG_00128"
FT                   /product="secreted antigen 85-C fbpC (fibronectin-binding
FT                   protein C)"
FT                   /note="Mapped to H37Rv Rv0129c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04473"
FT                   /protein_id="ABR04473.1"
FT                   /translation="MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAG
FT                   AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEE
FT                   YYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTG
FT                   NAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANS
FT                   MWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTN
FT                   QTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
FT                   "
FT   gene            158163..158618
FT                   /locus_tag="TBFG_10131"
FT                   /old_locus_tag="TBFG_00129"
FT   CDS_pept        158163..158618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10131"
FT                   /old_locus_tag="TBFG_00129"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0130"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04474"
FT                   /protein_id="ABR04474.1"
FT                   /translation="MRTFESVADLAAAAGEKVGQSDWVTITQEEVNLFADATGDHQWIH
FT                   VDPERAAAGPFGTTIAHGFMTLALLPRLQHQMYTVKGVKLAINYGLNKVRFPAPVPVGS
FT                   RVRATSSLVGVEDLGNGTVQATVSTTVEVEGSAKPACVAESIVRYVA"
FT   gene            complement(158631..159974)
FT                   /locus_tag="TBFG_10132"
FT                   /old_locus_tag="TBFG_00130"
FT   CDS_pept        complement(158631..159974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10132"
FT                   /old_locus_tag="TBFG_00130"
FT                   /product="acyl-CoA dehydrogenase fadE1"
FT                   /note="Mapped to H37Rv Rv0131c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10132"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04475"
FT                   /protein_id="ABR04475.1"
FT                   /translation="MPVRRRAGERLPTVWDFETDPQYQSKLDWVEKFMAEELEPLDLVA
FT                   LDPYDKKNADTMAILRPLQRQVKDQGLWAAHLRPELGGQGFGQVKLALLNEIIGRSRWA
FT                   PSAFGCQAPDSGNAEILALFGTDEQKARYLRPLLDGEITSCYSMTEPQGGSDPGLFVTA
FT                   ATRDAAGNGDWIINGEKWFSTNAKHASFFIVMAVTKPEARTYEKMSLFIVPADTPGIEI
FT                   VRNVGVGAESTRHASHGYIRYHDVRVPADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIA
FT                   LARRAFDMMCERALSRQTRHGRLADLQMTQEKIADSWIQIEQFRLLVLRTAWLIDKHHD
FT                   YQKVRRDIAAVKVAMPQVLHDVVQRAMHLHGALGVSDEMPFVKMMLAAESLGIADGATE
FT                   LHKMTVARRTLREYQPVTTLFPSQHIPTRRAHAEAWLAQRLEHAIAEF"
FT   gene            complement(160016..161098)
FT                   /locus_tag="TBFG_10133"
FT                   /old_locus_tag="TBFG_00131"
FT   CDS_pept        complement(160016..161098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10133"
FT                   /old_locus_tag="TBFG_00131"
FT                   /product="F420-dependent glucose-6-phosphate dehydrogenase
FT                   fgd2"
FT                   /note="Mapped to H37Rv Rv0132c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10133"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04476"
FT                   /protein_id="ABR04476.1"
FT                   /translation="MTGISRRTFGLAAGFGAIGAGGLGGGCSTRSGPTPTPEPASRGVG
FT                   VVLSHEQFRTDRLVAHAQAAEQAGFRYVWASDHLQPWQDNEGHSMFPWLTLALVGNSTS
FT                   SILFGTGVTCPIYRYHPATVAQAFASLAILNPGRVFLGLGTGERLNEQAATDTFGNYRE
FT                   RHDRLIEAIVLIRQLWSGERISFTGHYFRTDELKLYDTPAMPPPIFVAASGPQSATLAG
FT                   RYGDGWIAQARDINDAKLLAAFAAGAQAAGRDPTTLGKRAELFAVVGDDKAAARAADLW
FT                   RFTAGAVDQPNPVEIQRAAESNPIEKVLANWAVGTDPGVHIGAVQAVLDAGAVPFLHFP
FT                   QDDPITAIDFYRTNVLPELR"
FT   gene            161185..161790
FT                   /locus_tag="TBFG_10134"
FT                   /old_locus_tag="TBFG_00132"
FT   CDS_pept        161185..161790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10134"
FT                   /old_locus_tag="TBFG_00132"
FT                   /product="hypothetical acetyltransferase"
FT                   /note="Mapped to H37Rv Rv0133"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04477"
FT                   /protein_id="ABR04477.1"
FT                   /translation="MTPQARPARRADVRELSRTMARAFYDDPVMSWLLSNDNARTARLT
FT                   RLFATIVRHQHLAGGGVEVARGAAGIGGAALWDPPDRWRESRRQQLAMTPGFLRVFGFR
FT                   TAKARAALDVMMRVHPEEPHWYLAAIGSDPTVRGQGFGQVLMRSRLDRCDAEHCPAYLE
FT                   STKPENVPYYQRFGFRVTREIALPDAGPPLWAMWREPR"
FT   gene            162087..162989
FT                   /locus_tag="TBFG_10135"
FT                   /old_locus_tag="TBFG_00133"
FT   CDS_pept        162087..162989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10135"
FT                   /old_locus_tag="TBFG_00133"
FT                   /product="epoxide hydrolase ephF"
FT                   /note="Mapped to H37Rv Rv0134"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04478"
FT                   /protein_id="ABR04478.1"
FT                   /translation="MIALPALEGVEHRHVDVAEGVRIHVADAGPADGPAVMLVHGFPQN
FT                   WWEWRDLIGPLAADGNRVLCPDLRGAGWSSAPRSRYTKTEMADDLAAVLDGLGVAKVKL
FT                   VAHDWGGPVAFIMMLRHPEKVTGFFGVNTVAPWVKRDLGMLRNMWRFWYQIPMSLPVIG
FT                   PRVISDPKGRYFRLLTGWVGGGFRVPDDDVRLYLDCMREPGHAEAGSRWYRTFQTREML
FT                   RWLRGEYNDARVDVPVRWLHGTGDPVITPDLLDGYAERASDFEVELVDSVGHWIVEQRP
FT                   ELVLDRVRAFLAAGTEQRD"
FT   gene            complement(162960..163565)
FT                   /locus_tag="TBFG_10136"
FT                   /old_locus_tag="TBFG_00134"
FT   CDS_pept        complement(162960..163565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10136"
FT                   /old_locus_tag="TBFG_00134"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0135c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04479"
FT                   /protein_id="ABR04479.1"
FT                   /translation="MTAVAAGALVVETDSFRLRLLDGLVASIGERGYRATTVSDIVRHA
FT                   RTSKRTFYDRFTSKEQCFLELLLADNETLGNSIRAAVDPNADWHDQIRQAVEAYVTHIE
FT                   SRPAVTLSWIREFPSLGAAAYPVQRRGMEQLTSLLIELSASPGFRRANLPPLNVPLAVI
FT                   LLGGLRELTALTVEDGQPIRNIVEPAVDASIALLGPRS"
FT   gene            163682..165007
FT                   /locus_tag="TBFG_10137"
FT                   /old_locus_tag="TBFG_00135"
FT   CDS_pept        163682..165007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10137"
FT                   /old_locus_tag="TBFG_00135"
FT                   /product="cytochrome P450 138 cyp138"
FT                   /note="Mapped to H37Rv Rv0136"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04480"
FT                   /protein_id="ABR04480.1"
FT                   /translation="MSEVVTAAPAPPVVRLPPAVRGPKLFQGLAFVVSRRRLLGRFVRR
FT                   YGKAFTANILMYGRVVVVADPQLARQVFTSSPEELGNIQPNLSRMFGSGSVFALDGDDH
FT                   RRRRRLLAPPFHGKSMKNYETIIEEETLRETANWPQGQAFATLPSMMHITLNAILRAIF
FT                   GAGGSELDELRRLIPPWVTLGSRLAALPKPKRDYGRLSPWGRLAEWRRQYDTVIDKLIE
FT                   AERADPNFADRTDVLALMLRSTYDDGSIMSRKDIGDELLTLLAAGHETTAATLGWAFER
FT                   LSRHPDVLAALVEEVDNGGHELRQAAILEVQRARTVIDFAARRVNPPVYQLGEWVIPRG
FT                   YSIIINIAQIHGDPDVFPQPDRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAAFANMEMD
FT                   VVLRTVLRHFTLETTTAAGERSHGRGVAFTPKDGGRVVMRRR"
FT   gene            complement(165028..165576)
FT                   /locus_tag="TBFG_10138"
FT                   /old_locus_tag="TBFG_00136"
FT   CDS_pept        complement(165028..165576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10138"
FT                   /old_locus_tag="TBFG_00136"
FT                   /product="peptide methionine sulfoxide reductase msrA"
FT                   /note="Mapped to H37Rv Rv0137c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04481"
FT                   /protein_id="ABR04481.1"
FT                   /translation="MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYR
FT                   NHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQK
FT                   RIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRL
FT                   PRRTAESALRASLSPELGT"
FT   gene            165639..166142
FT                   /locus_tag="TBFG_10139"
FT                   /old_locus_tag="TBFG_00137"
FT   CDS_pept        165639..166142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10139"
FT                   /old_locus_tag="TBFG_00137"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0138"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10139"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04482"
FT                   /protein_id="ABR04482.1"
FT                   /translation="MSASEFSRAELAAAFEKFEKTVARAAATRDWDCWVQHYTPDVEYI
FT                   EHAAGIMRGRQRVRAWIQETMTTFPGSHMVAFPSLWSVIDESTGRIICELDNPMLDPGD
FT                   GSVISATNISVITYAGNGQWCRQEDIYNPLRFLRAAMKWCRKAQELGTLDEDAARWMRR
FT                   HGGP"
FT   gene            166143..167165
FT                   /locus_tag="TBFG_10140"
FT                   /old_locus_tag="TBFG_00138"
FT   CDS_pept        166143..167165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10140"
FT                   /old_locus_tag="TBFG_00138"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0139"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10140"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04483"
FT                   /protein_id="ABR04483.1"
FT                   /translation="MNAPKLVIGANGFLGSHVTRQLVADCAPQKGEVRAMVRPAANTRS
FT                   IDDLPLTRFHGDVFDTATVAEAMAGCDDVYYCVVDTRAWLRDPSPLFRTNVAGLRNVLD
FT                   VATDASLRRFVFTSSYATVGRRRGHVATEEDRVDTRKVTPYVRSRVAAEDLVLQYAHDA
FT                   GLPAVAMCVSTTYGGGDWGRTPHGAFIAGAVFGRLPFTMRGIRLEAVGVDDAARALILA
FT                   AERGRNGERYLISERMMPLQEVVRIAADEAGVPPPRWSISVPVLYALGALGSLRARLTG
FT                   KDTELSLASVRMMRSEADVDHGKAVRELGWQPRPVEESIREAARFWAAMRTVGKDPAAS
FT                   "
FT   gene            167226..167606
FT                   /locus_tag="TBFG_10141"
FT                   /old_locus_tag="TBFG_00139"
FT   CDS_pept        167226..167606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10141"
FT                   /old_locus_tag="TBFG_00139"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0140"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04484"
FT                   /protein_id="ABR04484.1"
FT                   /translation="MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEA
FT                   SYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPA
FT                   VAAIAGHVACYPDKAEISIFPG"
FT   gene            complement(167587..167997)
FT                   /locus_tag="TBFG_10142"
FT                   /old_locus_tag="TBFG_00140"
FT   CDS_pept        complement(167587..167997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10142"
FT                   /old_locus_tag="TBFG_00140"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0141c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04485"
FT                   /protein_id="ABR04485.1"
FT                   /translation="MTPFDDPQAELAWMFLQSLCEGGDLDEGFALLSNDFTYWSIVTRT
FT                   ELDKKTFRRAVERRKQVFEVNIELIRCVNEGETVVVEGHCDGVSADRTRYDSPFVCIFE
FT                   TRDGMIISLREYSDTQSLAEVYPVACATPGRC"
FT   gene            168027..168953
FT                   /locus_tag="TBFG_10143"
FT                   /old_locus_tag="TBFG_00141"
FT   CDS_pept        168027..168953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10143"
FT                   /old_locus_tag="TBFG_00141"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0142"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04486"
FT                   /protein_id="ABR04486.1"
FT                   /translation="MRSIDVVVEAVVTFAGAAGFAHTLAPLRRGQQDPCFRVPGDGTIW
FT                   RTSLLPTGPVTARISRAGRDAARCVAWGSGAEEFVDMAPAMLGAADDASDFVPLHPAVA
FT                   AAHRRLPNLRLGRTGQVLEALIPAVIEQRVPGADAFRSWRLLVSKYGTQAPGPAPPGMR
FT                   VPPSAEVWRHIPSWEFHRANVDPGRARAVVGCAQRAASLERLVSLPAARAAEALTSLPG
FT                   VGVWTAAETTQRVFGDADAVSVGDYHIPKMIGWTLVGRPVDDAGMLELLEPMRPHRHRV
FT                   VRLLEASGLAREPRRGPRLPVQNIRAL"
FT   gene            complement(169020..170498)
FT                   /locus_tag="TBFG_10144"
FT                   /old_locus_tag="TBFG_00142"
FT   CDS_pept        complement(169020..170498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10144"
FT                   /old_locus_tag="TBFG_00142"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0143c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04487"
FT                   /protein_id="ABR04487.1"
FT                   /translation="MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLR
FT                   KWFLLGITIGVIAGLGAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPW
FT                   AIPLVTTGGAVLSALIVAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTI
FT                   GSGGSGGREGPTAQISAGFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAAL
FT                   GASIPYRDDFDYRNLLPGFIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVV
FT                   IGLIAAAVGYLYARVFHASVAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWA
FT                   QLAADRGTLLSIPLWIVIVLPIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLG
FT                   ELTELPGVPHEPGIFVVVAMMACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAA
FT                   LLLSRTNVTIYETQRLNRQTAEAERGGSDRPTTA"
FT   gene            170600..171442
FT                   /locus_tag="TBFG_10145"
FT                   /old_locus_tag="TBFG_00143"
FT   CDS_pept        170600..171442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10145"
FT                   /old_locus_tag="TBFG_00143"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0144"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04488"
FT                   /protein_id="ABR04488.1"
FT                   /translation="MPHSWTPTSVMTPPLVVAAFRPVGHYRLATDRAGGPCSPPATGAK
FT                   LTSSVASRPTVGTKPQWWHTLVMSMSLTAGRGPGRPPAAKADETRKRILHAARQVFSER
FT                   GYDGATFQEIAVRADLTRPAINHYFANKRVLYQEVVEQTHELVIVAGIERARREPTLMG
FT                   RLAVVVDFAMEADAQYPASTAFLATTVLESQRHPELSRTENDAVRATREFLVWAVNDAI
FT                   ERGELAADVDVSSLAETLLVVLCGVGFYIGFVGSYQRMATITDSFQQLLAGTLWRPPT"
FT   gene            171531..172484
FT                   /locus_tag="TBFG_10146"
FT                   /old_locus_tag="TBFG_00144"
FT   CDS_pept        171531..172484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10146"
FT                   /old_locus_tag="TBFG_00144"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0145"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04489"
FT                   /protein_id="ABR04489.1"
FT                   /translation="MTELDDVSSLPSSRRTAGDTWAITESVGATALGVAAARAVETAAT
FT                   NPLIRDEFAKVLVSSAGTAWARLADADLAWLDGDQLGRRVHRVACDYQAVRTHFFDEYF
FT                   GAAVDAGVRQVVILAAGLDARAYRLNWPAGTVVYEIDQPSVLEYKAGILQSHGAVPTAR
FT                   RHAVAVDLRDDWPAALIAAGFDGTQPTAWLAEGLLPYLPGDAADRLFDMVTALSAPGSQ
FT                   VAVEAFTMNTKGNTQRWNRMRERLGLDIDVQALTYHEPDRSDAAQWLATHGWQVHSVSN
FT                   REEMARLGRAIPQDLVDETVRTTLLRGRLVTPAQPA"
FT   gene            172527..173459
FT                   /locus_tag="TBFG_10147"
FT                   /old_locus_tag="TBFG_00145"
FT   CDS_pept        172527..173459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10147"
FT                   /old_locus_tag="TBFG_00145"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0146"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04490"
FT                   /protein_id="ABR04490.1"
FT                   /translation="MRTHDDTWDIKTSVGATAVMVAAARAVETDRPDPLIRDPYARLLV
FT                   TNAGAGAIWEAMLDPTLVAKAAAIDAETAAIVAYLRSYQAVRTNFFDTYFASAVAAGIR
FT                   QVVILASGLDSRAYRLDWPAGTIVYEIDQPKVLSYKSTTLAENGVTPSAGRREVPADLR
FT                   QDWPAALRDAGFDPTARTAWLAEGLLMYLPAEAQDRLFTQVGAVSVAGSRIAAETAPVH
FT                   GEERRAEMRARFKKVADVLGIEQTIDVQELVYHDQDRASVADWLTDHGWRARSQRAPDE
FT                   MRRVGRWVEGVPMADDPTAFAEFVTAERL"
FT   gene            173554..175074
FT                   /locus_tag="TBFG_10148"
FT                   /old_locus_tag="TBFG_00146"
FT   CDS_pept        173554..175074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10148"
FT                   /old_locus_tag="TBFG_00146"
FT                   /product="hypothetical aldehyde dehydrogenase (NAD+)
FT                   dependent"
FT                   /note="Mapped to H37Rv Rv0147"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04491"
FT                   /protein_id="ABR04491.1"
FT                   /translation="MSDRVKAVAPPDGRTMMTTESVARKTQKSETEAPREPAPVSDEKQ
FT                   TDVAKTVARLRKTFASGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAY
FT                   LADIATTSAEAKYAAKRVRRWMRRRYLLLEVPQLPGRGWVEYEPYGTVLIIGAWNYPFY
FT                   LTLGPAVGAIAAGNAVVLKPSEIAAASAHLMTELVYRYLDTEAIAVVQGDGAVSQELIA
FT                   QGFDRVMFTGGTEIGRKVYEGAAPHLTPVTLELGGKSPVIVAADADVDVAAKRIAWIKL
FT                   LNAGQTCVAPDYVLADATVRDELVSKITAALTKFRSGAPQGMRIVNQRQFDRLSGYLAA
FT                   AKTDAAADGGGVVVGGDCDASNLRIQPTVVVDPDPDGPLMSNEIFGPILPVVTVKSLDD
FT                   AIRFVNSRPKPLSAYLFTKSRAVRERVIREVPAGGMMVNHLAFQVSTAKLPFGGVGASG
FT                   MGAYHGRWGFEEFSHRKSVLTKPTRPDLSSFIYPPYTERAIKVARRLF"
FT   gene            175149..176009
FT                   /locus_tag="TBFG_10149"
FT                   /old_locus_tag="TBFG_00147"
FT   CDS_pept        175149..176009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10149"
FT                   /old_locus_tag="TBFG_00147"
FT                   /product="hypothetical short-chain type
FT                   dehydrogenase/reductase"
FT                   /note="Mapped to H37Rv Rv0148"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04492"
FT                   /protein_id="ABR04492.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAGEGASVVVNDLGGARDGT
FT                   GAGSAMADEVVAEIRDKGGRAVANYDSVATEDGAANIIKTALDEFGAVHGVVSNAGILR
FT                   DGTFHKMSFENWDAVLKVHLYGGYHVLRAAWPHFREQSYGRVVVATSTSGLFGNFGQTN
FT                   YGAAKLGLVGLINTLALEGAKYNIHANALAPIAATRMTQDILPPEVLEKLTPEFVAPVV
FT                   AYLCTEECADNASVYVVGGGKVQRVALFGNDGANFDKPPSVQDVAARWAEITDLSGAKI
FT                   AGFKL"
FT   gene            176016..176984
FT                   /locus_tag="TBFG_10150"
FT                   /old_locus_tag="TBFG_00148"
FT   CDS_pept        176016..176984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10150"
FT                   /old_locus_tag="TBFG_00148"
FT                   /product="hypothetical quinone oxidoreductase
FT                   (NADPH:quinone oxidoreductase) (zeta-crystallin)"
FT                   /note="Mapped to H37Rv Rv0149"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10150"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04493"
FT                   /protein_id="ABR04493.1"
FT                   /translation="MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLL
FT                   LTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANV
FT                   VRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQ
FT                   AGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDD
FT                   ALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGL
FT                   NQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP"
FT   gene            complement(176981..177268)
FT                   /locus_tag="TBFG_10151"
FT                   /old_locus_tag="TBFG_00149"
FT   CDS_pept        complement(176981..177268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10151"
FT                   /old_locus_tag="TBFG_00149"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0150c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10151"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04494"
FT                   /protein_id="ABR04494.1"
FT                   /translation="MLTLPDDRAPTGLPDPGIEALAHTKIASTISTVVADGYAVVLSTA
FT                   DIANSLLANAIGYPIAASVALVTPAAGANSSCWPADPSQHHRIAESRACA"
FT   gene            complement(177859..179625)
FT                   /locus_tag="TBFG_10152"
FT                   /old_locus_tag="TBFG_00150"
FT   CDS_pept        complement(177859..179625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10152"
FT                   /old_locus_tag="TBFG_00150"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0151c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04495"
FT                   /protein_id="ABR04495.1"
FT                   /translation="MAPFGFTPKARHNRGVALRSTYRLDGWVMGPVDKEGWGLSYVFAQ
FT                   PSVLAAAATDLAGIGSAINQATAAVAAPTTGLAAAAADEVSTALATLFGAYGQQFQAIS
FT                   AQVAAFHNEFTQRLAAAANAFVNAEATNTSALVQEATAGLFKPTSPPVLPPMFNQNTAI
FT                   IMGGTGSPIPTPSYVNAITTLFIDPVVSNPVVKALVTPEELYPITGVKSLPFQTSVQLG
FT                   LQILDGAIWEQINAGNHVTVFGYSQSAVIASLEMQHLISLGPNAPSPSQLNFILIGNEM
FT                   NPNGGILARIPGLNVTTLGLPFYGATPDNPYPTTTYTLEYDGFADFPRYPLNVLSDINA
FT                   VFGILTVHTTYADLTPAQIASATQLPTQGTTSNTYYIIETEHLPLLAPLRAIPVIGPPL
FT                   AALVEPNLEVIVNLGYGDPRFGYSTSPANVPTPFGLFPDVPASVVADALVAGTQQGVND
FT                   FMVELPAALNTLPQTPMPAFPPYVPTLLPPPPPPQPATLINIADTFASVVSTGYSILLP
FT                   TADLGLAFVTILPAYDLTLFVNQLAAGNLRAAIELPLAATIGLAALGGMIEFIAIVVTL
FT                   ADITQQLQSFSI"
FT   gene            complement(179635..181236)
FT                   /locus_tag="TBFG_10153"
FT                   /old_locus_tag="TBFG_00151"
FT   CDS_pept        complement(179635..181236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10153"
FT                   /old_locus_tag="TBFG_00151"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0152c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04496"
FT                   /protein_id="ABR04496.1"
FT                   /translation="MHWPRRPAMRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLA
FT                   AAANSYADAEAAIASTRQNQLAVPAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPS
FT                   MLTPPIRCRSVRRALQAVFTPEELYPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGN
FT                   AVTVFGWSQSAIIASLEMQRFTAMGGAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLP
FT                   TLDLTFYGATPSDTIYPTAIYTLEYDGFADFSRYPLNFISDLNAVAGITFVHTKYLDLT
FT                   PAQVEGATKLPTSPGYTEVTDYYIIRTENRPLLQPLRAVPVIGDPLADLIQPNLKVIVN
FT                   LGYGDPNYGYSTSYADVRTPFGLWPNVPPQVIADALAAGTQEGILDFTADLQALSAQPL
FT                   TLPQIQLPQPADLVAAVAAAPTPAEVVNTLARIISTNYAVLLPTVDIALALVTTLPLYT
FT                   TQLFVRQLAAGNLINAIGYPLAATVGLGTIDSGRRGIAHPPRGGLGHRSKHRGPRHLTD
FT                   SRRHRRPPTTVYRPRQ"
FT   gene            complement(181471..182301)
FT                   /locus_tag="TBFG_10154"
FT                   /old_locus_tag="TBFG_00152"
FT   CDS_pept        complement(181471..182301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10154"
FT                   /old_locus_tag="TBFG_00152"
FT                   /product="phosphotyrosine protein phosphatase ptpb"
FT                   /note="Mapped to H37Rv Rv0153c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04497"
FT                   /protein_id="ABR04497.1"
FT                   /translation="MAVRELPGAWNFRDVADTATALRPGRLFRSSELSRLDDAGRATLR
FT                   RLGITDVADLRSSREVARRGPGRVPDGIDVHLLPFPDLADDDADDSAPHETAFKRLLTN
FT                   DGSNGESGESSQSINDAATRYMTDEYRQFPTRNGAQRALHRVVTLLAAGRPVLTHCFAG
FT                   KDRTGFVVALVLEAVGLDRDVIVADYLRSNDSVPQLRARISEMIQQRFDTELAPEVVTF
FT                   TKARLSDGVLGVRAEYLAAARQTIDETYGSLGGYLRDAGISQATVNRMRGVLLG"
FT   gene            complement(182303..183514)
FT                   /locus_tag="TBFG_10155"
FT                   /old_locus_tag="TBFG_00153"
FT   CDS_pept        complement(182303..183514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10155"
FT                   /old_locus_tag="TBFG_00153"
FT                   /product="acyl-CoA dehydrogenase fadE2"
FT                   /note="Mapped to H37Rv Rv0154c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04498"
FT                   /protein_id="ABR04498.1"
FT                   /translation="MSAKAIDYRTRLSDFMTEHVFGAEADYDDYRRAAGPADHTAPPII
FT                   EELKTKAKDRGLWNLFLSAESGLTNLEYAPLAEMTGWSMEIAPEALNCAAPDTGNMEIL
FT                   HMFGTEQQRAQWLRPLLDGKIRSAFSMTEPAVASSDARNIETTISRDGADYVINGRKWW
FT                   TSGAADPRCKILIVMGRTNPDAAAHQQQSMVLVPIDTPGVTIVRSTPVFGWQDRHGHCE
FT                   IDYHNVRVPATNLLGEEGSGFAIAQARLGPGRIHHCMRALGAAERALALMVNRVRNRVA
FT                   FGRPLAEQGVVQQAIAQSRNEIDQARLLCEKAAWTIDQHGNKEARHLVAMIKAVAPRVA
FT                   CDVIDRAIQVHGAAGVSDDTPLARLYGWHRAMRIFDGPDEVHLRSIARAELSREKSTFA
FT                   AAVT"
FT   gene            183938..185038
FT                   /locus_tag="TBFG_10156"
FT                   /old_locus_tag="TBFG_00154"
FT   CDS_pept        183938..185038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10156"
FT                   /old_locus_tag="TBFG_00154"
FT                   /product="NAD(P) transhydrogenase alpha subunit pntAa"
FT                   /note="Mapped to H37Rv Rv0155"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04499"
FT                   /protein_id="ABR04499.1"
FT                   /translation="MTDPQTQSTRVGVVAESGPDERRVALVPKAVASLVNRGVAVVVEA
FT                   GAGERALLPDELYTAVGASIGDAWAADVVVKVAPPTAAEVGRLRGGQTLIGFLAPRNAD
FT                   NSIGALTQAGVQAFALEAIPRISRAQVMDALSSQANVSGYKAVLLAASESTRFFPMLTT
FT                   AAGTVKPATVLVLGVGVAGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLDLGIS
FT                   ASGEGGYARELTDDERAQQQKALEEAISGFDVVITTALVPGRPAPTLVTAAAVEAMKPG
FT                   SVVVDLAGETGGNCELTEPGRTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLL
FT                   IKDGRLAPDFDDEVIAQSCVTRGKDS"
FT   gene            185039..185371
FT                   /locus_tag="TBFG_10157"
FT                   /old_locus_tag="TBFG_00155"
FT   CDS_pept        185039..185371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10157"
FT                   /old_locus_tag="TBFG_00155"
FT                   /product="NAD(P) transhydrogenase alpha subunit pntAb"
FT                   /note="Mapped to H37Rv Rv0156"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04500"
FT                   /protein_id="ABR04500.1"
FT                   /translation="MYNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPD
FT                   RDEALR"
FT   gene            185368..186795
FT                   /locus_tag="TBFG_10158"
FT                   /old_locus_tag="TBFG_00156"
FT   CDS_pept        185368..186795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10158"
FT                   /old_locus_tag="TBFG_00156"
FT                   /product="NAD(P) transhydrogenase beta subunit pntB"
FT                   /note="Mapped to H37Rv Rv0157"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04501"
FT                   /protein_id="ABR04501.1"
FT                   /translation="MNLHYLVEILYIISFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIA
FT                   VAATLVMIRHTSQWPLIIAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIA
FT                   LSEFIDTTGFSAFQHGESPTVHIVVASLFAAIIGSISFWGSIVAFGKLQEIISGRPIGL
FT                   GKAQQPINLLLLAVAVAAAVVIGLHAHPGSGGVALWWMIGLLVAAGVLGLMVVLPIGGA
FT                   DMPVVISMLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIV
FT                   AGGFGGGGVAPSGGGDDKHVKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDLA
FT                   TLLEDRGVPVKYAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVTIVIG
FT                   ANDVTNPAARNETSSPIYGMPILNVDKSRSVIVLKRSMNSGFAGIDNPLFYADGTTMLF
FT                   GDAKKSVTEVSEELKAL"
FT   gene            187101..187745
FT                   /locus_tag="TBFG_10159"
FT                   /old_locus_tag="TBFG_00157"
FT   CDS_pept        187101..187745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10159"
FT                   /old_locus_tag="TBFG_00157"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0158"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04502"
FT                   /protein_id="ABR04502.1"
FT                   /translation="MPSDTSPNGLSRREELLAVATKLFAARGYHGTRMDDVADVIGLNK
FT                   ATVYHYYASKSLILFDIYRQAAEGTLAAVHDDPSWTAREALYQYTVRLLTAIASNPERA
FT                   AVYFQEQPYITEWFTSEQVAEVREKEQQVYEHVHGLIDRGIASGEFYECDSHVVALGYI
FT                   GMTLGSYRWLRPSGRRTAKEIAAEFSTALLRGLIRDESIRNQSPLGTRKET"
FT   gene            complement(187749..189155)
FT                   /locus_tag="TBFG_10160"
FT                   /old_locus_tag="TBFG_00158"
FT   CDS_pept        complement(187749..189155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10160"
FT                   /old_locus_tag="TBFG_00158"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0159c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04503"
FT                   /protein_id="ABR04503.1"
FT                   /translation="MSYVIAAPEMLATAAADVDGIGSAIRAASASAAGPTTGLLAAAAD
FT                   EVSSAAAALFSEYARECQEVLKQAAAFHGEFTRALAAAGAAYAQAEASNTAAMSGTAGS
FT                   SGALGSVGMLSGNPLTALMMGGTGEPILSDRVLAIIDSAYIRPIFGPNNPVAQYTPEQW
FT                   WPFIGNLSLDQSIAQGVTLLNNGINAELQNGHDVVVFGYSQSAAVATNEIRALMALPPG
FT                   QAPDPSRLAFTLIGNINNPNGGVLERYVGLYLPFLDMSFNGATPPDSPYQTYMYTGQYD
FT                   GYAHNPQYPLNILSDLNAFMGIRWVHNAYPFTAAEVANAVPLPTSPGYTGNTHYYMFLT
FT                   QDLPLLQPIRAIPFVGTPIAELIQPDLRVLVDLGYGYGYADVPTPASLFAPINPIAVAS
FT                   ALATGTVQGPQAALVSIGLLPQSALPNTYPYLPSANPGLMFNFGQSSVTELSVLSGALG
FT                   SVARLIPPIA"
FT   gene            complement(189247..190755)
FT                   /locus_tag="TBFG_10161"
FT                   /old_locus_tag="TBFG_00159"
FT   CDS_pept        complement(189247..190755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10161"
FT                   /old_locus_tag="TBFG_00159"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0160c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04504"
FT                   /protein_id="ABR04504.1"
FT                   /translation="MSHLVTAPDMLATAAAHVDEIASTLRAANAAAAGPTCNLLAAAGD
FT                   EVSAATAALFSAYGREYQAVVKQAAAFHSEFTRTLEAAGNAYAHAEAANAARVSHALDT
FT                   INAPIRTLLGRAPLSPNGSSGAGGLPAIAQLAAESPITALIMGGTNNPLPDPEYVTDIN
FT                   KAFIQTLFPGAVSQGLFTPEQFWPVTPDLGNLTFNQSVTEGVALLNTAVNNQLALDNKV
FT                   VAFGYSQSATIINNYINSLMAMGSPNPDDISFVMIGSGNNPVGGLLARFPGFYIPFLDV
FT                   PFNGATPANSPYPTHIYTAQYDGIAHAPQFPLRILSDINAFMGYFYVHNTYPELMATQV
FT                   DNAVPLPTSPGYTGNTQYYMFLTQDLPLLQPIRDIPYAGPPIADLFQPQLRVLVDLGYA
FT                   DYGPGGNYADIPTPAGLFSIPNPFAVTYYLIKGSLQAPYGAIVEIGVEAGLIGPEWFPD
FT                   SYPWVPSINPGLNFYFGQPQVTLLSLMSGGLGNILHLIPPPVFT"
FT   gene            190923..192272
FT                   /locus_tag="TBFG_10162"
FT                   /old_locus_tag="TBFG_00160"
FT   CDS_pept        190923..192272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10162"
FT                   /old_locus_tag="TBFG_00160"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0161"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04505"
FT                   /protein_id="ABR04505.1"
FT                   /translation="MLTSLVSAVGSHHVTTDPDVLAGRSVDHTGRYRGRASALVRPGSA
FT                   EEVAEVLRVCRDAGAYVTVQGGRTSLVAGTVPEHDDVLLSTERLCVVSDVDTVERRIEI
FT                   GAGVTLAAVQHAASTAGLVFGVDLSARDTATVGGMASTNAGGLRTVRYGNMGEQVVGLD
FT                   VALPDGTVLRRHSRVRRDNTGYDLPALFVGAEGTLGVITALDLRLHPTPSHRVTAVCGF
FT                   AELAALVDAGRMFRDVEGIAALELIDGRAAALTREHLGVRPPVEADWLLLVELAADHDQ
FT                   TDRLADLLGGARMCGEPAVGVDAAAQQRLWRTRESLAEVLGVYGPPLKFDVSLPLSAIS
FT                   GFARDAVALVHRHVPDSPEALPLLFGHIGEGNLHLNVLRCPPDREPALYAKMMGLIAEC
FT                   GGNVSSEHGVGSRKRAYLGMSRQANDVAAMRRVKAALDPTGYLNAAVLFD"
FT   gene            complement(192300..193451)
FT                   /locus_tag="TBFG_10163"
FT                   /old_locus_tag="TBFG_00161"
FT   CDS_pept        complement(192300..193451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10163"
FT                   /old_locus_tag="TBFG_00161"
FT                   /product="zinc-type alcohol dehydrogenase subunit E adhE"
FT                   /note="Mapped to H37Rv Rv0162c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04507"
FT                   /protein_id="ABR04507.1"
FT                   /translation="MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPP
FT                   DRGEVLVRIEAAGVCHSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVV
FT                   LVFLPRCGQCAACATDGRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATH
FT                   VVVNRASVVPVPHEVPPTVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAV
FT                   LTALTYTDVRVVAVDQLPEKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALH
FT                   TAIGLTAPGGRTITVGLPPPDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLW
FT                   QSGRLPVESLVTSTIRLDDINEAMDHLADGIAVRQLISFTGDL"
FT   gene            193433..193888
FT                   /locus_tag="TBFG_10164"
FT                   /old_locus_tag="TBFG_00162"
FT   CDS_pept        193433..193888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10164"
FT                   /old_locus_tag="TBFG_00162"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0163"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04506"
FT                   /protein_id="ABR04506.1"
FT                   /translation="MAALPAPEKLLRSDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDT
FT                   AINAWINTSTGVDPLAMPVLGIVAESGCRYFSELRFPESLMVGLAVTRLGRSSVTYRLG
FT                   VFKEPDDAGVITALGHWVHVYVDRTSRRPVPIPEAIRSLLSTACVSG"
FT   gene            193942..194427
FT                   /locus_tag="TBFG_10165"
FT                   /old_locus_tag="TBFG_00163"
FT   CDS_pept        193942..194427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10165"
FT                   /old_locus_tag="TBFG_00163"
FT                   /product="conserved hypothetical protein TB18.5"
FT                   /note="Mapped to H37Rv Rv0164"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04508"
FT                   /protein_id="ABR04508.1"
FT                   /translation="MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEW
FT                   NEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQ
FT                   EQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS"
FT   gene            complement(194460..195254)
FT                   /locus_tag="TBFG_10166"
FT                   /old_locus_tag="TBFG_00164"
FT   CDS_pept        complement(194460..195254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10166"
FT                   /old_locus_tag="TBFG_00164"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0165c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04509"
FT                   /protein_id="ABR04509.1"
FT                   /translation="MIKHDVVWVTLWPERPNNKPPPSPRQVPGNPGPTLKVLASHVNAP
FT                   LSAKPRSQLPLRRAQLSDEVAGHLRAAIMSGALRSGTFIRLDETAAELGVSVTPVREAL
FT                   LKLRGEGMVGLEPHRGHVVLPLTRQDIDDIFWLQATIAQELATSATAHITDVEIDELDR
FT                   INNALAGAIGSGDAKTIASIEFAFHRVFNKASRRIKLAWFLLNAARYMGAGVRGRPAMG
FT                   RGRGEQSSAADRRAAPPRHSRRNRAHRLAVHRWGTQADGGPG"
FT   gene            195309..196973
FT                   /locus_tag="TBFG_10167"
FT                   /old_locus_tag="TBFG_00165"
FT   CDS_pept        195309..196973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10167"
FT                   /old_locus_tag="TBFG_00165"
FT                   /product="fatty-acid-CoA ligase fadD5"
FT                   /note="Mapped to H37Rv Rv0166"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04510"
FT                   /protein_id="ABR04510.1"
FT                   /translation="MTAQLASHLTRALTLAQQQPYLARRQNWVNQLERHAMMQPDAPAL
FT                   RFVGNTMTWADLRRRVAALAGALSGRGVGFGDRVMILMLNRTEFVESVLAANMIGAIAV
FT                   PLNFRLTPTEIAVLVEDCVAHVMLTEAALAPVAIGVRNIQPLLSVIVVAGGSSQDSVFG
FT                   YEDLLNEAGDVHEPVDIPNDSPALIMYTSGTTGRPKGAVLTHANLTGQAMTALYTSGAN
FT                   INSDVGFVGVPLFHIAGIGNMLTGLLLGLPTVIYPLGAFDPGQLLDVLEAEKVTGIFLV
FT                   PAQWQAVCTEQQARPRDLRLRVLSWGAAPAPDALLRQMSATFPETQILAAFGQTEMSPV
FT                   TCMLLGEDAIAKRGSVGRVIPTVAARVVDQNMNDVPVGEVGEIVYRAPTLMSCYWNNPE
FT                   ATAEAFAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAELENVLASHPDIAE
FT                   VAVIGRADEKWGEVPIAVAAVTNDDLRIEDLGEFLTDRLARYKHPKALEIVDALPRNPA
FT                   GKVLKTELRLRYGACVNVERRSASAGFTERRENRQKL"
FT   gene            197177..197974
FT                   /locus_tag="TBFG_10168"
FT                   /old_locus_tag="TBFG_00166"
FT   CDS_pept        197177..197974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10168"
FT                   /old_locus_tag="TBFG_00166"
FT                   /product="hypothetical integral membrane protein yrbE1A"
FT                   /note="Mapped to H37Rv Rv0167"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04511"
FT                   /protein_id="ABR04511.1"
FT                   /translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE
FT                   FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL
FT                   TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL
FT                   VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG
FT                   LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR"
FT   gene            197976..198845
FT                   /locus_tag="TBFG_10169"
FT                   /old_locus_tag="TBFG_00167"
FT   CDS_pept        197976..198845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10169"
FT                   /old_locus_tag="TBFG_00167"
FT                   /product="hypothetical integral membrane protein yrbE1B"
FT                   /note="Mapped to H37Rv Rv0168"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04512"
FT                   /protein_id="ABR04512.1"
FT                   /translation="MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQ
FT                   IAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
FT                   VEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   FLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFW
FT                   SFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGV
FT                   DPNFNLTV"
FT   gene            198850..200214
FT                   /locus_tag="TBFG_10170"
FT                   /old_locus_tag="TBFG_00168"
FT   CDS_pept        198850..200214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10170"
FT                   /old_locus_tag="TBFG_00168"
FT                   /product="MCE-family protein mce1A"
FT                   /note="Mapped to H37Rv Rv0169"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04513"
FT                   /protein_id="ABR04513.1"
FT                   /translation="MTTPGKLNKARVPPYKTAGLGLVLVFALVVALVYLQFRGEFTPKT
FT                   QLTMLSARAGLVMDPGSKVTYNGVEIGRVDTISEVTRDGESAAKFILDVDPRYIHLIPA
FT                   NVNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKV
FT                   DPVKLNLTLSAAAEALTGLGDKFGESIVNANTVLDDLNSRMPQSRHDIQQLAALGDVYA
FT                   DAAPDLFDFLDSSVTTARTINAQQAELDSALLAAAGFGNTTADVFDRGGPYLQRGVADL
FT                   VPTATLLDTYSPELFCTIRNFYDADPLAKAASGGGNGYSLRTNSEILSGIGISLLSPLA
FT                   LATNGAAIGIGLVAGLIAPPLAVAANLAGALPGIVGGAPNPYTYPENLPRVNARGGPGG
FT                   APGCWQPITRDLWPAPYLVMDTGASLAPYNHMEVGSPYAVEYVWGRQVGDNTINP"
FT   gene            200211..201251
FT                   /locus_tag="TBFG_10171"
FT                   /old_locus_tag="TBFG_00169"
FT   CDS_pept        200211..201251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10171"
FT                   /old_locus_tag="TBFG_00169"
FT                   /product="MCE-family protein mce1B"
FT                   /note="Mapped to H37Rv Rv0170"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04514"
FT                   /protein_id="ABR04514.1"
FT                   /translation="MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEFSN
FT                   VSGLRQGQFVRASGVEIGKVKALHLVDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIG
FT                   NRYVELKRGEGKGANDLLPPGGLIPLSRTSPALDLDALIGGFKPVFRALDPAKVNNIAN
FT                   ALITVFQGQGGTINDILDQTAQLTSQIAERDQAIGEVVKNLNIVLDTTVKHRKEFDETV
FT                   NNLENLITGLRNHSDQLAGGLAHISNGAGTVADLLAENRTLVRKAVSYLDAIQQPVIDQ
FT                   RVELDDLLHKTPTALTALGRANGTYGDFQNFYLCDLQIKWNGFQAGGPVRTVKLFSQPT
FT                   GRCTPQ"
FT   gene            201248..202795
FT                   /locus_tag="TBFG_10172"
FT                   /old_locus_tag="TBFG_00170"
FT   CDS_pept        201248..202795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10172"
FT                   /old_locus_tag="TBFG_00170"
FT                   /product="MCE-family protein mce1C"
FT                   /note="Mapped to H37Rv Rv0171"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04515"
FT                   /protein_id="ABR04515.1"
FT                   /translation="MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQ
FT                   FTDSGGLHKGDRVRIAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILG
FT                   RKVLEIEPRGAQALPPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSE
FT                   TVDQTYPHLSAALDGVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAK
FT                   TLIAAFNERGRAVDALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLA
FT                   ETLTILGRFSASFGETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAG
FT                   LPAYRWPDPNGTRFPNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPL
FT                   PCANLTQGPFGGPDFPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQ
FT                   EAPPGARTLPLGPAPGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
FT   gene            202792..204384
FT                   /locus_tag="TBFG_10173"
FT                   /old_locus_tag="TBFG_00171"
FT   CDS_pept        202792..204384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10173"
FT                   /old_locus_tag="TBFG_00171"
FT                   /product="MCE-family protein mce1D"
FT                   /note="Mapped to H37Rv Rv0172"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04516"
FT                   /protein_id="ABR04516.1"
FT                   /translation="MSTIFDIRNLRLPQLSRASVVIGSLVVVLALAAGIVGVRLYQKLT
FT                   NNTVVAYFTQANALYVGDKVQIMGLPVGSIDKIEPAGDKMKVTFHYQNKYKVPANASAV
FT                   ILNPTLVASRNIQLEPPYRGGPVLADNAVIPVERTQVPTEWDELRDSVSHIIDELGPTP
FT                   EQPKGPFGEVIEAFADGLAGKGKQINTTLNSLSQALNALNEGRGDFFAVVRSLALFVNA
FT                   LHQDDQQFVALNKNLAEFTDRLTHSDADLSNAIQQFDSLLAVVRPFFAKNREVLTHDVN
FT                   NLATVTTTLLQPDPLDGLETVLHIFPTLAANINQLYHPTHGGVVSLSAFTNFANPMEFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPVLDAIKFNYFPFGLNVASTASTLPKEIAYSEPRL
FT                   QPPNGYKDTTVPGIWVPDTPLSHRNTQPGWVVAPGMQGVQVGPITQGLLTPESLAELMG
FT                   GPDIAPPSSGLQTPPGPPNAYDEYPVLPPIGLQAPQVPIPPPPPGPDVIPGPVPPTPAP
FT                   VGAPLPAEAGGGQ"
FT   gene            204381..205553
FT                   /locus_tag="TBFG_10174"
FT                   /old_locus_tag="TBFG_00172"
FT   CDS_pept        204381..205553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10174"
FT                   /old_locus_tag="TBFG_00172"
FT                   /product="MCE-family lipoprotein lprK (MCE-family
FT                   lipoprotein mce1e)"
FT                   /note="Mapped to H37Rv Rv0173"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04517"
FT                   /protein_id="ABR04517.1"
FT                   /translation="MMSVLARMRVMRHRAWQGLVLLVLALLLSSCGWRGISNVAIPGGP
FT                   GTGPGSYTIYVQMPDTLAINGNSRVMVADVWVGSIRAIKLKNWVATLTLSLKKDVTLPK
FT                   NATAKIGQTSLLGSQHVELAAPPDPSPVPLKDGDTIPLKRSSAYPTTEQTLASIATLLR
FT                   GGGLVNLEGIQQEINAIVTGRADQIRAFLGKLDTFTDELNQQRDDITRAIDSTNRLLAY
FT                   VGGRSEVLNRVLTDLPPLIKHFADKQELLINASDAVGRLSQSADQYLSAARGDLHQDLQ
FT                   ALQCPLKELRRAAPYLVGALKLILTQPFDVDTVPQLVRGDYMNLSLTLDLTYSAIDNAF
FT                   LTGTGFSGALRALEQSFGRDPETMIPDIRYTPNPNDAPGGPLVERGNRQC"
FT   gene            205547..207094
FT                   /locus_tag="TBFG_10175"
FT                   /old_locus_tag="TBFG_00173"
FT   CDS_pept        205547..207094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10175"
FT                   /old_locus_tag="TBFG_00173"
FT                   /product="MCE-family protein mce1F"
FT                   /note="Mapped to H37Rv Rv0174"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04518"
FT                   /protein_id="ABR04518.1"
FT                   /translation="MLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKAD
FT                   LPASGGLYPTANVTYRGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAV
FT                   GEQYIDLVSTGAPGKYFSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETA
FT                   QAVGGLGPALQRLVDSTQAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKL
FT                   NNLAAQTATRDQNVRSILSQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAG
FT                   VEQLLVFLPQGAAIAQTVLTPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPR
FT                   PLPSGTYCKIPQDAQLQVRGARNIPCVDVPGKRAATPKECRSKDPYVPLGTNPWFGDPN
FT                   QILTCPAPGARCDQPVKPGLVIPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQ
FT                   CNGQQPNPCVYTPTSGPSAVYSPASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS"
FT   gene            207130..207771
FT                   /locus_tag="TBFG_10176"
FT                   /old_locus_tag="TBFG_00174"
FT   CDS_pept        207130..207771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10176"
FT                   /old_locus_tag="TBFG_00174"
FT                   /product="MCE associated membrane protein"
FT                   /note="Mapped to H37Rv Rv0175"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04519"
FT                   /protein_id="ABR04519.1"
FT                   /translation="MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVE
FT                   RRPSRLRRGWLVGIAATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAA
FT                   TQAPDAGAMSASMQKIIECGTGDFGAQASLYTSTLVEAYQAASVHVQVTDMRAAVERNN
FT                   NDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK"
FT   gene            207768..208736
FT                   /locus_tag="TBFG_10177"
FT                   /old_locus_tag="TBFG_00175"
FT   CDS_pept        207768..208736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10177"
FT                   /old_locus_tag="TBFG_00175"
FT                   /product="MCE associated membrane protein"
FT                   /note="Mapped to H37Rv Rv0176"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04520"
FT                   /protein_id="ABR04520.1"
FT                   /translation="MTVVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMA
FT                   LTALTVPPGSAWRWLCACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAI
FT                   GPWRLLVRDLAHLVDTLSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRL
FT                   TAAVALAAAGACASATAVGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRD
FT                   FERARSLATDRYRPQLSIQQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERG
FT                   TPPNQRYIQSTVRAIFQKSRGQWRLDDLAVVMKPRQPTGEK"
FT   gene            208733..209287
FT                   /locus_tag="TBFG_10178"
FT                   /old_locus_tag="TBFG_00176"
FT   CDS_pept        208733..209287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10178"
FT                   /old_locus_tag="TBFG_00176"
FT                   /product="MCE associated protein"
FT                   /note="Mapped to H37Rv Rv0177"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04521"
FT                   /protein_id="ABR04521.1"
FT                   /translation="MSPRRKFEPGEGALLAPQSIEPSRRWGLPLALTASAVVMAAAISA
FT                   CALMRISHESHQRAAHKDIVMLSDVRSFMTMFTSPDPFHANEYAERVLSHATGDFAKQY
FT                   HERANDILIRISGVEPTTGTVLDAGVQRWNEDGSANVLVVTQITSKSADGKRVVSNANR
FT                   WLVTAKQEGNEWKISSLLPVI"
FT   gene            209254..209988
FT                   /locus_tag="TBFG_10179"
FT                   /old_locus_tag="TBFG_00177"
FT   CDS_pept        209254..209988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10179"
FT                   /old_locus_tag="TBFG_00177"
FT                   /product="MCE associated membrane protein"
FT                   /note="Mapped to H37Rv Rv0178"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04522"
FT                   /protein_id="ABR04522.1"
FT                   /translation="MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDER
FT                   GAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPY
FT                   LSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIA
FT                   AANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKR
FT                   YDARWLVTRMTTITSLDLTPQV"
FT   gene            complement(210019..211128)
FT                   /locus_tag="TBFG_10180"
FT                   /old_locus_tag="TBFG_00178"
FT   CDS_pept        complement(210019..211128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10180"
FT                   /old_locus_tag="TBFG_00178"
FT                   /product="lipoprotein lprO"
FT                   /note="Mapped to H37Rv Rv0179c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04523"
FT                   /protein_id="ABR04523.1"
FT                   /translation="MWIRAERVAVLTPTASLRRLTACYAALAVCAALACTTGQPAARAA
FT                   DGREMLAQAIATTRGSYLVYNFGGGHPMPLLNAGGHWYEMNNGGHLMIIKNASQRLSPH
FT                   LLVDTHTGDQARCEHNPGARTGEGLWQASEIYPPLKAWQRMGRPTIAVNANFFDVRGQK
FT                   GGSWRSTGCSSPLGAYVDNTRGQGRANQAVTGTVAYAGKQGLSGGNELWSSLTTMILPV
FT                   GGAPYVLRPKSRQDYDLATPVIEDLLNKNARFVAVAGIGLLSPGNTGQLHDGGPSAART
FT                   ALAYAKQKDEMYIFQGGNYTPDNIQDLFRGLGSDTAILLDGGGSSAIVLRRDTGGMWAG
FT                   AGSPKGSCDTRQVLCDSHERALPSWLAFN"
FT   gene            complement(211208..212566)
FT                   /locus_tag="TBFG_10181"
FT                   /old_locus_tag="TBFG_00179"
FT   CDS_pept        complement(211208..212566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10181"
FT                   /old_locus_tag="TBFG_00179"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0180c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04524"
FT                   /protein_id="ABR04524.1"
FT                   /translation="MSQAQPRPAAPNPKRNVKAIRTVRFWMAPIATTLALMSALAALYL
FT                   GGILNPMTNLRHFPIALVNEDAGPAGQQIVDGLVSGLDKNKFDIRVVSPDEARRLLDTA
FT                   AVYGSALIPPTFSSQLRDFGASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALT
FT                   VVNGKVGERLTAEVAAQTGGVALAGAAAAGLASPIDVKSTAYNPLPNGTGNGLSAFYYA
FT                   LLLLLAGFTGSIVVSTLVDSMLGYVPAEFGPVYRFAEQVNISRFRTLLVKWAVMVVLAL
FT                   LTSGVYLAIAHGLGMPIPLGWQVWLYGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVI
FT                   LGLPSAGATVPLEAVPAFFRWLAQFEPMHQVFLGVRSLLYLNGNADAGLSQALTMTSIG
FT                   LIIGLLLGGFITHLYDRSSFHRIPGAVEMAIAVEHQAQYQARQSARESSSEQP"
FT   gene            complement(212593..213327)
FT                   /locus_tag="TBFG_10182"
FT                   /old_locus_tag="TBFG_00180"
FT   CDS_pept        complement(212593..213327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10182"
FT                   /old_locus_tag="TBFG_00180"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0181c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04525"
FT                   /protein_id="ABR04525.1"
FT                   /translation="MTATVEIRRAADRAVTTTSWLKSRHSFSFGDHYDPDNTHHGLLLV
FT                   NNDDQMEPASGFDPHPHRDMEIVTWVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILH
FT                   SEMNDSATEPVHFVQMWVIPDATGITASYQQQEIDDELLRAGLVTIASGIPGQDAALTL
FT                   HNSSASLHGARLRPGATVSLPCAPFLHLFVAYGRLTLEGGGELADGDAVRFTDADAHGL
FT                   TANEPSEVLIWEMHAKLGDSAT"
FT   gene            complement(213344..214456)
FT                   /locus_tag="TBFG_10183"
FT                   /old_locus_tag="TBFG_00181"
FT   CDS_pept        complement(213344..214456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10183"
FT                   /old_locus_tag="TBFG_00181"
FT                   /product="alternative RNA polymerase sigma factor sigG"
FT                   /note="Mapped to H37Rv Rv0182c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04527"
FT                   /protein_id="ABR04527.1"
FT                   /translation="MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAEN
FT                   SGREPADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEGFAGK
FT                   SSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERREVSWLEPLPDVTD
FT                   DPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLRDVLQWKSAEVADAIGTSTVAVN
FT                   SLLQRARSQLQTVRPSAADRLSAPDSPEAQDLLARYIAAFEAYDIDRLVELFTAEAIWE
FT                   MPPYTGWYQGAQAIVTLIHQQCPAYSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLH
FT                   VLDMAADRVSHVVAFLDTTLFPKFGLPDSL"
FT   gene            214404..215243
FT                   /locus_tag="TBFG_10184"
FT                   /old_locus_tag="TBFG_00182"
FT   CDS_pept        214404..215243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10184"
FT                   /old_locus_tag="TBFG_00182"
FT                   /product="hypothetical lysophospholipase"
FT                   /note="Mapped to H37Rv Rv0183"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04526"
FT                   /protein_id="ABR04526.1"
FT                   /translation="MTTTRTERNFAGIGDVRIVYDVWTPDTAPQAVVVLAHGLGEHARR
FT                   YDHVAQRLGAAGLVTYALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATREYPGCKR
FT                   IVLGHSMGGGIVFAYGVERPDNYDLMVLSAPAVAAQDLVSPVVAVAAKLLGVVVPGLPV
FT                   QELDFTAISRDPEVVQAYNTDPLVHHGRVPAGIGRALLQVGETMPRRAPALTAPLLVLH
FT                   GTDDRLIPIEGSRRLVECVGSADVQLKEYPGLYHEVFNEPERNQVLDDVVAWLTERL"
FT   gene            215285..216034
FT                   /locus_tag="TBFG_10185"
FT                   /old_locus_tag="TBFG_00183"
FT   CDS_pept        215285..216034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10185"
FT                   /old_locus_tag="TBFG_00183"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0184"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04528"
FT                   /protein_id="ABR04528.1"
FT                   /translation="MTNDKMLARIAALLRQAEGTDNPHEADAFMSTAQRLATAASIDLA
FT                   VARSHAGNRSPAQAPTQRTITIGAAGTRGLRTYVQLFVLIAAANDVRCDVASNSTFVYA
FT                   YGFAEDIDTSHALYASLVVQMVRASDAYLASGAHRPTPTITARLNFQLAFGARVGQRLA
FT                   DAREQTRQEATKDRDRPPGTAIALRDKDIELHEYYRRSSKARGAWRASRATAGYSSAAR
FT                   RAGDRAGRQARLGNNPELPGARAALGR"
FT   gene            216031..216540
FT                   /locus_tag="TBFG_10186"
FT                   /old_locus_tag="TBFG_00184"
FT   CDS_pept        216031..216540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10186"
FT                   /old_locus_tag="TBFG_00184"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0185"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04529"
FT                   /protein_id="ABR04529.1"
FT                   /translation="MIGADVPRDSQRARVYAAEAFVRTLFDRVTAHGSPTVEFFGTQLT
FT                   LPPEGRFGSVASVQRYVDDVLALPAVGQNWPTVSPVRVRARRAATAAHYENHGGTGTIA
FT                   VPDRHTAGWAMRELVVLHEVAHHLCQVPPPHGPEFVATVCTLTELVMGPEVGHVFRVVY
FT                   AQEGVR"
FT   gene            216585..218660
FT                   /locus_tag="TBFG_10187"
FT                   /old_locus_tag="TBFG_00185"
FT   CDS_pept        216585..218660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10187"
FT                   /old_locus_tag="TBFG_00185"
FT                   /product="beta-glucosidase bglS"
FT                   /note="Mapped to H37Rv Rv0186"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04530"
FT                   /protein_id="ABR04530.1"
FT                   /translation="MTDDERFSLLVGLTGASDLWPVRDERIPQGVPMCAGYVPGIPRLG
FT                   VPALLMSDAGLGVTNPGYRPGDTATALPAGLALAASFNPVLARSSGKAIGREARSRGFN
FT                   VQLAGAINLARDPRNGRNFEYLSEDPLLSATMAAESIIGIQQQGVIATTKHFSLNCNET
FT                   NRHWLDAVIDPDAHRESDLLAFEIVIERSQPGAVMAAYNKVNGDYAAGNDHLLNDVLKG
FT                   AWGYRGWVMSDWGGTPSWECALAGLDQECGAQIDAVLWQSEAFTDRLRAAYADGNLPKG
FT                   RLSDMVRRILRSMFAVGIDRWKPAPAPDMNAHNEIAAQMARQGIVLLQNRGLLPLAPES
FT                   AGRIAVIGGYAHLGVPAGYGSSAVTPPGGYAGVIPIGGSGLAAGLRNLYLLPSSPLSEL
FT                   RKRLPNAQFEFDPGINPAEAVLAARRADIAIVFAIRAEGEGFDSADLSLPWGQDALIAA
FT                   VASANANTVVVLETGNPVTMPWRDSVNAIMQAWYPGQAGGQAVAEIVTGQVNPSGRLPI
FT                   TFPVDLGQTPRSQPPELGAPWGTSTTIHYTEGADVGYRWFASTNQTPMFAFGHGLSYTS
FT                   FEYRDLVVTGGHTVHASFSVTNTGDRSGADVPQLYMIAAPGESRLRLLGFERVELEPGQ
FT                   TRRVRIEADPRLLARYDGEARSWRIEPGGYTVAVGASAVALKLAAKVKLAGRGFGR"
FT   gene            219027..219683
FT                   /locus_tag="TBFG_10188"
FT                   /old_locus_tag="TBFG_00186"
FT   CDS_pept        219027..219683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10188"
FT                   /old_locus_tag="TBFG_00186"
FT                   /product="hypothetical O-methyltransferase"
FT                   /note="Mapped to H37Rv Rv0187"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04531"
FT                   /protein_id="ABR04531.1"
FT                   /translation="MDQQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQ
FT                   QGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQ
FT                   RAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVD
FT                   NVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR"
FT   gene            219802..220233
FT                   /locus_tag="TBFG_10189"
FT                   /old_locus_tag="TBFG_00187"
FT   CDS_pept        219802..220233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10189"
FT                   /old_locus_tag="TBFG_00187"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0188"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04532"
FT                   /protein_id="ABR04532.1"
FT                   /translation="MSTVHSSIDQHPDLLALRASFDRAAESTIAHFTFGLALLAGLYVA
FT                   ASPWIVGFSATRGLPTCDLIVGIAVAYLAYGFASALDRTHGMTWTLPVLGVWVIFSPWV
FT                   LPGVAVTAGMMWSHIIAGAVVAVLGFYFGMRTRAAANQG"
FT   gene            complement(220312..222039)
FT                   /locus_tag="TBFG_10190"
FT                   /old_locus_tag="TBFG_00188"
FT   CDS_pept        complement(220312..222039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10190"
FT                   /old_locus_tag="TBFG_00188"
FT                   /product="dihydroxy-acid dehydratase ilvD"
FT                   /note="Mapped to H37Rv Rv0189c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04533"
FT                   /protein_id="ABR04533.1"
FT                   /translation="MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDE
FT                   DFAKPQIGVASSWNEITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEG
FT                   MHFSLVSREVIADSVEVVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSI
FT                   LPGRAKLSDGSERDVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANT
FT                   MASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAI
FT                   AVVMAFGGSTNAVLHLLAIAHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHI
FT                   GGVPVVMKALLDAGLLHGDCLTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGIT
FT                   ILHGSLAPEGAVVKTAGFDSDVFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPK
FT                   GGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRN
FT                   GDRIRLDVAGRVLDVLADPAEFASRQQDFSPPPPRYTTGVLSKYVKLVSSAAVGAVCG"
FT   gene            222187..222477
FT                   /locus_tag="TBFG_10191"
FT                   /old_locus_tag="TBFG_00189"
FT   CDS_pept        222187..222477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10191"
FT                   /old_locus_tag="TBFG_00189"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0190"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04534"
FT                   /protein_id="ABR04534.1"
FT                   /translation="MTAAHGYTQQKDNYAKRLRRVEGQVRGIARMIEEDKYCIDVLTQI
FT                   SAVTSALRSVALNLLDEHLSHCVTRAVAEGGPGADGKLAEASAAIARLVRS"
FT   gene            222605..223846
FT                   /locus_tag="TBFG_10192"
FT                   /old_locus_tag="TBFG_00190"
FT   CDS_pept        222605..223846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10192"
FT                   /old_locus_tag="TBFG_00190"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0191"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04535"
FT                   /protein_id="ABR04535.1"
FT                   /translation="MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALS
FT                   AIARNLRVSVVLVGTLLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSA
FT                   LAPNFAVLAAGRVLCAVTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSP
FT                   LTAAMSLMWGWRLAAVCVTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLV
FT                   KVSVLTMIAVTGHFVSYTYIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDR
FT                   WPKGAVIVGMTGLTAAFTLLTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAA
FT                   MRSGGDDPDGASGLYVTAFQIGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVS
FT                   QHLFENPTLSPGDG"
FT   gene            223923..224225
FT                   /locus_tag="TBFG_10193"
FT                   /old_locus_tag="TBFG_00191"
FT   CDS_pept        223923..224225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10193"
FT                   /old_locus_tag="TBFG_00191"
FT                   /product="conserved secreted protein"
FT                   /note="Mapped to H37Rv Rv0192A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04536"
FT                   /protein_id="ABR04536.1"
FT                   /translation="MSRWKQGWTRGSLFAALNIAAVVAVLMLGAGVAVADPDAAPGDPG
FT                   GPGAPGAQRDPSTRRQLTCWRRHPTRWRCRRHLTRWRRRHLTRSRRPRLTRWQCR"
FT   gene            224315..224980
FT                   /locus_tag="TBFG_10194"
FT                   /old_locus_tag="TBFG_00191"
FT   CDS_pept        224315..224980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10194"
FT                   /old_locus_tag="TBFG_00191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0192"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04537"
FT                   /protein_id="ABR04537.1"
FT                   /translation="MVGVAKPIVINFAVPIADRAMAESAIHISSIPPVPGKFYWMSPTQ
FT                   VRWRPFEFWPANTAVNIDAAGTKSSFRTGDSLVATADDATHQMTITRNGVVQKTFPMSM
FT                   GMVSGGHQTPNGTYYVLEKFATVVMDSSTYGVPVNSAQGYKLTVSDAVRIDNSGNFVHS
FT                   APWSVADQGKRNVTHGCINLSPANAKWFYDNFGSGDPVVVKNSVGTYNKNDGAQDWQI"
FT   gene            complement(225040..226887)
FT                   /locus_tag="TBFG_10195"
FT                   /old_locus_tag="TBFG_00192"
FT   CDS_pept        complement(225040..226887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10195"
FT                   /old_locus_tag="TBFG_00192"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0193c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04538"
FT                   /protein_id="ABR04538.1"
FT                   /translation="MIQISRDMSSLGQTATTQALPDNSDGIQLTKFAADDILPLEYAPP
FT                   IGPELVSQDQLPAAWAYKRFRDLDDKESYRRKLLQELTDALAAQGSEAAEIATAALRDL
FT                   IDQMAEQGAVVLADIVESDDFLELVKRYDELMAREGSRSFIHRFLDLRRSPGMLTDPAV
FT                   NGALVHPLMIALISYAVGGPIRMIDARGKDAEPLSVLAQDNMLHIDNTPFNDEYKILIT
FT                   WRRGTAQGPAGQNFTFLPGTHKLARTCFVNEDGVPWSSENASIFTTPDSIRKVFDAQRQ
FT                   LGGQDHPTVIEVTDSERPLSGVFAAGSLVHHRFRTASGSARSCIILVFHRVADNPGRMV
FT                   SDVEDSSDVSLSELLTRGVPDESYQQRFIATLCAAADEIAELLLKWKKTPQRPVSLPLQ
FT                   TKQIDGARFEEWISAATEAPEVREIRNRELTIPYGEVLSAEEFFDLIWRLMRFDKHGPL
FT                   DLILYHDNREEPRKWARNLIREMSADRLYERLLGWLADIQQPRPADCLRPLQIHALISE
FT                   VLKTLPLDEDQDPPADWHFDLLGMSHAEAARSVKHLLEDVAEALLRCEDMAAYLSTSLF
FT                   AFWAVDAAYSLDGRRNLVVKDCARRLLRHYTMLSLTCFQ"
FT   gene            227194..230778
FT                   /locus_tag="TBFG_10196"
FT                   /old_locus_tag="TBFG_00193"
FT   CDS_pept        227194..230778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10196"
FT                   /old_locus_tag="TBFG_00193"
FT                   /product="hypothetical drugs-transport transmembrane
FT                   ATP-binding protein ABC transporter"
FT                   /note="Mapped to H37Rv Rv0194"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04539"
FT                   /protein_id="ABR04539.1"
FT                   /translation="MRTNCWWRLSGYVMRHRRDLLLGFGAALAGTVIAVLVPLVTKRVI
FT                   DDAIAADHRPLAPWAVVLVAAAGATYLLTYVRRYYGGRIAHLVQHDLRMDAFQALLRWD
FT                   GRQQDRWSSGQLIVRTTNDLQLVQALLFDVPNVLRHVLTLLLGVAVMTWLSVPLALLAV
FT                   LLVPVIGLIAHRSRRLLAAATHCAQEHKAAVTGVVDAAVCGIRVVKAFGQEERETVKLV
FT                   TASRALYAAQLRVARLNAHFGPLLQTLPALGQMAVFALGGWMAAQGSITVGTFVAFWAC
FT                   LTLLARPACDLAGMLTIAQQARAGAVRVLELIDSRPTLVDGTKPLSPEARLSLEFQRVS
FT                   FGYVADRPVLREISLSVRAGETLAVVGAPGSGKSTLASLATRCYDVTQGAVRIGGQDVR
FT                   ELTLDSLRSAIGLVPEDAVLFSGTIGANIAYGRPDATPEQIATAARAAHIEEFVNTLPD
FT                   GYQTAVGARGLTLSGGQRQRIALARALLHQPRLLIMDDPTSAVDAVIECGIQEVLREAI
FT                   ADRTAVIFTRRRSMLTLADRVAVLDSGRLLDVGTPDEVWERCPRYRELLSPAPDLADDL
FT                   VVAERSPVCRPVAGLGTKAAQHTNVHNPGPHDHPPGPDPLRRLLREFRGPLALSLLLVA
FT                   VQTCAGLLPPLLIRHGIDVGIRRHVLSALWWAALAGTATVVIRWVVQWGSAMVAGYTGE
FT                   QVLFRLRSVVFAHAQRLGLDAFEDDGDAQIVTAVTADVEAIVAFLRTGLVVAVISVVTL
FT                   VGILVALLAIRARLVLLIFTTMPVLALATWQFRRASNWTYRRARHRLGTVTATLREYAA
FT                   GLRIAQAFRAEYRGLQSYFAHSDDYRRLGVRGQRLLALYYPFVALLCSLATTLVLLDGA
FT                   REVRAGVISVGALVTYLLYIELLYTPIGELAQMFDDYQRAAVAAGRIRSLLSTRTPSSP
FT                   AARPVGTLRGEVVFDAVHYSYRTREVPALAGINLRIPAGQTVVFVGSTGSGKSTLIKLV
FT                   ARFYDPTHGTVRVDGCDLREFDVDGYRNRLGIVTQEQYVFAGTVRDAIAYGRPDATDAQ
FT                   VERAAREVGAHPMITALDNGYLHQVTAGGRNLSAGQLQLLALARARLVDPDILLLDEAT
FT                   VALDPATEAVVQRATLTLAARRTTLIVAHGLAIAEHADRIVVLEHGTVVEDGAHTELLA
FT                   AGGHYSRLWAAHTRLCSPEITQLQCIDA"
FT   gene            231152..231850
FT                   /locus_tag="TBFG_10197"
FT                   /old_locus_tag="TBFG_00194"
FT   CDS_pept        231152..231850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10197"
FT                   /old_locus_tag="TBFG_00194"
FT                   /product="two component transcriptional regulatory protein,
FT                   luxR-family"
FT                   /note="Mapped to H37Rv Rv0195"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04540"
FT                   /protein_id="ABR04540.1"
FT                   /translation="MVKRSGAKFREEFILRPDRVQMAPVNVISVAVVASDPLTRDGALA
FT                   RLSSHRELDVRAWQAGCETSVLLVLATTITAPLLCQIEDVQKDGPSHAPKLVVVADEFS
FT                   AEQVFRMIKLGLTGLLYRSQSTFDCIVETIRLSAEGRLRLPERVQRYLVGRIKSTPTAE
FT                   PDTPCAAALAEREVAVLRLLADGLSTHQVAVQLNYCERTIKNIVHDIVTRLKLRNRTHA
FT                   VAHALRAGLI"
FT   gene            231963..232547
FT                   /locus_tag="TBFG_10198"
FT                   /old_locus_tag="TBFG_00195"
FT   CDS_pept        231963..232547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10198"
FT                   /old_locus_tag="TBFG_00195"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0196"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04541"
FT                   /protein_id="ABR04541.1"
FT                   /translation="MQGPRERMVVSAALLIRERGAHATAISDVLQHSGAPRGSAYHYFP
FT                   GGRTQLLCEAVDYAGEHVAAMINEAEGGLELLDALIDKYRQQLLSTDFRAGCPIAAVSV
FT                   EAGDEQDRERMAPVIARAAAVFDRWSDLTAQRFIADGIPPDRAHELAVLATSTLEGAIL
FT                   LARVRRDLTPLDLVHRQLRNLLLAELPERSR"
FT   gene            232544..234793
FT                   /locus_tag="TBFG_10199"
FT                   /old_locus_tag="TBFG_00196"
FT   CDS_pept        232544..234793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10199"
FT                   /old_locus_tag="TBFG_00196"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0197"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10199"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04542"
FT                   /protein_id="ABR04542.1"
FT                   /translation="MMTSSDWLPTACILCECNCGIVVQVDDRRLARIRGDKAHPGSAGY
FT                   TCNKALRLDHYQNNRARLSSPMRRRADGTYEEIDWDTAIVEIAEGFKQIRDTHGGDKIF
FT                   YYGGGGQGNHLGGAYSGAFLKALGSRYRSNALAQEKTGEAWVDFQLYGGHTRGEFENAE
FT                   VSVFVGKNPWMSQSFPRARVVLNEIAKDPGRSMIVIDPVVTDTAKMADFHLRVQPGCDA
FT                   WCLAALAAVLVQENLCNEAFLAAHVHGVDTVRAALQEVPVADYAQRCGVDEELLRAAAR
FT                   RIGTAASVSVFEDLGIQQAPNSTVCSYLNKLLWILTGNFAKKGGQHLHSSFAPLFSQVS
FT                   GRTPVTGAPIIAGLIPGNVVPEEILTEHPDRFRAMIVERGNPAHSLADSAACRAAFQAL
FT                   ELMVVVDVAMTETARLAHYVLPAASQFEKPEATFFNFEFPRNGFQLRRPLFPPLPGTLP
FT                   EPEIWARLVRALGVVDEADLRPLREAAAQGRQAYTEAFLAAAATNPTVAKLTAYVLYET
FT                   LGPTLPDGLAGAAALWGLAQKTAMAYPDAVRRAGHADGNALFDAILERPSGVTFTVHNY
FT                   EDDFALISHPDHKIALEIPEMLAEIRSLTQTPSRLTTPQLPIVLSVGERRAYTANDIFR
FT                   DPSWRKRDANGALRVSVEDAQALGLADGCLARITTAAGSAEATVEVTETMLAGHAALPN
FT                   GFGLDYTGDDGRTVVAGVAPNALTSTRWRDPYAGTPWHKHVPAAIRRADAESPIW"
FT   gene            complement(234834..236825)
FT                   /locus_tag="TBFG_10200"
FT                   /old_locus_tag="TBFG_00197"
FT   CDS_pept        complement(234834..236825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10200"
FT                   /old_locus_tag="TBFG_00197"
FT                   /product="hypothetical zinc metalloprotease"
FT                   /note="Mapped to H37Rv Rv0198c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04543"
FT                   /protein_id="ABR04543.1"
FT                   /translation="MTLAIPSGIDLSHIDADARPQDDLFGHVNGRWLAEHEIPADRATD
FT                   GAFRSLFDRAETQVRDLIIQASQAGAAVGTDAQRIGDLYASFLDEEAVERAGVQPLHDE
FT                   LATIDSAADATELAAALGTLQRAGVGGGIGVYVDTDSKDSTRYLVHFTQSGIGLPDESY
FT                   YRDEQHAAVLAAYPGHIARMFGLVYGGESRDHAKTADRIVALETKLADAHWDVVKRRDA
FT                   DLGYNLRTFAQLQTEGAGFDWVSWVTALGSAPDAMTELVVRQPDYLVTFASLWASVNVE
FT                   DWKCWARWRLIRARAPWLTRALVAEDFEFYGRTLTGAQQLRDRWKRGVSLVENLMGDAV
FT                   GKLYVQRHFPPDAKSRIDTLVDNLQEAYRISISELDWMTPQTRQRALAKLNKFTAKVGY
FT                   PIKWRDYSKLAIDRDDLYGNVQRGYAVNHDRELAKLFGPVDRDEWFMTPQTVNAYYNPG
FT                   MNEIVFPAAILQPPFFDPQADEAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWT
FT                   DDDRTEFAARTKALIEQYHAYTPRDLVDHPGPPHVQGAFTIGENIGDLGGLSIALLAYQ
FT                   LSLNGNPAPVIDGLTGMQRVFFGWAQIWRTKSRAAEAIRRLAVDPHSPPEFRCNGVVRN
FT                   VDAFYQAFDVTEDDALFLDPQRRVRIWN"
FT   gene            236868..237527
FT                   /locus_tag="TBFG_10201"
FT                   /old_locus_tag="TBFG_00198"
FT   CDS_pept        236868..237527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10201"
FT                   /old_locus_tag="TBFG_00198"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0199"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04544"
FT                   /protein_id="ABR04544.1"
FT                   /translation="MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIA
FT                   STLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNIDASLQ
FT                   RLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVV
FT                   TTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLRLDVSDVDGKLMISRLESIR"
FT   gene            237524..238213
FT                   /locus_tag="TBFG_10202"
FT                   /old_locus_tag="TBFG_00199"
FT   CDS_pept        237524..238213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10202"
FT                   /old_locus_tag="TBFG_00199"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0200"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04545"
FT                   /protein_id="ABR04545.1"
FT                   /translation="MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLL
FT                   VVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFN
FT                   RDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRG
FT                   VTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLD
FT                   VTPINAR"
FT   gene            complement(238210..238707)
FT                   /locus_tag="TBFG_10203"
FT                   /old_locus_tag="TBFG_00200"
FT   CDS_pept        complement(238210..238707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10203"
FT                   /old_locus_tag="TBFG_00200"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0201c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04546"
FT                   /protein_id="ABR04546.1"
FT                   /translation="MAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESGDIAT
FT                   WQRIAAALKRDPYGRTARQVEEVLEGIPATGIANAFWEVLDRARTHLDANERAEVARQV
FT                   GLLLDRSGLQRQEFASRIGVTAQDLTAYLDGIVSPSASLMIRMRRLSDRFVRAKSVRAA
FT                   DS"
FT   gene            complement(238710..241610)
FT                   /locus_tag="TBFG_10204"
FT                   /old_locus_tag="TBFG_00201"
FT   CDS_pept        complement(238710..241610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10204"
FT                   /old_locus_tag="TBFG_00201"
FT                   /product="transmembrane transport protein mmpL11"
FT                   /note="Mapped to H37Rv Rv0202c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04547"
FT                   /protein_id="ABR04547.1"
FT                   /translation="MMRLSRNLRRCRWLVFTGWLLALVPAVYLAMTQSGNLTGGGFEVA
FT                   GSQSLLVHDQLDAHYPDRGAPALALVAAPRPDASYQDIDNAVALLRQIASELPGVTEAP
FT                   NPTQRPPQPDRPYVVSLRLDARNAGTSDVAKKLRDRIGVKGDQSGQTANGKVRLYVIGQ
FT                   GALSAAAAANTKHDIANAERWNLPIILMVLVAVFGSLAAAAIPLALAVCTVVITMGLVF
FT                   VLSMHTTMSVFVTSTVSMFGIALAVDYSLFILMRYREELRCGRRPPDAVDAAMATSGLA
FT                   VVLSGMTVIASLTGIYLINTPALRSMATGAILAVAVAMLTSATLTPAVLATFARAAAKR
FT                   SALVHWSRRPASTQSWFWSRWVGWVMRRPWITALAASTVLLVMAAPATLMVLGNSLLRQ
FT                   FDSSHEIRTGAAAAAQALGPGALGPVQVLVRFDAGGASAPEHSQTIAAIRHRIAQAPNV
FT                   VSVAPPRFADDNGSALLSAVLSVDPEDLGARDTITWMRTQLPRVAGAAQVDVGGPTALI
FT                   KDFDDRVSATQPLVLVFVAVIAFLMLLISIRSVFLAFKGVLMTLLSVAAAYGSLVMVFQ
FT                   WGWARGLGFPALHSIDSTVPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGQTRDAVAYG
FT                   VRTSARTITSAALIMIAVFCGFAFAGMPLVAEIGVACAVAIAVDATVVRLVLVPALMAM
FT                   FDRWNWWLPRWLAHILPSVDFDRPLPKVDLGDVVVIPDDFAAAIPPSADVRMVLKSAAK
FT                   LKRLAPDAICVTDPLAFTGCGCDGKALDQVQLAYRNGIARAISWGQRPVHPVTVWRKRL
FT                   AVALDALQTTTWECGGVQTHRAGPGYRRRSPVETTNVALPTGDRLQIPTGAETLRFKGY
FT                   LIMSRNSSHDYADFADLVDTMAPETAAAVLAGMDRYYSCQAPGRQWMATQLVGRLADPQ
FT                   PSDLGDQSPGADAQAKWEEVRRRCLSVAVAMLEEAR"
FT   gene            241832..242242
FT                   /locus_tag="TBFG_10205"
FT                   /old_locus_tag="TBFG_00202"
FT   CDS_pept        241832..242242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10205"
FT                   /old_locus_tag="TBFG_00202"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0203"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04548"
FT                   /protein_id="ABR04548.1"
FT                   /translation="MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASE
FT                   VARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVASDLHAL
FT                   SQPLTDLSTRCSLPISGLQAIGLMQAVQGARR"
FT   gene            complement(242294..243577)
FT                   /locus_tag="TBFG_10206"
FT                   /old_locus_tag="TBFG_00203"
FT   CDS_pept        complement(242294..243577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10206"
FT                   /old_locus_tag="TBFG_00203"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0204c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04549"
FT                   /protein_id="ABR04549.1"
FT                   /translation="MYRDYGATCTVTLKHVSHDAPARNLRQRVGALPRTRVGAPPAEGV
FT                   PPCGKYWWLRWAVLAIVAIVLAIEVALGWDQLAKAWVSLYRAKWWWLLAAVAAAGASMH
FT                   SFAQIQRTLLKSAGVHVKQWRSEAAFYAANSLSTTLPGGPVLSATFLLRQQRIWGASTV
FT                   VASWQLVMSGVLQAVGLALLGLGGAFFLGAKNNPFSLLFTLGGFVTLLLLAQAVASRPE
FT                   LIEGIGRRVLSWANSVRGRPADAGLPKWRETLMQLESVSLGRRDLGVAFGWSLFNWIAD
FT                   VACLGFAAYAAGDHASVGGLAVAYAAARAVGTIPLMPGGLLVVEAVLVPGLVSSGMPLP
FT                   SAISAMLIYRLISWLLIAAIGWVVFFFMFRTESTADSDNDRDPPTDPNLRLVIQPQGTP
FT                   CDDPVETTPQGPAPTPDLRPEGGETPPR"
FT   gene            243702..244805
FT                   /locus_tag="TBFG_10207"
FT                   /old_locus_tag="TBFG_00204"
FT   CDS_pept        243702..244805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10207"
FT                   /old_locus_tag="TBFG_00204"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0205"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04550"
FT                   /protein_id="ABR04550.1"
FT                   /translation="MSASLDDASVAPLVRKTAAWAWRFLVILAAMVALLWVLNKFEVIV
FT                   VPVLLVLMLSALLVPPVDWLDSRGLPHAVAVTLVLLSGFAVLGGILTFVVSQFIAGLPH
FT                   LVTEVERSIDSARRWLIEGPAHLRGEQIDNAGNAAIEALRNNQAKLTSGALSTAATITE
FT                   LVTAAVLVLFTLIFFLYGGRSIWQYVTKAFPASVRDRVRAAGRAGYASLIGYARATFLV
FT                   ALTDAAGVGAGLAVMGVPLALPLASLVFFGAFIPLIGAVVAGFLAVVVALLAKGIGYAL
FT                   ITVGLLIAVNQLEAHLLQPLVMGRAVSIHPLAVVLAIAAGGVLAGVVGALLAVPTVAFF
FT                   NNAVQVLLGGNPFADVADVSSDHLTEV"
FT   gene            complement(244802..247636)
FT                   /locus_tag="TBFG_10208"
FT                   /old_locus_tag="TBFG_00205"
FT   CDS_pept        complement(244802..247636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10208"
FT                   /old_locus_tag="TBFG_00205"
FT                   /product="transmembrane transport protein mmpL3"
FT                   /note="Mapped to H37Rv Rv0206c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04551"
FT                   /protein_id="ABR04551.1"
FT                   /translation="MFAWWGRTVYRYRFIVIGVMVALCLGGGVFGLSLGKHVTQSGFYD
FT                   DGSQSVQASVLGDQVYGRDRSGHIVAIFQAPAGKTVDDPAWSKKVVDELNRFQQDHPDQ
FT                   VLGWAGYLRASQATGMATADKKYTFVSIPLKGDDDDTILNNYKAIAPDLQRLDGGTVKL
FT                   AGLQPVAEALTGTIATDQRRMEVLALPLVAVVLFFVFGGVIAAGLPVMVGGLCIAGALG
FT                   IMRFLAIFGPVHYFAQPVVSLIGLGIAIDYGLFIVSRFREEIAEGYDTETAVRRTVITA
FT                   GRTVTFSAVLIVASAIGLLLFPQGFLKSLTYATIASVMLSAILSITVLPACLGILGKHV
FT                   DALGVRTLFRVPFLANWKISAAYLNWLADRLQRTKTREEVEAGFWGKLVNRVMKRPVLF
FT                   AAPIVIIMILLIIPVGKLSLGGISEKYLPPTNSVRQAQEEFDKLFPGYRTNPLTLVIQT
FT                   SNHQPVTDAQIADIRSKAMAIGGFIEPDNDPANMWQERAYAVGASKDPSVRVLQNGLIN
FT                   PADASKKLTELRAITPPKGITVLVGGTPALELDSIHGLFAKMPLMVVILLTTTIVLMFL
FT                   AFGSVVLPIKATLMSALTLGSTMGILTWIFVDGHFSKWLNFTPTPLTAPVIGLIIALVF
FT                   GLSTDYEVFLVSRMVEARERGMSTQEAIRIGTAATGRIITAAALIVAVVAGAFVFSDLV
FT                   MMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWARRLQTRIGLGEIHLPD
FT                   ERKRPVSNGRPARPPVTAGLVAARAAGDPRPPHDPTHPLAESPRPARSSRASSPELTPA
FT                   LEATAAPAAPSGASTTRMQIGSSTEPPTTRLAAAGRSVQSPASTPPPTPTPPSALSAGQ
FT                   TRAMPLAANRSTDAAGDPAEPTAALPIIRSDGDDSEAATEQLNARGTSDKTRQRRRGGG
FT                   ALSAQDLLRREGRL"
FT   gene            complement(247702..248430)
FT                   /locus_tag="TBFG_10209"
FT                   /old_locus_tag="TBFG_00206"
FT   CDS_pept        complement(247702..248430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10209"
FT                   /old_locus_tag="TBFG_00206"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0207c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04552"
FT                   /protein_id="ABR04552.1"
FT                   /translation="MSLTEDVTSQTSESLARHSVLAEDLSQDGLTSLGAPGARVLLVWD
FT                   APNLDMGLGSILGRRPTALERPRFDALGRWLLARTAEIVAGRPGISTEPEATVFTNIAP
FT                   GSAEVVRPWVDALRNVGFAVFAKPKVDEDSDVDRDMLAHIDERYREGLAALVVASADGQ
FT                   AFRQPLEAVARSGTPVQVLGFREHASWALASDTLEFVDLEDIAGVFREPLPRIGLDSLP
FT                   EQGAWLQPFRPLSSLLTSRV"
FT   gene            complement(248433..249224)
FT                   /locus_tag="TBFG_10210"
FT                   /old_locus_tag="TBFG_00207"
FT   CDS_pept        complement(248433..249224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10210"
FT                   /old_locus_tag="TBFG_00207"
FT                   /product="hypothetical methlytransferase"
FT                   /note="Mapped to H37Rv Rv0208c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04553"
FT                   /protein_id="ABR04553.1"
FT                   /translation="MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRET
FT                   WERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVVLEIGSGSGTSTLAMAKAEPHVDVI
FT                   AVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDPWPK
FT                   ARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTEL
FT                   LPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR"
FT   gene            249356..250441
FT                   /locus_tag="TBFG_10211"
FT                   /old_locus_tag="TBFG_00208"
FT   CDS_pept        249356..250441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10211"
FT                   /old_locus_tag="TBFG_00208"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0209"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04554"
FT                   /protein_id="ABR04554.1"
FT                   /translation="MRGQGHQIFVDELARFATSSADQRVVAIAQRAAEPLRVAVRGRPG
FT                   VGCRTVARALQGAGSSSGMTVTPQARAADSDVDLVVYVTVEVVKPEDREAIAATRRPVV
FT                   AVLNKADLAGPLSGAGPIVMAQARCAQFSTLLGVPMESMIGLLAVAALDDLDDTLRAVL
FT                   RALAAHPDGFDALDRAVAGFLAAALPVPTEVRLRLLDTLDLFGIALGMAAFRPGRPSRT
FT                   PAQLRTLLRRVSGVDAVIDKVTAAGSEVRYRRLLDAVAELEALAAQAKEIGGPIGEFLR
FT                   DDDTVLARMAAAVDVALAVGLDVGPLDDPAAHLPRAVRWHRYSLDNGDMHRTCGADIAR
FT                   GSLRLWSLAGGMPLHRYRKSS"
FT   gene            250438..251916
FT                   /locus_tag="TBFG_10212"
FT                   /old_locus_tag="TBFG_00209"
FT   CDS_pept        250438..251916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10212"
FT                   /old_locus_tag="TBFG_00209"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0210"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10212"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04555"
FT                   /protein_id="ABR04555.1"
FT                   /translation="MIRAASDDPAGVDELVAAIAPGLAGLGLPVINRREVVLVTGPWLA
FT                   GVSGVRAALAERLPQRRFVETAELGPGDAPVAVVFVVSAATALTESDCVLLDTAAEHTD
FT                   AVVAVVSKIDVHRGWRDVLTSNRDRLAARASRYARVPWVGAAAAPELGEPYLDDLVAAI
FT                   QKQLADPAVARRNMLRAWESRLLMVARRFDGDAQSAGRRARVDALRQQRRTVLRQGRQS
FT                   KSEHTIALRAQIQHARVKLSYFARNRCSLLRVELQEHVAGLSRKDIARFAAYTRGRVQE
FT                   VVAEVGEGAVAHLADVAQLLGVPVQPPVLENLPAVLPTVVAPPLTSRRLEIRLTTLLGA
FT                   GFGLGIALTLSRLVAGLTPGLAASGMVAGVAIGLAVTAWVVNARALLHDRVVVDRWTGE
FT                   VTASLRSVVEQLVATRVVAVETLLSTAISERDDAENARVADQVSIIDGELREHAVAAAR
FT                   AAALRDREMPAVRAALEAVRAELGEPGAPTTGLF"
FT   gene            252100..253920
FT                   /locus_tag="TBFG_10213"
FT                   /old_locus_tag="TBFG_00210"
FT   CDS_pept        252100..253920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10213"
FT                   /old_locus_tag="TBFG_00210"
FT                   /product="iron-regulated phosphoenolpyruvate carboxykinase
FT                   (GTP) pckA"
FT                   /note="Mapped to H37Rv Rv0211"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04556"
FT                   /protein_id="ABR04556.1"
FT                   /translation="MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEF
FT                   QRLCDQLVEAGTFIRLNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMD
FT                   PGEMRSIMKDLYRGCMRGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   KAALEKMGDDGFFVKALHSVGAPLEPGQKDVAWPCSETKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYFAAAFPSACGKTNLAML
FT                   QPTIPGWRAETLGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGN
FT                   TVFTNVALTDDGDVWWEGLEGDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPI
FT                   LAPEWDDPQGVPISGILFGGRRKTTVPLVTEARDWQHGVFIGATLGSEQTAAAEGKVGN
FT                   VRRDPMAMLPFLGYNVGDYFQHWINLGKHADESKLPKVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWIVDRIEHKAGGATTPIGTVPAVEDLDLDGLDVDAADVAAALAVDADEWRQEL
FT                   PLIEEWLQFVGEKLPTGVKDEFDALKERLG"
FT   gene            complement(253987..254958)
FT                   /locus_tag="TBFG_10214"
FT                   /old_locus_tag="TBFG_00211"
FT   CDS_pept        complement(253987..254958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10214"
FT                   /old_locus_tag="TBFG_00211"
FT                   /product="transcriptional regulatory protein, asnC-family
FT                   nadR"
FT                   /note="Mapped to H37Rv Rv0212c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04557"
FT                   /protein_id="ABR04557.1"
FT                   /translation="MTHGMVLGKFMPPHAGHVYLCEFARRWVDELTIVVGSTAAEPIPG
FT                   AQRVAWMRELFPFDRVVHLANENPQRPWEHPDFWDIWKASLQGVLATRPDFVFGAEPYN
FT                   ADFAQVLGARFVAVDHGRTVVPVTATDIRADPLGHWQHIPRCVRPAFVKRVSIIGPEST
FT                   GKTTLAQAVAEKLRTKWVPERAKMLRELNGGSLIGLEWAEIVRGQIASEEALARDADRV
FT                   LICDTDPLATTVWAEFLAGGCPQELRDLARRPYDLTLLTTPDVPWDADDGRCVPGARGT
FT                   FFARCEQALRAAGRSFVVITGGWEERLSVSLRAVEELVRARR"
FT   gene            complement(254955..256268)
FT                   /locus_tag="TBFG_10215"
FT                   /old_locus_tag="TBFG_00212"
FT   CDS_pept        complement(254955..256268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10215"
FT                   /old_locus_tag="TBFG_00212"
FT                   /product="hypothetical methyltransferase"
FT                   /note="Mapped to H37Rv Rv0213c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10215"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04558"
FT                   /protein_id="ABR04558.1"
FT                   /translation="MSIKAYAKTQGIAVTSVNGLVAGHGSVQETWLAMQSAAALSGTPR
FT                   LVGFSCIDTFPEVLWLAQRARQAWDGVRIVIGNAMATLNYERILRQHDCFDYVVVGDGE
FT                   VAFTKLALALANDAAVDDVPGLARRSEQGQILRTPSSLVDLDELPRPARDELPTVLADG
FT                   FAASVFSTRGCPYRCTFCGTGAMSAMLGKDSYRAKSVDAVVDEIDYLVSDYDVNFLSIT
FT                   DDLFISKHPGSQQRAADFANAVLRRGISVNFMVDIRLDSVVDLDLFKHLHRAGLRRVFI
FT                   GVETGSYEQLRAYRKQILTRGQDAADTINALQQLGIDVIPGTIMFHPTVQPDELRETVR
FT                   LLRATKYTVGFKFMSRIVPYPGTPLYQAYSDAGYLTAKWPLGQWEFVDPEASRVYADVV
FT                   AKVAPDVGISFDEAEAYFLSRLDEWENVIAGRIAEATS"
FT   gene            256382..257995
FT                   /locus_tag="TBFG_10216"
FT                   /old_locus_tag="TBFG_00213"
FT   CDS_pept        256382..257995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10216"
FT                   /old_locus_tag="TBFG_00213"
FT                   /product="fatty-acid-CoA ligase fadD4"
FT                   /note="Mapped to H37Rv Rv0214"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10216"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04559"
FT                   /protein_id="ABR04559.1"
FT                   /translation="MPRGELYKRFRLVMGGIAPCGSGRRAATYPRRMQIRPYIGADKPA
FT                   VILYPSGTVISFDELEARANRLAHWFRQAGLREDDVVAILMENNEHVHAVMWAARRSGL
FT                   YYVPINTHLTASEAAYIVDNSGAKAIVGSAALRETCHGLAEHLPGGLPDLLMLAGGGLV
FT                   GWMTYPECVADQPDTPIEDEREGDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALL
FT                   DFWMDADSVYLSPAPMYHTAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQ
FT                   FVPAMFVRMLKLPEAVRNSYDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEYYASSE
FT                   ASGSTLITAEDWLTHPGSVGKPIQGGVHIVGADGSELPPNQPGEIYFEGGYPFEYLNDP
FT                   AKTAASRNKHGWVTVGDVGYLDDDGYLFLTGRRHHMIISGGVNIYPQEAENLLVAHPKV
FT                   LDAAVFGVPDDEMGQRVMAAVQTVDSADANDQFAGELLAWLRDRLSHFKCPRSIAFEPQ
FT                   LPRTDTGKLYKSGLVEKYSV"
FT   gene            complement(258101..259222)
FT                   /locus_tag="TBFG_10217"
FT                   /old_locus_tag="TBFG_00214"
FT   CDS_pept        complement(258101..259222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10217"
FT                   /old_locus_tag="TBFG_00214"
FT                   /product="acyl-CoA dehydrogenase fadE3"
FT                   /note="Mapped to H37Rv Rv0215c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10217"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04560"
FT                   /protein_id="ABR04560.1"
FT                   /translation="MLAGYRTGGQYGGRQKVRNELNDDEAMLVATVRAFIDRDVKPTVR
FT                   EVEHANSYPEAWIEQMKHIGIYGLAIDEQYGGSPVSMPCYVQVTQELARGWMSLAGAMG
FT                   GHTVVAKLLTLFGTEEQRRTYLPPMASGELRATMALTEPGGGSDLQNMSTTALADGPEG
FT                   SAGLLINGCKTWISNARRSGLFAVLCKTDPNATPRHQGMSIVLVEPGPGLTVSRDLPKL
FT                   GYKGVESCELSFDNLRVPVSAILGGAMGQGFSQMMKGLETGRIQVAARALGVATAALED
FT                   SLAYAQQRESFGRPIWQHQAVGNYLADMATKLTAARQLTRYAAERYDSGQRCDMEAGMA
FT                   KLFASEVAMEIALNAVRIHGGYGYSTEYDVERR"
FT   gene            259231..260244
FT                   /locus_tag="TBFG_10218"
FT                   /old_locus_tag="TBFG_00215"
FT   CDS_pept        259231..260244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10218"
FT                   /old_locus_tag="TBFG_00215"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0216"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04561"
FT                   /protein_id="ABR04561.1"
FT                   /translation="MASGYGGIRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVG
FT                   NRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTLATQRVKANLFYRGLRFHRFPA
FT                   VGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWK
FT                   PGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSG
FT                   APELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTA
FT                   PVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF"
FT   gene            complement(260241..261149)
FT                   /locus_tag="TBFG_10219"
FT                   /old_locus_tag="TBFG_00216"
FT   CDS_pept        complement(260241..261149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10219"
FT                   /old_locus_tag="TBFG_00216"
FT                   /product="esterase lipW"
FT                   /note="Mapped to H37Rv Rv0217c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10219"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04562"
FT                   /protein_id="ABR04562.1"
FT                   /translation="MSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTP
FT                   PDIEVLTLESGVGVRLYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSRLGIT
FT                   VASVDYRLAPENPYPAALGDCYSALTWLASLPAVDPARVAIGGASAGGGLAAALALLAR
FT                   DRGGITPAFQLLVYPMLDDRPSIAPANPHYRLWNGRANRFGWRAYLGDADARVAVPGRR
FT                   DDLGGLAPAWIGVGTHDLLHDEDLAYAERLTAAGVPCQVEVVEGAFHGFDRVAPNVGVS
FT                   QRFFTSQCNSLRAALALSNRT"
FT   gene            261242..262570
FT                   /locus_tag="TBFG_10220"
FT                   /old_locus_tag="TBFG_00217"
FT   CDS_pept        261242..262570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10220"
FT                   /old_locus_tag="TBFG_00217"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0218"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04563"
FT                   /protein_id="ABR04563.1"
FT                   /translation="MSDPARGAEAEDAYGFPAGLWRWLQRHPPPALHRLTRFRSPLRGP
FT                   WLTSVFGLVLLVALPFVIITGLLSYIAYAPQLGQAIPGDVGWLRLPAFTWPTRPSWLYR
FT                   LTQGLHVGLGLVIIPVVLAKLWSVIPRLFVWPPARSIAQVLERLSVLMLVGGILFQIVT
FT                   GVLNIQYDYIFGFSFYTGHYFGAWVFIAGFLLHIVVKIPHMVTGLRSIPMREVLGTNVA
FT                   DTRAQPCDPDGLVSVNPGEATLSRRGALGLVGAGVLLIGVLTVGQTLGGFTRKAALLLP
FT                   RGRVVSPGDFPVNKTAAAAGITAEAIGPDWRLVLRGGPAEVVLDRATLAGLPQRTARLP
FT                   LACVEGWSAVRTWSGVPLAELALLAGVPAARSARVTSLQRGGAFGEAKLAANQIADPDA
FT                   LLALRVDGADLSLDHGYPARIIVPALPGVHNTKWVAGIEFHKR"
FT   gene            262572..263120
FT                   /locus_tag="TBFG_10221"
FT                   /old_locus_tag="TBFG_00218"
FT   CDS_pept        262572..263120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10221"
FT                   /old_locus_tag="TBFG_00218"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0219"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04564"
FT                   /protein_id="ABR04564.1"
FT                   /translation="MFDIATRFKNSYGSGPLHLLAMVSGFALLGYIVATARPSALWNQA
FT                   TWWQSIAVWFVAAVVAHDLLLYPLYALADRILARLVGRRDVSAPRRRPELPVRNYIRIP
FT                   ALAAGLTLLVFLPGIIRQGAPTYLDATGQTQEPFLGRWLLLTAVAFGISAAAYAIRLVV
FT                   AHVRRRRAGCSRVDAIDEE"
FT   gene            263130..264341
FT                   /locus_tag="TBFG_10222"
FT                   /old_locus_tag="TBFG_00219"
FT   CDS_pept        263130..264341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10222"
FT                   /old_locus_tag="TBFG_00219"
FT                   /product="esterase lipC"
FT                   /note="Mapped to H37Rv Rv0220"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04565"
FT                   /protein_id="ABR04565.1"
FT                   /translation="MNQRRAAGSTGVAYIRWLLRARPADYMLALSVAGGSLPVVGKHLK
FT                   PLGGVTAIGVWGARHASDFLSATAKDLLTPGINEVRRRDRASTQEVSVAALRGIVSPDD
FT                   LAVEWPAPERTPPVCGALRHRRYVHRRRVLYGDDPAQLLDVWRRKDMPTKPAPVLIFVP
FT                   GGAWVHGSRAIQGYAVLSRLAAQGWVCLSIDYRVAPHHRWPRHILDVKTAIAWARANVD
FT                   KFGGDRNFIAVAGCSAGGHLSALAGLTANDPQYQAELPEGSDTSVDAVVGIYGRYDWED
FT                   RSTPERARFVDFLERVVVQRTIDRHPEVFRDASPIQRVTRNAPPFLVIHGSRDCVIPVE
FT                   QARSFVERLRAVSRSQVGYLELPGAGHGFDLLDGARTGPTAHAIALFLNQVHRSRAQFA
FT                   KEVI"
FT   gene            264385..265794
FT                   /locus_tag="TBFG_10223"
FT                   /old_locus_tag="TBFG_00220"
FT   CDS_pept        264385..265794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10223"
FT                   /old_locus_tag="TBFG_00220"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0221"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10223"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04566"
FT                   /protein_id="ABR04566.1"
FT                   /translation="MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFRE
FT                   VIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVG
FT                   EIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEV
FT                   GRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFT
FT                   PPPTFMNHRLTPERRFATATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGK
FT                   AEPLLASVPVSYDFSPERISGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLL
FT                   GPELISRWAAYWPPAGAEALFRSLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIY
FT                   SVGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVE
FT                   LTVVESAMAQA"
FT   gene            265825..266613
FT                   /locus_tag="TBFG_10224"
FT                   /old_locus_tag="TBFG_00221"
FT   CDS_pept        265825..266613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10224"
FT                   /old_locus_tag="TBFG_00221"
FT                   /product="enoyl-CoA hydratase echA1"
FT                   /note="Mapped to H37Rv Rv0222"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04567"
FT                   /protein_id="ABR04567.1"
FT                   /translation="MSSESDAANTEPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLA
FT                   DAMDQLDGDAGLSVAILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTKPLIA
FT                   AVEGYALAGGTELALAADLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMEL
FT                   ALTGDNLPAERAHELGLVNVLAEPGTALDAAIALAEKITANGPLAVVATKRIITESRGW
FT                   SPDTMFAEQMKILVPVFTSNDAKEGAIAFAERRRPRWTGT"
FT   gene            complement(266619..268082)
FT                   /locus_tag="TBFG_10225"
FT                   /old_locus_tag="TBFG_00222"
FT   CDS_pept        complement(266619..268082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10225"
FT                   /old_locus_tag="TBFG_00222"
FT                   /product="hypothetical aldehyde dehydrogenase"
FT                   /note="Mapped to H37Rv Rv0223c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04568"
FT                   /protein_id="ABR04568.1"
FT                   /translation="MSDSATEYDKLFIGGKWTKPSTSDVIEVRCPATGEYVGKVPMAAA
FT                   ADVDAAVAAARAAFDNGPWPSTPPHERAAVIAAAVKMLAERKDLFTKLLAAETGQPPTI
FT                   IETMHWMGSMGAMNYFAGAADKVTWTETRTGSYGQSIVSREPVGVVGAIVAWNVPLFLA
FT                   VNKIAPALLAGCTIVLKPAAETPLTANALAEVFAEVGLPEGVLSVVPGGIETGQALTSN
FT                   PDIDMFTFTGSSAVGREVGRRAAEMLKPCTLELGGKSAAIILEDVDLAAAIPMMVFSGV
FT                   MNAGQGCVNQTRILAPRSRYDEIVAAVTNFVTALPVGPPSDPAAQIGPLISEKQRTRVE
FT                   GYIAKGIEEGARLVCGGGRPEGLDNGFFIQPTVFADVDNKMTIAQEEIFGPVLAIIPYD
FT                   TEEDAIAIANDSVYGLAGSVWTTDVPKGIKISQQIRTGTYGINWYAFDPGSPFGGYKNS
FT                   GIGRENGPEGVEHFTQQKSVLLPMGYTVA"
FT   gene            complement(268181..268945)
FT                   /locus_tag="TBFG_10226"
FT                   /old_locus_tag="TBFG_00223"
FT   CDS_pept        complement(268181..268945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10226"
FT                   /old_locus_tag="TBFG_00223"
FT                   /product="hypothetical methyltransferase"
FT                   /note="Mapped to H37Rv Rv0224c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04569"
FT                   /protein_id="ABR04569.1"
FT                   /translation="MAVTDVFARRATLRRSLRLLADFRYEQRDPARFYRTLAADTAAMI
FT                   GDLWLATHSEPPVGRTLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRP
FT                   GMFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLG
FT                   PFGGHEMGLSHYLGGARAAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAV
FT                   FPRYHPRWAWWLTSVPVLREFLVSNLVLVLTP"
FT   gene            268981..270135
FT                   /locus_tag="TBFG_10227"
FT                   /old_locus_tag="TBFG_00224"
FT   CDS_pept        268981..270135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10227"
FT                   /old_locus_tag="TBFG_00224"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0225"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04570"
FT                   /protein_id="ABR04570.1"
FT                   /translation="MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRT
FT                   ARYPGAPRHELVDGVRISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGW
FT                   PFVARLLYGRRSLVLVHHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPS
FT                   ARDLIALGVDSERIAVVRNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVA
FT                   ELQPRIPGLHLDIVGGGWWRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLL
FT                   PSRKEGWGLAVIEAAQHGVPTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSD
FT                   SVLRDQLGAKAQARSGEFSWRQSAEALRSVLEAVQASRFVSGVV"
FT   gene            complement(270152..271882)
FT                   /locus_tag="TBFG_10228"
FT                   /old_locus_tag="TBFG_00225"
FT   CDS_pept        complement(270152..271882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10228"
FT                   /old_locus_tag="TBFG_00225"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0226c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04571"
FT                   /protein_id="ABR04571.1"
FT                   /translation="MRWFRPGYALVLVLLLAAPLLRPGYLLLRDAVSTPRSYVSANALG
FT                   LTSAPRATPQDFAVALASHLVDGGVVVKALLLLGLWLAGWGAARLVATALPAAGAAGQF
FT                   VAITLAIWNPYVAERLLQGHWSLLVGYGCLPWVATAMLTMRTTVGAGWFGLFGLAFWVA
FT                   LAGLTPSGLLLAATVAVVCVAMPGAGRPRWQCGVAALGSALVGALPWLTASALGSSLTS
FT                   HTAANQLGVTAFAPRAEPGLGTLGSLASLGGIWNGEAVPSSRTTLFAVASAVVLLAMVA
FT                   IGLPTVARRPVAVPLLTLAAVSVMVPAVLATGPGLHALRVVVDAAPGLGVLRDGQKWVA
FT                   LAVPGYTLSGAGTVLTLRRWLRPATAAVVCCLALVLTLPDLAWGVWGKVAPVHYPSGWA
FT                   AVAAAINADPRTVAVLPAGTMRRFSWSGSAPVLDPLPRWVRADVLTTGDLVISGVTVPG
FT                   EDAHARAVQELLLTGPHPSTLAAAGVGWLVVESDSAGDMGAAARTLGRLAAAHRDDELA
FT                   LYRVGGQTSGASSARLKATMLAHWAWLSMLLVGGAGAAGYWVRRHLHHCEDTPASRAQD
FT                   "
FT   gene            complement(271892..273157)
FT                   /locus_tag="TBFG_10229"
FT                   /old_locus_tag="TBFG_00226"
FT   CDS_pept        complement(271892..273157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10229"
FT                   /old_locus_tag="TBFG_00226"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0227c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04572"
FT                   /protein_id="ABR04572.1"
FT                   /translation="MLRFAACGAIGLGAALLIAALLLSTYTTSRIAEIPLDIDATLISD
FT                   GTGTALDSASLATEHIVVNQDVPLVSQQQVTVESPANADVVTLQVGSSLRRTDKQKDSG
FT                   LLLAIVDTVTLNRKTAMAVSDDTHTGGAVQKPRGLNDENPPTAIPLRHDGLSYRFPFHT
FT                   EKKTYPYFDPIAQKAFDANYEGEEDVNGLTTYRFTQNVGYTPEGKLVAPLKYPSLYAGD
FT                   EDGKVTTSAAMWGLPGDPNEQITMTRYYAAQRTFWVDPVSGTIVKETERANHYFARDPL
FT                   KPEVTFADYQVTSTEETVESQVNAARDERDRLALWSRVLPITFTAAGLVALVGGGLFAS
FT                   FSLRTEGALMAASGDRDDHDYRRGGFEEPVPGAEAETEKLPTQRPDFPREPSGSDPPRL
FT                   GSAQPPPPPDAGHPDPGPPERR"
FT   gene            273373..274596
FT                   /locus_tag="TBFG_10230"
FT                   /old_locus_tag="TBFG_00227"
FT   CDS_pept        273373..274596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10230"
FT                   /old_locus_tag="TBFG_00227"
FT                   /product="hypothetical integral membrane acyltransferase"
FT                   /note="Mapped to H37Rv Rv0228"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04573"
FT                   /protein_id="ABR04573.1"
FT                   /translation="MGPADESGAPIRPQTPHRHTVLVTNGQVVGGTRGFLPAVEGMRAC
FT                   AAVGVVVTHVAFQTGHSSGVGGRLFGRFDLAVAVFFAVSGFLLWRGHAAAARDLRSHPR
FT                   TGPYLRSRVARIMPAYVVAVVVILSLLPDADHASLTVWLANLTLTQIYVPLTLTGGLTQ
FT                   MWSLSVEVAFYAALPVLALLGRRIPVGARVPAIAALAALSWAWGWLPLDAGSGINPLTW
FT                   PPAFFSWFAAGMLLAEWAYSPVGLPHRWARRRVAMAVTALLGYLVAASPLAGPEGLVPG
FT                   TAAQFAVKTAMGSLVAFALVAPLVLDRPDTSHRLLGSPAMVTLGRWSYGLFIWHLAALA
FT                   MVFPVIGAFPFTGRMPTVLVLTLIFGFAIAAVSYALVESPCREALRRWERRNEPISVGE
FT                   LQADAIAP"
FT   gene            complement(274624..275304)
FT                   /locus_tag="TBFG_10231"
FT                   /old_locus_tag="TBFG_00228"
FT   CDS_pept        complement(274624..275304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10231"
FT                   /old_locus_tag="TBFG_00228"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0229c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04574"
FT                   /protein_id="ABR04574.1"
FT                   /translation="MRQPRRANAMGLALCIYIGSLLIYTPIHGETSRRHRRAGFKHGSY
FT                   RIGHDDDQRHRQRGPAASHVSASSTRRRRSRHAGRRTARGPRRSMALKYLLDTSVIKRL
FT                   SRPAVRRAVEPLAEAGAVARTQITDLEVGYSARNETEWQRLMVALSAFDLIESTASHHR
FT                   RALGIQRLLAARSQRGRKIPDLLIAAAGEEHGLVVLHYDADFDLIAAVTGQPCQWIVPA
FT                   GTID"
FT   gene            complement(275301..276281)
FT                   /locus_tag="TBFG_10232"
FT                   /old_locus_tag="TBFG_00229"
FT   CDS_pept        complement(275301..276281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10232"
FT                   /old_locus_tag="TBFG_00229"
FT                   /product="phosphotriesterase php (parathion hydrolase)"
FT                   /note="Mapped to H37Rv Rv0230c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04575"
FT                   /protein_id="ABR04575.1"
FT                   /translation="MPELNTARGPIDTADLGVTLMHEHVFIMTTEIAQNYPEAWGDEDK
FT                   RVAGAIARLGELKARGVDTIVDLTVIGLGRYIPRIARVAAATELNIVVATGLYTYNDVP
FT                   FYFHYLGPGAQLDGPEIMTDMFVRDIEHGIADTGIKAGILKCATDEPGLTPGVERVLRA
FT                   VAQAHKRTGAPISTHTHAGLRRGLDQQRIFAEEGVDLSRVVIGHCGDSTDVGYLEELIA
FT                   AGSYLGMDRFGVDVISPFQDRVNIVARMCERGHADKMVLSHDACCYFDALPEELVPVAM
FT                   PNWHYLHIHNDVIPALKQHGVTDEQLHTMLVDNPRRIFERQGGYQ"
FT   gene            276376..278082
FT                   /locus_tag="TBFG_10233"
FT                   /old_locus_tag="TBFG_00230"
FT   CDS_pept        276376..278082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10233"
FT                   /old_locus_tag="TBFG_00230"
FT                   /product="acyl-CoA dehydrogenase fadE4"
FT                   /note="Mapped to H37Rv Rv0231"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10233"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04576"
FT                   /protein_id="ABR04576.1"
FT                   /translation="MLLNPNHLTRKYPDRRSGEIMAATVDFFESRGKARLKHDDHERIW
FT                   YSDFLDFVGRERIFASLLTPASYGADDCRWDTYRISEFAEIMGFYGLSYWYPFQVTALG
FT                   LGPIWMSANEDAKRKAAAGLEAGEVFAFGLSEQTHGADVYQTDMILTPSDGGWTANGEK
FT                   YYIGNANVARMVSTFGKIAGTPESQEYVFFVADSQHERYDLIKNVVNSQNYVANYALRD
FT                   YPVTEADILHRGAEAFHAALNTVNVCKYNLGWGAIGMCTHALYESVTHAANRHLYGTVV
FT                   TDFSHVRRLLTDAYVRLIAMKLVASRASDYMRSASAADRRYLLYSPLTKAKVTSEGERV
FT                   ITALWDVIAAKGVEKDTFFETVAREIGLLPRLEGTVHINIGLLGKFMPNYLFAPDSTLP
FT                   VIPRRDDAADDAFLFAQGPTGGLGKVRFHDWRASFDTCAHLPNVALLREQVDVFAELLA
FT                   SATPDAAQQKDIDFAFGVGQLFANVPYAQLILEEARLSGVDEALIDEIFGVLVRDFNTH
FT                   AVELHGRSATTAEQARFAMRMVRRPVHDPARYDQIWKDHVLALNGAYQMAP"
FT   gene            278217..278906
FT                   /locus_tag="TBFG_10234"
FT                   /old_locus_tag="TBFG_00231"
FT   CDS_pept        278217..278906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10234"
FT                   /old_locus_tag="TBFG_00231"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR/acrR-family"
FT                   /note="Mapped to H37Rv Rv0232"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04577"
FT                   /protein_id="ABR04577.1"
FT                   /translation="MPTVTWARVDPARRAAVVEAAEAEFGAHGFSRGSLNVIARRAGVA
FT                   KGSLFQYFADKRDLYAFIADIASQRVRSYMEDLIRELDPNRPFFEFLTDLLDGWVAYFA
FT                   EHPRERALHAAATLEVDTDARISVRSVLHRHYLDVLRPLVRDAHARGDLRADSDTGALM
FT                   SLLLLIFPHLALAPYMRGLDPILGLDEPTPEQPALAVRRLVAVLAAAFDAQHPATNSAQ
FT                   TRSEEIT"
FT   gene            278903..279847
FT                   /locus_tag="TBFG_10235"
FT                   /old_locus_tag="TBFG_00232"
FT   CDS_pept        278903..279847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10235"
FT                   /old_locus_tag="TBFG_00232"
FT                   /product="ribonucleoside-diphosphate reductase beta subunit
FT                   nrdB"
FT                   /note="Mapped to H37Rv Rv0233"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04578"
FT                   /protein_id="ABR04578.1"
FT                   /translation="MTRTRSGSLAAGGLNWASLPLKLFAGGNAKFWDPADIDFTRDRAD
FT                   WEKLSDDERDYATRLCTQFIAGEEAVTEDIQPFMSAMRAEGRLADEMYLTQFAFEEAKH
FT                   TQVFRMWLDAVGISEDLHRYLDDLPAYRQIFYAELPECLNALSADPSPAAQVRASVTYN
FT                   HIVEGMLALTGYYAWHKICVERAILPGMQELVRRIGDDERRHMAWGTFTCRRHVAADDA
FT                   NWTVFETRMNELIPLALRLIEEGFALYGDQPPFDLSKDDFLQYSTDKGMRRFGTISNAR
FT                   GRPVAEIDVDYSPAQLEDTFADEDRRTLAAASA"
FT   gene            complement(279923..281458)
FT                   /locus_tag="TBFG_10236"
FT                   /old_locus_tag="TBFG_00233"
FT   CDS_pept        complement(279923..281458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10236"
FT                   /old_locus_tag="TBFG_00233"
FT                   /product="succinate-semialdehyde dehydrogenase
FT                   [NADP+]-dependent gabD1"
FT                   /note="Mapped to H37Rv Rv0234c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10236"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04579"
FT                   /protein_id="ABR04579.1"
FT                   /translation="MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFV
FT                   QTHPAKDVSVPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARW
FT                   ANATADLLEAEADQAAAMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADA
FT                   AKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALY
FT                   LADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKP
FT                   TVLELGGSDPFIVMPSADLDAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFV
FT                   ARMAALRVGDPTDPDTDVGPLATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYP
FT                   PTVITDISKDMALYTEEVFGPVASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRR
FT                   FIDDIVAGQVFINGMTVSYPELPFGGVKRSGYGRELSAHGIREFCNIKTVWIA"
FT   gene            complement(281484..282932)
FT                   /locus_tag="TBFG_10237"
FT                   /old_locus_tag="TBFG_00234"
FT   CDS_pept        complement(281484..282932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10237"
FT                   /old_locus_tag="TBFG_00234"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0235c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04580"
FT                   /protein_id="ABR04580.1"
FT                   /translation="MGWFSAPEYWLGRLALERGTAIIYLIAFVAAAQQFRPLIGEHGML
FT                   PVPRYLAGQSFWRTPSIFHFRYSDRVFAGVCWLGAVLSAAVVAGAASFVPLWATMLIWL
FT                   TLWVLYLSIVNVGQAWYSFGWESLLLETGFLMIFLGNERTAPPILTLLLARWLLFRVEF
FT                   GAGLIKMRGDSCWRSLTCLYYHHETQPMPGPLSWFFHHLPKPLHRIEVAGNHFAQLVVP
FT                   FGLFTPQPAASIAAAIIVVTQLWLVASGNFSWLNWLTILLACSAIDTSSAAALLPMPAQ
FT                   PALSAPPQWFAGLVVVFTAAVLLLSYWPARNLLSSHQRMNMSFNPFHLVNTYGAFGSIC
FT                   RTRREVVIEGTDESPITEQTVWKAYEFKGKPGDPRRLPRQWAPYHLRLDWLMWFAAISP
FT                   GYALPWMTPFLNRLLRNDPATLKLLRHNPFPQSPPRYVRAQLYQYRFTTVAELRRDRAW
FT                   WHRTLIGRYVPPMSLRKVASPPAD"
FT   gene            complement(282967..287169)
FT                   /locus_tag="TBFG_10238"
FT                   /old_locus_tag="TBFG_00235"
FT   CDS_pept        complement(282967..287169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10238"
FT                   /old_locus_tag="TBFG_00235"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0236c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04581"
FT                   /protein_id="ABR04581.1"
FT                   /translation="MAPLSRKWLPVVGAVALALTFAQSPGQVSPDTKLDLTANPLRFLA
FT                   RATNLWNSDLPFGQAQNQAYGYLFPHGTFFVIGHLLGVPGWVTQRLWWAVLLTVGFWGL
FT                   LRVAEALGVGGPSSRVVGAVAFALSPRVLTTLGSISSETLPMMLAPWVLLPTILALRGT
FT                   SGRSVRALAAQAGLAVALMGAVNAIATLAGCLPAVIWWACHRPNRLWWRYTAWWLLAMA
FT                   LATLWWVMALTQLHGVSPPFLDFIESSGVTTQWSSLVEVLRGTDSWTPFVAPNATAGAP
FT                   LVTGSAAILGTCLVAAAGLAGLTSPAMPARGRLVTMLLVGVVLLTVGHRGGLASPVAHP
FT                   VQAFLDAAGTPLRNVHKVGPVIRLPLVLGLAQLLSRVPLPGSAPRPAWLRAFAHPERDK
FT                   RVAVAVVALTALMVSTSLAWTGRVAPPGTFGALPQYWQEAADWLRTHHAATPTPGRVLV
FT                   VPGAPFATQVWGTSHDEPLQVLGDGPWGVRDSIPLTPPQTIRALDSVQRLFAAGRPSAG
FT                   LADTLARQGISYVLVRNDLDPETSRSARPILLHRSIAGSPGLAKLAEFGAPVGPDPLAG
FT                   FVNDSGLRPRYPAIEIYRVSAPANPGAPYFAATDQLARVDGGPEVLLRLDERRRLQGQP
FT                   PLGPVLMTADARAAGLPVPQVAVTDTPVARETDYGRVDHHSSAIRAPGDARHTYNRVPD
FT                   YPVPGAEPVVGGWTGGRITVSSSSADATAMPDVAPASAPAAAVDGDPATAWVSNALQAA
FT                   VGQWLQVDFDRPVTNAVVTLTPSATAVGAQVRRILIETVNGSTTLRFDEAGKPLTAALP
FT                   YGETPWVRFTAAATDDGSAGVQFGITDLAITQYDASGFAHPVQLRHTVLVPGPPPGSAI
FT                   AGWDLGSELLGRPGCAPGPDGVRCAASMALAPEEPANLSRTLTVPRPVSVTPMVWVRPR
FT                   QGPKLADLIAAPSTTRASGDSDLVDILGSAYAAADGDPATAWTAPQRVVQHKTPPTLTL
FT                   TLPRPTVVTGLRLAASRSMLPAHPTVVAINLGDGPQVRQLQVGELTTLWLHPRVTDTVS
FT                   VSLLDWDDVIDRNALGFDQLKPPGLAEVVVLGAGGAPIAPADAARNRARALTVDCDHGP
FT                   VVAVAGRFVHTSIRTTVGALLDGEPVAALPCEREPIALPAGQQELLISPGAAFVVDGAQ
FT                   LSTPGAGLSSATVTSAETGAWGPTHREVRVPESATSRVLVVPESINSGWVARTSTGARL
FT                   TPIAVNGWQQAWVVPAGNPGTITLTFAPNSLYRASLAIGLALLPLLALLAFWRTGRRQL
FT                   ADRPTPPWRPGAWAAAGVLAAGAVIASIAGVMVMGTALGVRYALRRRERLRDRVTVGLA
FT                   AGGLILAGAALSRHPWRSVDGYAGNWASVQLLALISVSVVAASVVATSESRGQDRMQ"
FT   gene            complement(287216..287389)
FT                   /locus_tag="TBFG_10239"
FT                   /old_locus_tag="TBFG_00236"
FT   CDS_pept        complement(287216..287389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10239"
FT                   /old_locus_tag="TBFG_00236"
FT                   /product="small secreted protein"
FT                   /note="Mapped to H37Rv Rv0236A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04582"
FT                   /protein_id="ABR04582.1"
FT                   /translation="MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSS
FT                   SVLNRVEYGNRS"
FT   gene            287504..288670
FT                   /locus_tag="TBFG_10240"
FT                   /old_locus_tag="TBFG_00237"
FT   CDS_pept        287504..288670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10240"
FT                   /old_locus_tag="TBFG_00237"
FT                   /product="lipoprotein lpqI"
FT                   /note="Mapped to H37Rv Rv0237"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10240"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04583"
FT                   /protein_id="ABR04583.1"
FT                   /translation="MAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPV
FT                   PRSCAEPAGIPALLSPRDKLAQLLVVGVRDAADAQAVVTNYHVGGILIGSDTDLTIFDG
FT                   ALAEIVAGGGPLPLAVSVDEEGGRVSRLRSLIGGTGPSARELAQTRTVQQVRDLARDRG
FT                   RQMRKLGITIDFAPVVDVTDAPDDTVIGDRSFGSDPATVTAYAGAYAQGLRDAGVLPVL
FT                   KHFPGHGRGSGDSHNGGATTPPLDDLVGDDLVPYRTLVTQAPVGVMVGHLQVPGLTGSE
FT                   PASLSKAAVNLLRTGTGYGAPPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIA
FT                   LWVTTKEVPAVLDRLEQALRAGELPMSAVDRSVVRVATMKGPNPGCGR"
FT   gene            288746..289360
FT                   /locus_tag="TBFG_10241"
FT                   /old_locus_tag="TBFG_00238"
FT   CDS_pept        288746..289360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10241"
FT                   /old_locus_tag="TBFG_00238"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0238"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10241"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04584"
FT                   /protein_id="ABR04584.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLNREMSRFIDALRSSINFDQSPKDLLRNTIVSFLRYIDANR
FT                   ASWIVMYTQATSSQAFAHTVREGREQIVQLVAELVRAGTRGPLTDAEIEMMAVALVGAG
FT                   EAVATRLGIGDTDVDEAAEMMINLFWLGLKGAPVDRLETGH"
FT   gene            289422..289655
FT                   /locus_tag="TBFG_10242"
FT                   /old_locus_tag="TBFG_00239"
FT   CDS_pept        289422..289655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10242"
FT                   /old_locus_tag="TBFG_00239"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0239"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04585"
FT                   /protein_id="ABR04585.1"
FT                   /translation="MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRR
FT                   DAASDTWQPPTPRRLGPFRASEETWRELANEA"
FT   gene            289663..290100
FT                   /locus_tag="TBFG_10243"
FT                   /old_locus_tag="TBFG_00240"
FT   CDS_pept        289663..290100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10243"
FT                   /old_locus_tag="TBFG_00240"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0240"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04586"
FT                   /protein_id="ABR04586.1"
FT                   /translation="MLSIDTNILLYAQNRDCPEHDAAAAFLVECAGRADVAVCELVLME
FT                   LYQLLRNPTVVTRPLEGPEAAEVCQTFRRNRRWALLENAPVMNEVWVLAATPRIARRRL
FT                   FDARLALTLRHHGVDEFATRNINGFTDFGFSRVWDPITSDG"
FT   gene            complement(290130..290972)
FT                   /locus_tag="TBFG_10244"
FT                   /old_locus_tag="TBFG_00241"
FT   CDS_pept        complement(290130..290972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10244"
FT                   /old_locus_tag="TBFG_00241"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0241c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04587"
FT                   /protein_id="ABR04587.1"
FT                   /translation="MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVA
FT                   AYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVT
FT                   DAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQK
FT                   KPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLA
FT                   NIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL"
FT   gene            complement(290983..292347)
FT                   /locus_tag="TBFG_10245"
FT                   /old_locus_tag="TBFG_00242"
FT   CDS_pept        complement(290983..292347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10245"
FT                   /old_locus_tag="TBFG_00242"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase fabG4"
FT                   /note="Mapped to H37Rv Rv0242c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04588"
FT                   /protein_id="ABR04588.1"
FT                   /translation="MAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLT
FT                   GSLLIGGAGRVVEPLRAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHE
FT                   FFTPVLRNLGRCGRVVVVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYL
FT                   SPDAKPAATGLESTMRFLLSAKSAYVDGQVFSVGADDSTPPADWEKPLDGKVAIVTGAA
FT                   RGIGATIAEVFARDGAHVVAIDVESAAENLAETASKVGGTALWLDVTADDAVDKISEHL
FT                   RDHHGGKADILVNNAGITRDKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGG
FT                   RVIGLSSIAGIAGNRGQTNYATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTA
FT                   AIPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA"
FT   gene            292489..293811
FT                   /locus_tag="TBFG_10246"
FT                   /old_locus_tag="TBFG_00243"
FT   CDS_pept        292489..293811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10246"
FT                   /old_locus_tag="TBFG_00243"
FT                   /product="acetyl-CoA acyltransferase fadA2"
FT                   /note="Mapped to H37Rv Rv0243"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04589"
FT                   /protein_id="ABR04589.1"
FT                   /translation="MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAAL
FT                   SGLVDRFGLAGERLDMVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQ
FT                   AAIAAADGIAAGRYEVAAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTL
FT                   PASLGVEIPANSEPRTGLSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFD
FT                   DLVSPFLGLYRDDNLRPNSSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLAS
FT                   EQWAEAHSLAPLAYLVDAETAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEI
FT                   HEAFASVVLAHLAAWESEEYCKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRI
FT                   LAQTAKQLAEKKAAKKGGGPLRGLISICAAGGQGVAAILEA"
FT   gene            complement(294115..295950)
FT                   /locus_tag="TBFG_10247"
FT                   /old_locus_tag="TBFG_00244"
FT   CDS_pept        complement(294115..295950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10247"
FT                   /old_locus_tag="TBFG_00244"
FT                   /product="acyl-CoA dehydrogenase fadE5"
FT                   /note="Mapped to H37Rv Rv0244c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04590"
FT                   /protein_id="ABR04590.1"
FT                   /translation="MSHYRSNVRDQVFNLFEVLGVDKALGHGEFSDVDVDTARDMLAEV
FT                   SRLAEGPVAESFVEGDRNPPVFDPKTHSVMLPESFKKSVNAMLEAGWDKVGIDEALGGM
FT                   PMPKAVVWALHEHILGANPAVWMYAGGAGFAQILYHLGTEEQKKWAVLAAERGWGSTMV
FT                   LTEPDAGSDVGAARTKAVQQADGSWHIDGVKRFITSGDSGDLFENIFHLVLARPEGAGP
FT                   GTKGLSLYFVPKFLFDVETGEPGERNGVFVTNVEHKMGLKVSATCELAFGQHGVPAKGW
FT                   LVGEVHNGIAQMFEVIEQARMMVGTKAIATLSTGYLNALQYAKSRVQGADLTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATFQDAAVAEVVHGVDAKLAVKVNDLM
FT                   LPVVKGVGSEQAYAKLTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGVALAHVSGQIQEFVDSGAGNGRLKTERALLAKALTDVQGMAAALTGYLMA
FT                   AQQDVTSLYKVGLGSVRFLMSVGDLIIGWLLQRQAAVAVAALDAGATGDERSFYEGKVA
FT                   VASFFAKNFLPLLTSTREVIETLDNDIMELDEAAF"
FT   gene            296322..296810
FT                   /locus_tag="TBFG_10248"
FT                   /old_locus_tag="TBFG_00245"
FT   CDS_pept        296322..296810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10248"
FT                   /old_locus_tag="TBFG_00245"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0245"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04591"
FT                   /protein_id="ABR04591.1"
FT                   /translation="MNSTNNLTPSSLREAFGHFPTGVVAIAAEVDGVRQGLAASTFVPV
FT                   SLEPPLVSFCVQNTSTTWPKLTGVPMLGISVLGEAHDAAVRTLAAKTGDRFAGLETVSN
FT                   DAGAVFIKGTSVWLESAIEQLVPAGDHTIVVLRVNQVKVDPNVAPIVFHRSVLRRLGV"
FT   gene            297126..298436
FT                   /locus_tag="TBFG_10249"
FT                   /old_locus_tag="TBFG_00246"
FT   CDS_pept        297126..298436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10249"
FT                   /old_locus_tag="TBFG_00246"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0246"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04592"
FT                   /protein_id="ABR04592.1"
FT                   /translation="MAKTSHRVSSADGMSKRILRLIIAQSGFYSAALQLGNVSIVLPFV
FT                   VAELDAELWIAALIFPAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGVNALC
FT                   ATIGKGSVAGILLVVNVTLIGVVSAISFVAFADLVAAMPSGTARARILLTEVGVGAALT
FT                   AVVAATLSFVPDQHPLSRNIHLLWTAAVAMAISAAICRALPHRIVPRVHAAPGLHKLVY
FT                   VGWTAIRTNGWYRRYLLVQVLFGSVVLGSSFHSIRVAAVPGDQPDEVVAVVLFVCVGLL
FT                   GGIALWNRVRERFGLVGLFVGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIAN
FT                   QSVFTAGQLWIARDAEPGLRTSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVL
FT                   LLNLTAAYSATRFAPAKSVDVRGLPQVSRTSRPKTGG"
FT   gene            complement(298433..299179)
FT                   /locus_tag="TBFG_10250"
FT                   /old_locus_tag="TBFG_00247"
FT   CDS_pept        complement(298433..299179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10250"
FT                   /old_locus_tag="TBFG_00247"
FT                   /product="hypothetical succinate dehydrogenase iron-sulfur
FT                   subunit (succinic dehydrogenase)"
FT                   /note="Mapped to H37Rv Rv0247c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04593"
FT                   /protein_id="ABR04593.1"
FT                   /translation="MTYSASMRVWRGDESCGELREFTVEVNEGEVVLDVILRLQQTQTP
FT                   DLAVRWNCKAGKCGSCSAEINGKPRLMCMTRMSTFDEDEIVTVTPMRTFPVIRDLVTDV
FT                   SFNYQKAREIPSFAPPKELQPSEYRMAQVDVARSQEFRKCIECFLCQNVCHVVRDHEEN
FT                   KDAFAGPRFLMRIAELEMHPLDTRDRRSQAQEEHGLGYCNITKCCTEVCPENIKITDNA
FT                   LIPMKERVADRKYDPVVWLGSKLFRR"
FT   gene            complement(299180..301120)
FT                   /locus_tag="TBFG_10251"
FT                   /old_locus_tag="TBFG_00248"
FT   CDS_pept        complement(299180..301120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10251"
FT                   /old_locus_tag="TBFG_00248"
FT                   /product="hypothetical succinate dehydrogenase iron-sulfur
FT                   subunit (succinic dehydrogenase)"
FT                   /note="Mapped to H37Rv Rv0248c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04594"
FT                   /protein_id="ABR04594.1"
FT                   /translation="MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKA
FT                   HTVMAEGGCAAAMGNANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETY
FT                   GALFDRTDDGRISQRNFGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYE
FT                   ARIKVFAECTITELLKDQGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNS
FT                   WEYTGDGHALALRAGATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENS
FT                   RFMFDYIPPVFKGQYAETEEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTP
FT                   HGGVYLDIASRLTPAEIKRRLPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDAD
FT                   TGAATVPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSA
FT                   EAIDAAAQQALSPFEGPKDGSAPENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAE
FT                   LWSRYHNVLVEGHRQYNPGWNLSIDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMD
FT                   PNWRRILLVCRATETMGTGGSGSGDSNCHINVTQQLQTPMRPDLLELFEISELEKYYTD
FT                   EELAEHPGRRG"
FT   gene            complement(301151..301972)
FT                   /locus_tag="TBFG_10252"
FT                   /old_locus_tag="TBFG_00249"
FT   CDS_pept        complement(301151..301972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10252"
FT                   /old_locus_tag="TBFG_00249"
FT                   /product="hypothetical succinate dehydrogenase membrane
FT                   anchor subunit (succinic dehydrogenase)"
FT                   /note="Mapped to H37Rv Rv0249c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04595"
FT                   /protein_id="ABR04595.1"
FT                   /translation="MSAPTANRPAIGVFTPTRAQIPERTLRTDLWWLPPLLTNLGLLAF
FT                   ICYATTRAFWGSQYWVEKYHYLTPFYSPCVSASCQPGASHLGVWFGHFPGWIPLGAMVL
FT                   PFLLGFRLTCYYYRKAYYRSVWQSPTSCAVPEPRAHYTGETRLPLIVQNTHRYFFYIAV
FT                   VVSLINTYDAIAAFHSPSGFGFGLGNVILTINVVLLWAYTISCHSCRHATGGRLKHFSK
FT                   HPVRYWIWTQVSKLNTRHMQFAWITLGTLALTDFYIMLVASGSITDLRFIG"
FT   gene            complement(302052..302345)
FT                   /locus_tag="TBFG_10253"
FT                   /old_locus_tag="TBFG_00250"
FT   CDS_pept        complement(302052..302345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10253"
FT                   /old_locus_tag="TBFG_00250"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0250c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04596"
FT                   /protein_id="ABR04596.1"
FT                   /translation="MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRIL
FT                   TDIELLDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY"
FT   gene            complement(302490..302969)
FT                   /locus_tag="TBFG_10254"
FT                   /old_locus_tag="TBFG_00251"
FT   CDS_pept        complement(302490..302969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10254"
FT                   /old_locus_tag="TBFG_00251"
FT                   /product="heat shock protein hsp (heat-stress-induced
FT                   ribosome-binding protein A)"
FT                   /note="Mapped to H37Rv Rv0251c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04597"
FT                   /protein_id="ABR04597.1"
FT                   /translation="MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAA
FT                   EIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTL
FT                   REIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK"
FT   gene            303183..305744
FT                   /locus_tag="TBFG_10255"
FT                   /old_locus_tag="TBFG_00252"
FT   CDS_pept        303183..305744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10255"
FT                   /old_locus_tag="TBFG_00252"
FT                   /product="nitrite reductase [NAD(P)H] large subunit [FAD
FT                   flavoprotein] nirB"
FT                   /note="Mapped to H37Rv Rv0252"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04598"
FT                   /protein_id="ABR04598.1"
FT                   /translation="MPTAGSSRAPAAAREIVVVGHGMVGHRLVEAVRARDADGSLRITV
FT                   LAEEGDAAYDRVGLTSYTESWDRALLALPGNDYAGDQRVRLLLNTRVTQIDRATKSVVT
FT                   AAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIRAGAQRTLDGGHTDG
FT                   GVVIGGGLLGLEAANALRQFGLQTHVVEMMPRLMAQQIDEAGGALLARMIADLGIAVHV
FT                   GTGTESIESVKHSDGSVWARVRLSDGEVIDAGVVIFAAGIRPRDELARAAGLAIGDRGG
FT                   VLTDLSCRTSDPDIYAVGEVAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFPEADLST
FT                   KLKLLGVDVASFGDAMGATENCLEVVINDAVKRTYAKLVLSDDATTLLGGVLVGDASSY
FT                   GVLRPMVGAELPGDPLALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKGELKCAIAD
FT                   GCGDVPALKSCTAAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIITATE
FT                   VRTFSGLLDRFGRGKGCDICKPVVASILASTGSDHILDGEQASLQDSNDHFLANIQKNG
FT                   SYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDLFGARVDQLPLIWQRLVD
FT                   GGMESGHAYGKAVRTVKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGC
FT                   ARECAEARGKDVGVIATEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFLIYY
FT                   IRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEFEAAMQRHVANYKCEWKGVLEDP
FT                   DKLSRFVSFVNAPDAVDSTVTFTERAGRKVPVSIGIPRVRS"
FT   gene            305770..306126
FT                   /locus_tag="TBFG_10256"
FT                   /old_locus_tag="TBFG_00253"
FT   CDS_pept        305770..306126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10256"
FT                   /old_locus_tag="TBFG_00253"
FT                   /product="nitrite reductase [NAD(P)H] small subunit nirD"
FT                   /note="Mapped to H37Rv Rv0253"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04599"
FT                   /protein_id="ABR04599.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
FT   gene            complement(306142..306666)
FT                   /locus_tag="TBFG_10257"
FT                   /old_locus_tag="TBFG_00254"
FT   CDS_pept        complement(306142..306666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10257"
FT                   /old_locus_tag="TBFG_00254"
FT                   /product="bifunctional cobalamin biosynthesis protein cobU:
FT                   cobinamide kinase + cobinamide phosphate
FT                   guanylyltransferase"
FT                   /note="Mapped to H37Rv Rv0254c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04600"
FT                   /protein_id="ABR04600.1"
FT                   /translation="MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDA
FT                   RVALHRARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVY
FT                   AVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEV
FT                   HLVIAGRVLKL"
FT   gene            complement(306691..308175)
FT                   /locus_tag="TBFG_10258"
FT                   /old_locus_tag="TBFG_00255"
FT   CDS_pept        complement(306691..308175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10258"
FT                   /old_locus_tag="TBFG_00255"
FT                   /product="cobyric acid synthase cobQ1"
FT                   /note="Mapped to H37Rv Rv0255c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10258"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04601"
FT                   /protein_id="ABR04601.1"
FT                   /translation="MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNS
FT                   MVCRGPDGTGVEIGRAQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVAS
FT                   SSWCAGRRALAEAACRAFDALAARYDVVVAEGAGSPAEINLRAGDYVNMGLARHAGLPT
FT                   IVVGDIDRGGVFAAFLGTVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLERVTGRR
FT                   VYGTLPWHPDLWLDSEDALDLQGRRAAGTGARRVAVVRLPRISNFTDVDALGLEPDLDV
FT                   VFASDPRALDDADLIVLPGTRATIADLAWLRARDLDRALLVHVAAGKPLLGICGGFQML
FT                   GRVIRDPYGIEGPGGQVTEVEGLGLLDVETAFSPHKVLRLPRGEGLGVPASGYEIHHGR
FT                   ITRGDTAEEFLGGARDGPVFGTMWHGSLEGDALREAFLRETLGLAPSGSCFLAARERRL
FT                   DLLGDLVERHLDVDALLNLARHGCPPTLPFLAPGAP"
FT   gene            complement(308194..309864)
FT                   /locus_tag="TBFG_10259"
FT                   /old_locus_tag="TBFG_00256"
FT   CDS_pept        complement(308194..309864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10259"
FT                   /old_locus_tag="TBFG_00256"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0256c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04602"
FT                   /protein_id="ABR04602.1"
FT                   /translation="MTAPIWMASPPEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAETA
FT                   DELAALLAAVQAGTWDGPTAAVYVAAHTPYLAWLVQASANSAAMATRQETAATAYGTAL
FT                   AAMPTLAELGANHALHGVLMATNFFGINTIPIALNESDYARMWIQAATTMASYQAVSTA
FT                   AVAAAPQTTPAPQIVKANAPTAASDEPNQVQEWLQWLQKIGYTDFYNNVIQPFINWLTN
FT                   LPFLQAMFSGFDPWLPSLGNPLTFLSPANIAFALGYPMDIGSYVAFLSQTFAFIGADLA
FT                   AAFASGNPATIAFTLMFTTVEAIGTIITDTIALVKTLLEQTLALLPAALPLLAAPLAPL
FT                   TLAPASAAGGFAGLSGLAGLVGIPPSAPPVIPPVAAIAPSIPTPTPTPAPAPAPTAVTA
FT                   PTPPPGPPPPPVTAPPPVTGAGIQSFGYLVGDLNSAAQARKAVGTGVRKKTPEPDSAEA
FT                   PAAAAAPEEQVQPQRRRRPKIKQLGRGYEYLDLDPETGHDPTGSPQGAGTLGFAGTTHK
FT                   ASPGQVAGLITLPNDAFGGSPRTPMMPGTWDTDSATRVE"
FT   gene            310016..310390
FT                   /locus_tag="TBFG_10260"
FT   CDS_pept        310016..310390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10260"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0257"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04603"
FT                   /protein_id="ABR04603.1"
FT                   /translation="MTRVSWLPDRCLPRLPACGRGLRGSLPGDSGGTAPDSHRLPASSS
FT                   PDGKNIGMQSVDLHVERHLPSRGRSHRTVATVTCVTALGDIRSAQLSATGAWPAVLFPS
FT                   WSWLCGIGGGVDLQKPSCRA"
FT   gene            complement(310254..310586)
FT                   /locus_tag="TBFG_10261"
FT                   /old_locus_tag="TBFG_00257"
FT   CDS_pept        complement(310254..310586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10261"
FT                   /old_locus_tag="TBFG_00257"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0257"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04604"
FT                   /protein_id="ABR04604.1"
FT                   /translation="MPCVHWLRRTCTGGGDTSPGAAAVVARSARQLVDDHVVEPESRRP
FT                   GRPKRLTDAELRRRRWSLCPAKRDNSVSAGQRRLQSRTATTNLGTKPPARRLSLRAGQI
FT                   GCRLVQ"
FT   gene            complement(310611..311066)
FT                   /locus_tag="TBFG_10262"
FT                   /old_locus_tag="TBFG_00258"
FT   CDS_pept        complement(310611..311066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10262"
FT                   /old_locus_tag="TBFG_00258"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0258c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04605"
FT                   /protein_id="ABR04605.1"
FT                   /translation="MARSQEPSRGLLDPVAKMLRLPFGTPDFIEKIVTGSVNQVGRRTL
FT                   YVLITTWDAAGGGPFAASAIATTGLAKTAEIVQSMFIGPVFNPLLKMLGADKIAIRASL
FT                   CAAQLVGLGIMRYGVRSEPLHSMSVEMLVDAIGPTMQRYLVGDIGRG"
FT   gene            complement(311091..311834)
FT                   /locus_tag="TBFG_10263"
FT                   /old_locus_tag="TBFG_00259"
FT   CDS_pept        complement(311091..311834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10263"
FT                   /old_locus_tag="TBFG_00259"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0259c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04606"
FT                   /protein_id="ABR04606.1"
FT                   /translation="MNLILTAHGTRRPSGVAMIADIAAQVSALVDRTVQVAFVDVLGPS
FT                   PSEVLSALSCRPAIVVPAFLSRGYHVRTDLPAHVAASAHPHVTVTPALGPCREIAQIVT
FT                   QQLVESGWRPGDSVILAAAGASDRRARADLHTTRTLVSELTGSWVDMGFAGTGGPDVRT
FT                   AVQRARDRAEANRGARRVVVASFLLAEGLFQERLRASGADVVTRPLGTHPGLAQLVANR
FT                   FRSAVARQQRLHRWHGTPTPVTLDL"
FT   gene            complement(311831..312976)
FT                   /locus_tag="TBFG_10264"
FT                   /old_locus_tag="TBFG_00260"
FT   CDS_pept        complement(311831..312976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10264"
FT                   /old_locus_tag="TBFG_00260"
FT                   /product="transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0260c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04607"
FT                   /protein_id="ABR04607.1"
FT                   /translation="MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMI
FT                   ALPDDDELQNNTEALIADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISR
FT                   GPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFL
FT                   GGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRE
FT                   LDIEDQLLAALRTDVHAMCVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGS
FT                   CTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGS
FT                   DTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV"
FT   gene            complement(313076..314485)
FT                   /locus_tag="TBFG_10265"
FT                   /old_locus_tag="TBFG_00261"
FT   CDS_pept        complement(313076..314485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10265"
FT                   /old_locus_tag="TBFG_00261"
FT                   /product="integral membrane nitrite extrusion protein narK3
FT                   (nitrite facilitator)"
FT                   /note="Mapped to H37Rv Rv0261c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04608"
FT                   /protein_id="ABR04608.1"
FT                   /translation="MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWS
FT                   LWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACLRFPYTFATAKFGGRNWTIFSALVL
FT                   LIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALALNA
FT                   GGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELN
FT                   TMRAVVSEPHTWVISLLYIGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAF
FT                   LGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGILISASTFGDHLAGPMPTATM
FT                   VGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAG
FT                   AVGALGGVGVNLALRESYPTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVP
FT                   ATTAPAGLAYV"
FT   gene            complement(314626..315171)
FT                   /locus_tag="TBFG_10266"
FT                   /old_locus_tag="TBFG_00262"
FT   CDS_pept        complement(314626..315171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10266"
FT                   /old_locus_tag="TBFG_00262"
FT                   /product="aminoglycoside 2-N-acetyltransferase aac"
FT                   /note="Mapped to H37Rv Rv0262c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10266"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04609"
FT                   /protein_id="ABR04609.1"
FT                   /translation="MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTL
FT                   GGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVE
FT                   QVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDI
FT                   SLDTSAELMCDWRAGDVW"
FT   gene            complement(315181..316083)
FT                   /locus_tag="TBFG_10267"
FT                   /old_locus_tag="TBFG_00263"
FT   CDS_pept        complement(315181..316083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10267"
FT                   /old_locus_tag="TBFG_00263"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0263c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04610"
FT                   /protein_id="ABR04610.1"
FT                   /translation="MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRL
FT                   VANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVIS
FT                   LGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELD
FT                   QAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWP
FT                   DRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVR
FT                   LHWARPRSRLPGQGVTQAW"
FT   gene            complement(316100..316753)
FT                   /locus_tag="TBFG_10268"
FT                   /old_locus_tag="TBFG_00264"
FT   CDS_pept        complement(316100..316753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10268"
FT                   /old_locus_tag="TBFG_00264"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0264c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04611"
FT                   /protein_id="ABR04611.1"
FT                   /translation="MSVMDVFMDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAA
FT                   LPGVVDIVAASRTVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDAP
FT                   DLAEVARCTGLTTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPSLRVPRRPERRTSMP
FT                   PGSVALADGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLTPGMWVQFRAA"
FT   gene            complement(316828..317820)
FT                   /locus_tag="TBFG_10269"
FT                   /old_locus_tag="TBFG_00265"
FT   CDS_pept        complement(316828..317820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10269"
FT                   /old_locus_tag="TBFG_00265"
FT                   /product="hypothetical periplasmic iron-transport
FT                   lipoprotein"
FT                   /note="Mapped to H37Rv Rv0265c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04612"
FT                   /protein_id="ABR04612.1"
FT                   /translation="MRQGCSRRGFLQVAEAAAATGLFAGCSSPKPPPGTPGGAAVTITH
FT                   LFGQTVIKEPPKRVVSAGYTEQDDLLAVDVVPIAVTDWFGDQPFAVWPWAAPKLGGARP
FT                   AVLNLDNGIQIDRIAALKPDLIVAINAGVDADTYQQLSAIAPTVAQSGGDAFFEPWKDQ
FT                   ARSIGQAVFAADRMRSLIEAVDQKFAAVAQRHPRWRGKKALLLQGRLWQGNVVATLAGW
FT                   RTDFLNDMGLVIADSIKPFAVDQRGVIPRDHIKAVLDAADVLIWMTESPEDEKALLADP
FT                   EIAASQATAQRRHIFTSKEQAGAIAFSSVLSYPVVAEQLPPQISQILGA"
FT   gene            complement(317842..321471)
FT                   /locus_tag="TBFG_10270"
FT                   /old_locus_tag="TBFG_00266"
FT   CDS_pept        complement(317842..321471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10270"
FT                   /old_locus_tag="TBFG_00266"
FT                   /product="5-oxoprolinase oplA"
FT                   /note="Mapped to H37Rv Rv0266c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10270"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04613"
FT                   /protein_id="ABR04613.1"
FT                   /translation="MVGAGWHFWVDRGGTFTDVVARRPDGRLLTHKLLSDNPARYRDAA
FT                   VAGIRALLANGEAGTRVDAVRMGTTVATNALLERTGERTLLVITRGFGDALRIAYQNRP
FT                   RIFDRRIVLPEMLYERVVEVDERVTADGRVLRAPDLEALGEKMRQAHADGIRAVAVVCL
FT                   HSYLYPGHEREIGTLAQRIGFAQISLSSEVSPLMKLVPRGDTTVVDAYLSPVLRRYINQ
FT                   VADQMRGVRLMFMQSNGGLAQAGHFRGKDAILSGPAGGIVGMVRMSALAGFDHVIGFDM
FT                   GGTSTDVSHYAGEYERVFTTQVAGVRLRAPMLDIHTVAAGGGSILHFDGSRYRVGPDSA
FT                   GADPGPACYRGGGPLCVTDANVMLGRIQPTHFPSVFGPSGDQPLDAGTVRRGFTDLAAD
FT                   IAARTGDDRSPEQVAEGYLRIAVANMANAVKKISVQKGHDVTRYALTTFGGAGGQHACA
FT                   VADALGIRTVLIPPMAGVLSALGIGLADTTAMREQSVEIPLGPAAPQRLASVAESLERA
FT                   ARAELLDEGVPGERIRVVRRVHLRYEGTDTAIPVQLAEIETMATAFESSHRALYTFLLD
FT                   RPLIAEAISVEATGLTDQPDLSQLGDQANDTTGSSETVRIYSNGLWRDAPLRRREAMRP
FT                   GDVLTGPAIIAEANATTVVDDGWQATMTETGHLLAQRVVTPPRPDAATRAGFEAGFEAD
FT                   PVLLEIFNNLFMSIAEQMGFRLEATAQSVNIRERLDFSCALFDPDGNLVANAPHIPVHL
FT                   GSMGTTVKEVIRRRLSGMKPGDVYAVNDPYHGGTHLPDITVITPVFNTGGEDVLFFVAS
FT                   RGHHAEIGGITPGSMPADSREIHEEGVLFDNWLLAENGRFREAETRRLLTEAPFGSRNP
FT                   DTNLADLRAQIAANQKGVDEVGKMIDHFGRDVVAAYMRHVQDNAEEAVRRVIDRLDNGA
FT                   YRYRMDSGATIAVRITVDRAARSATIDFTGTSAQLDTNFNAPTSVVNAAVLYVFRTLVA
FT                   DDIPLNDGCLRPLRIVVPEGSMLAPTHPAAVVAGNVETSQAITGALFAALGVQAEGSGT
FT                   MNNVTFGNERHQYYETVGSGSGAGDGYHGASVVQTHMTNSRLTDPEVLEWRYPVLLREF
FT                   AVRQGSGGAGRWRGGDGAVRRLEFTEPMTVSTLSGHRRVRPYGMAGGSPGELGRNRVER
FT                   ADGSTVELAGCGSTHVEPGDTLVIETPGGGGYGPASTSARRRR"
FT   gene            321648..323039
FT                   /locus_tag="TBFG_10271"
FT                   /old_locus_tag="TBFG_00267"
FT   CDS_pept        321648..323039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10271"
FT                   /old_locus_tag="TBFG_00267"
FT                   /product="integral membrane nitrite extrusion protein narU
FT                   (nitrite facilitator)"
FT                   /note="Mapped to H37Rv Rv0267"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04614"
FT                   /protein_id="ABR04614.1"
FT                   /translation="MALTTAPAIDYALPRQQDEGDHWIDDWRPEDPVFWETIGRPIARR
FT                   NLIFSIFAEHVGFSVWMLWSIVVVQMTAAAPGHPAASGWALSASQALCLVAVPSGVGAF
FT                   LRLPYTFAIPIFGGRNWTTVSAALLVIPCLLLAWAVSHPSLPFAVLVVIAATAGFGGGN
FT                   FASSMANISFFYPEKDKGWALGLNAAGGNIGVAVVQKIIPPIVVAGSGVALSRAGLFFV
FT                   PLAVAAAVCAFLFMNNLTEAKADVKPVWQSLRHADTWIMSLLYIGTFGSFIGYSAAFPT
FT                   LLKTVFGRGDIALGWAFLGAGIGSLVRPLGGKLADRIGGARITAASFVMLAAGAAAALW
FT                   SVQSVNLPVFFVSFMFLFVATGIGNGSSYRMISRIFQVKGEVAGGDPETMVNMRRQAAG
FT                   ALGIISSIGAFGGFVVPLAYAWSKVHFGNIEPALHFYVAFFLALLVVTWYCYLRRTTPM
FT                   GQVGV"
FT   gene            complement(323081..323590)
FT                   /locus_tag="TBFG_10272"
FT                   /old_locus_tag="TBFG_00268"
FT   CDS_pept        complement(323081..323590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10272"
FT                   /old_locus_tag="TBFG_00268"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0268c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04615"
FT                   /protein_id="ABR04615.1"
FT                   /translation="MGTRSKSRTRQLKQSNGCTATTSGASDRRRRARRRTAPAWLREDE
FT                   WLRHHLPHPPRQLSRCLHRRRRSACHHRYSRRTPKGGLPMTSSLVPISEARAHLSRLVR
FT                   ESADDDVVLMNHGRPAAILISAERYESLMEELEDLRDRLSVHEREHVTMPLDKLGAELG
FT                   VDIGRV"
FT   gene            complement(323655..324848)
FT                   /locus_tag="TBFG_10273"
FT                   /old_locus_tag="TBFG_00269"
FT   CDS_pept        complement(323655..324848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10273"
FT                   /old_locus_tag="TBFG_00269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0269c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04616"
FT                   /protein_id="ABR04616.1"
FT                   /translation="MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYY
FT                   LAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEA
FT                   VIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVRE
FT                   VLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWK
FT                   EEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRL
FT                   ADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWR
FT                   DRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR"
FT   gene            324884..326566
FT                   /locus_tag="TBFG_10274"
FT                   /old_locus_tag="TBFG_00270"
FT   CDS_pept        324884..326566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10274"
FT                   /old_locus_tag="TBFG_00270"
FT                   /product="fatty-acid-CoA ligase fadD2"
FT                   /note="Mapped to H37Rv Rv0270"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10274"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04617"
FT                   /protein_id="ABR04617.1"
FT                   /translation="MPNLTDLPGQAVSKLQKSIGQYVARGTAELHYLRKIIESGAIGLE
FT                   PPLNYAALAADIRKWGEVGMLPSHNARRAPNRAAVIDEEGTLTFSELDEAAHAVANGLL
FT                   AKGVRAGDGVAILARNHRWFVIANYGAARVGARIILLNSEFSGPQIKEVSDREGAKVII
FT                   YDDEYTKAVSLAQPPLGKLRALGVNPDDDKPSGSSDETLAELIAHSSTAPAPKASRRAS
FT                   IIILTSGTTGTPKGANRNTPPTLAPIGGILSHVPFKAGEVTLLPSPMFHALGYMHAALA
FT                   MFLGSTLVLRRRFKPALVLEDIEKHKATSMVVVPVMLSRILDQLEKTEPKPDLSSLKIV
FT                   FVSGSQLGAELATRALGDLGPVIYNMYGSTEVAFATIAGPKDLQFNPSTVGPVVKGVTV
FT                   KILDENGNEVPQGAVGRIFVGNAFPFEGYTGGGGKQIIDGLLSSGDVGYFDERGLLYVS
FT                   GRDDEMIVSGGENVFPAEVEDLISGHPDVVEAAAIGVDDKEFGARLRAFVVKKPGADLD
FT                   EDTIKQYVRDHLARYKVPREVIFLDELPRNPTGKVLKRELRKL"
FT   gene            complement(326583..328778)
FT                   /locus_tag="TBFG_10275"
FT                   /old_locus_tag="TBFG_00271"
FT   CDS_pept        complement(326583..328778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10275"
FT                   /old_locus_tag="TBFG_00271"
FT                   /product="acyl-CoA dehydrogenase fadE6"
FT                   /note="Mapped to H37Rv Rv0271c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04618"
FT                   /protein_id="ABR04618.1"
FT                   /translation="MSIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQ
FT                   AAAEQGLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAHDPQA
FT                   KVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQASVLVLPVAIESRDE
FT                   WVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDALLSNLTMTTAHALMSTLLSAEA
FT                   VGVARWATDTASAYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDDA
FT                   GESSSDVEFAAAVAATLAPATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFG
FT                   RGSEYPQRVVDTATTAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGG
FT                   WVLPYLPKPWGRAASPVEQIIIAQEFTAGRVKRPQIAIATWIVPSIVAFGTDNQKQRLL
FT                   PPTFRGDIFWCQLFSEPGAGSDLASLATKATRVDGGWRITGQKIWTTGAQYSQWGALLA
FT                   RTDPSAPKHNGITYFLLDMKSEGVQVKPLRELTGKEFFNTVYLDDVFVPDELVLGEVNR
FT                   GWEVSRNTLTAERVSIGGSDSTFLPTLGEFVDFVRDYRFEGQFDQVARHRAGQLIAEGH
FT                   ATKLLNLRSTLLTLAGGDPMAPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPG
FT                   KWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(328892..330025)
FT                   /locus_tag="TBFG_10276"
FT                   /old_locus_tag="TBFG_00272"
FT   CDS_pept        complement(328892..330025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10276"
FT                   /old_locus_tag="TBFG_00272"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0272c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04619"
FT                   /protein_id="ABR04619.1"
FT                   /translation="MTGRAATPGVIREFVGLPSRTAGRAAAGGHPCQGLYHHSVGRKPK
FT                   VALIAAHYQIDFSEHYLAEYMAIRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVRWLR
FT                   EVQGVETVVLLGNSGGGSLMAAYQSQAVDPNVTPLDGMRPAAGVTELPAADAYVAAAAH
FT                   PGRPDVLTAWMDAAVIDENDPVATDPELDLFDERNGPPYSPEFISRYRSAQVKRNHTIT
FT                   DWAESELKRVRAAGFSDRPFSVMRTWADPRMVDPSIEPTKRRPNQCYAGTPVKANRSAH
FT                   GIAAACTLRGWLGMWSLRVAQTRAAPHLARITCPALVLNAEADTGIFPSDAQQIYDGLA
FT                   SSDKTQVSIDTDHYFTTPGARSEQADTIAKWIAKRWR"
FT   gene            complement(330022..330642)
FT                   /locus_tag="TBFG_10277"
FT                   /old_locus_tag="TBFG_00273"
FT   CDS_pept        complement(330022..330642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10277"
FT                   /old_locus_tag="TBFG_00273"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0273c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04620"
FT                   /protein_id="ABR04620.1"
FT                   /translation="MPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSA
FT                   ASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLA
FT                   EAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMF
FT                   NQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN"
FT   gene            330697..331320
FT                   /locus_tag="TBFG_10278"
FT                   /old_locus_tag="TBFG_00274"
FT   CDS_pept        330697..331320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10278"
FT                   /old_locus_tag="TBFG_00274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0274"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04621"
FT                   /protein_id="ABR04621.1"
FT                   /translation="MARPPSRGANGSRTMIKPHNTNTEFELGGINHVALVCSDMARTVD
FT                   FYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIG
FT                   DITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVR
FT                   SFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR"
FT   gene            complement(331250..331975)
FT                   /locus_tag="TBFG_10279"
FT                   /old_locus_tag="TBFG_00275"
FT   CDS_pept        complement(331250..331975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10279"
FT                   /old_locus_tag="TBFG_00275"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0275c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10279"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04622"
FT                   /protein_id="ABR04622.1"
FT                   /translation="MTRSDRPYRGVEAAERLATRRRQSLSAGLDLLGSDQHDIAELTIR
FT                   TICRRAGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPAREQTRAGMANI
FT                   VRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDTLHAPANDHVKAVA
FT                   HFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDELTDPNLSRPRVAATAAKSGANDP
FT                   QPPEVAGQPPSSARPARRS"
FT   gene            332065..332985
FT                   /locus_tag="TBFG_10280"
FT                   /old_locus_tag="TBFG_00276"
FT   CDS_pept        332065..332985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10280"
FT                   /old_locus_tag="TBFG_00276"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0276"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04623"
FT                   /protein_id="ABR04623.1"
FT                   /translation="MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMG
FT                   VALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQK
FT                   AAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEA
FT                   DHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRG
FT                   IALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPR
FT                   FVREFPFNLMLWDLDRRMRRGRPLV"
FT   gene            complement(333025..333453)
FT                   /locus_tag="TBFG_10281"
FT                   /old_locus_tag="TBFG_00277"
FT   CDS_pept        complement(333025..333453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10281"
FT                   /old_locus_tag="TBFG_00277"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0277c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04624"
FT                   /protein_id="ABR04624.1"
FT                   /translation="MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWA
FT                   SFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGD
FT                   LIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI"
FT   gene            complement(333477..333650)
FT                   /locus_tag="TBFG_10282"
FT   CDS_pept        complement(333477..333650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04625"
FT                   /protein_id="ABR04625.1"
FT                   /translation="MIEDALRRELAAARTGGARPTVPVFDAGTGPRPGIDLTSNTVLSE
FT                   VLDEGLELNSRK"
FT   gene            complement(333754..335433)
FT                   /locus_tag="TBFG_10283"
FT                   /old_locus_tag="TBFG_00278"
FT   CDS_pept        complement(333754..335433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10283"
FT                   /old_locus_tag="TBFG_00278"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0278c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04626"
FT                   /protein_id="ABR04626.1"
FT                   /translation="MFFGSGGAGGAGGFGRTTGGIGGTGGNAGLLNGSGGAGGAGGAAI
FT                   TGPGGTGGAGGIPGLIGNGGNGGDGGASVTGTGGNGGAGGNGVQIGNGGNGGSGGTGAA
FT                   AGKAGLGGLGGQLIGLDGSNAPVSTSVHTLQQAALNVVNEPFQTLTGRPLIGNGANGTP
FT                   GTGAAGGAGGWLFGNGGNGGHGATNTAATATGGAGGAGGILFGTGGNGGTGGIATGAGG
FT                   IGGAGGAGGVSLLIGSGGTGGNGGNSIGVAGIGGAGGRGGDAGLLFGAAGTGGHGAAGG
FT                   VPAGVGGAGGNGGLFANGGAGGAGGFNAAGGNGGNGGLFGTGGTGGAGTNFGAGGNGGN
FT                   GGLFGAGGTGGAAGSGGSGITTGGGGHGGNAGLLSLGASGGAGGSGGASSLAGGAGGTG
FT                   GNGALLFGFGGAGGAGGHGGAALTSIQQGGAGGAGGNGGLLFGSAGAGGAGGSGANALG
FT                   AGTGGTGGDGGHAGVFGNGGDGGCRRVWRRYRRQRWCRRQRRADRQRRQRRQRRQSRGH
FT                   ARCRRHRRAAARRERTQRLAIAGRPATTRGVEGISCSPQMMP"
FT   gene            complement(335370..336488)
FT                   /locus_tag="TBFG_10284"
FT                   /old_locus_tag="TBFG_00278"
FT   CDS_pept        complement(335370..336488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10284"
FT                   /old_locus_tag="TBFG_00278"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0278c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04627"
FT                   /protein_id="ABR04627.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGAD
FT                   EVSTAVAALFGAHGQAYQALSAQAQAFHAQFTQALTSGGGAYAAAEAAAVSPLLDPINE
FT                   FFLANTGRPLIGNGANGAPGTGADGAPGGWLIGNGGAGGSGAANNAVGGTGGTGGAGGA
FT                   SGLLGSGGAGGAGGVATNTGGIGGAGGTGGNAVLFGAGGASTNTTGGAGGAGGDGGNAG
FT                   LLFGAAGVGGAGGFALATTASGGAGGAGGAGGMFTDAGSVGWAEKAGSAGPAGPAETAD
FT                   CSAPAAPAGPAAPSAPVSPGWAGPAGPAGPADCSAPAAPAAVVGAALPPAGKALPAPAG
FT                   TAGPAGTAATRACSSAPAAPAAPAGSAAPPAG"
FT   gene            complement(336752..339472)
FT                   /locus_tag="TBFG_10285"
FT                   /old_locus_tag="TBFG_00278"
FT   CDS_pept        complement(336752..339472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10285"
FT                   /old_locus_tag="TBFG_00278"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0278c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04628"
FT                   /protein_id="ABR04628.1"
FT                   /translation="MRIGRCQMSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTA
FT                   LMAAGADEVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSP
FT                   LLDPINEFFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGN
FT                   GGAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAG
FT                   GAGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGG
FT                   AGGAGGLFGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAG
FT                   GNAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADG
FT                   GQGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGG
FT                   NGGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVL
FT                   NVVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGG
FT                   AGGIFFGTGGTGGAGGVGTTGTGGDGGAGGAAFLMGSGGNGGSGGAGLTAGGDGGDGGN
FT                   AGSFFGAAGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLF
FT                   GAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGGSGGHGTPAAVPGGAGGAGGNAGLFSL
FT                   GASGGAGGSGGSSLTDGGGIGGVGGAGGLLFGYGGAGGAGGYSNIGAGGAGGAGGNAGM
FT                   LSGSGGSGGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLI
FT                   GNGGNGGNGGKAGGTPGAGGTSGLLIGENGLNGLP"
FT   gene            complement(339701..342214)
FT                   /locus_tag="TBFG_10286"
FT   CDS_pept        complement(339701..342214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10286"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0279c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04629"
FT                   /protein_id="ABR04629.1"
FT                   /translation="MSFVIAAPEVIAAAATDLASLESSIAAANAAAAANTTALLAAGAD
FT                   EVSTAVAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAATSPLLAPINE
FT                   FFLANTGRPLIGNGTNGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGNGGAGGLI
FT                   GNGGAGGAGGRASTGTGSAGGAGGAAGMLFGAAGVGGPGGFAAAFGATGGAGGAGGNGG
FT                   LFADGGVGGAGGATDAGTGGAGGSGGNGGLFGAGGTGGPGGFGIFGGGAGGDGGSGGLF
FT                   GAGGTGGSGGTSIINVGGNGGAGGDAGMLSLGAAGGAGGSGGSSPDGGGGAGGIGGDGG
FT                   TLFGSGGAGGVGGLGFDAGGAGGAGGKAGLLSGAGGAGGAGGGSFAGAGGTGGAGGAPG
FT                   LVGNAGNGGNGGASANGAGAAGGAGGSGVLIGNGGNGGSGGTGAPAGTAGAGGLGGQLL
FT                   GRDGFNAPASTPLHTLQQQILNAINEPTQALTGRPLIGNGANGTPGTGADGGAGGWLFG
FT                   NGGNGGHGATGADGGDGGSGGAGGILSGIGGTGGSGGIGTTGQGGTGGTGGAALLIGSG
FT                   GTGGSGGFGLDTGGAGGRGGDAGLFLGAAGTGGQAALSQNFIGAGGTAGAGGTGGLFAN
FT                   GGAGGAGGFGANGGTGGNGLLFGAGGTGGAGTLGADGGAGGHGGLFGAGGTGGAGGSSG
FT                   GTFGGNGGSGGNAGLLALGASGGAGGSGGSALNVGGTGGVGGNGGSGGSLFGFGGAGGT
FT                   GGSSGIGSSGGTGGDGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLIGNGGNGGNG
FT                   GKAGGTPGAGGTSGLIIGENGLNGL"
FT   gene            342505..344115
FT                   /locus_tag="TBFG_10287"
FT                   /old_locus_tag="TBFG_00279"
FT   CDS_pept        342505..344115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10287"
FT                   /old_locus_tag="TBFG_00279"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0280"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04630"
FT                   /protein_id="ABR04630.1"
FT                   /translation="MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADE
FT                   LIGLLGAVQTGAWQGPSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAA
FT                   MPTLVELAANHTLHGVLVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAV
FT                   ASAPQTTPAPPILAAEAADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGT
FT                   MNGIPFEDYTDAAQPIWWVVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHI
FT                   VQIVEALSQSPQLLAVALGSVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPPTLP
FT                   AVAMAPTMAAPGAAVASAAAPASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGF
FT                   GSGMSASASAQRKAPQPDSAAAAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDP
FT                   DWGPPPGEDPVTSTVASDRGAGHLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVP
FT                   GSWDPDRDAPGSAEPGDRG"
FT   gene            344139..345047
FT                   /locus_tag="TBFG_10288"
FT                   /old_locus_tag="TBFG_00280"
FT   CDS_pept        344139..345047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10288"
FT                   /old_locus_tag="TBFG_00280"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0281"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04631"
FT                   /protein_id="ABR04631.1"
FT                   /translation="MRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFC
FT                   RAVGGSWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILA
FT                   AGLDSRAYRLPWPDGTTVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQA
FT                   LRDSGFDAAAPSAWIAEGLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYA
FT                   AKVEEERAAIAEGAEEHPFFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVP
FT                   GPESEAGPMFARNTLVSAARV"
FT   gene            345271..347166
FT                   /locus_tag="TBFG_10289"
FT                   /old_locus_tag="TBFG_00281"
FT   CDS_pept        345271..347166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10289"
FT                   /old_locus_tag="TBFG_00281"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0282"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04632"
FT                   /protein_id="ABR04632.1"
FT                   /translation="MAGVGEGDSGGVERDDIGMVAASPVASRVNGKVDADVVGRFATCC
FT                   RALGIAVYQRKRPPDLAAARSGFAALTRVAHDQCDAWTGLAAAGDQSIGVLEAASRTAT
FT                   TAGVLQRQVELADNALGFLYDTGLYLRFRATGPDDFHLAYAAALASTGGPEEFAKANHV
FT                   VSGITERRAGWRAARWLAVVINYRAERWSDVVKLLTPMVNDPDLDEAFSHAAKITLGTA
FT                   LARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDEESASEVLQDLYAAHPEN
FT                   EQVEQALSDTSFGIVTTTAGRIEARTDPWDPATEPGAEDFVDPAAHERKAALLHEAELQ
FT                   LAEFIGLDEVKRQVSRLKSSVAMELVRKQRGLTVAQRTHHLVFAGPPGTGKTTIARVVA
FT                   KIYCGLGLLKRENIREVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGA
FT                   KNDFGLVAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPSYTS
FT                   HELVEIAHKMAEQRDSVFEQSALHDLEALFAKLAAESTPDTNGISRRSLDIAGNGRFVR
FT                   NIVERSEEEREFRLDHSEHAGSGEFSDEELMTITADDVGRSVEPLLRGLGLSVRA"
FT   gene            347163..348779
FT                   /locus_tag="TBFG_10290"
FT                   /old_locus_tag="TBFG_00282"
FT   CDS_pept        347163..348779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10290"
FT                   /old_locus_tag="TBFG_00282"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0283"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10290"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04633"
FT                   /protein_id="ABR04633.1"
FT                   /translation="MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGW
FT                   RFVMRRIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQAGSN
FT                   AVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTELDQFPRGNLIGIPG
FT                   APERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVIAGPLEDTGARAAALGPGQAVLV
FT                   DSGAGTWLLWDGKRSPIDLADHAVTSGLGLGADVPAPRIIASGLFNAIPEAPPLTAPII
FT                   PDAGNPASFGVPAPIGAVVSSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNN
FT                   NSYGLQQPPRLGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATS
FT                   SLTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPDAPGAGSLF
FT                   WVSDTGVRYGIDNEPQGVAGGGKAVEALGLNPPPVPIPWSVLSLFVPGPTLSRADALLA
FT                   HDTLVPDSRPARPVSAEGGYR"
FT   gene            348776..352768
FT                   /locus_tag="TBFG_10291"
FT                   /old_locus_tag="TBFG_00283"
FT   CDS_pept        348776..352768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10291"
FT                   /old_locus_tag="TBFG_00283"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0284"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04634"
FT                   /protein_id="ABR04634.1"
FT                   /translation="MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPY
FT                   LIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADY
FT                   LRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRH
FT                   TVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSRITVLGERA
FT                   QVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARN
FT                   LSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVV
FT                   HCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSR
FT                   WDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEP
FT                   LMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAG
FT                   ADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLE
FT                   YENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTL
FT                   DVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPI
FT                   RFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKL
FT                   IATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRD
FT                   PLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQ
FT                   DLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVID
FT                   NLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRL
FT                   ELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAIN
FT                   ARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFG
FT                   DARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAM
FT                   LGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTP
FT                   LIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRG
FT                   ERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS"
FT   gene            352765..353073
FT                   /locus_tag="TBFG_10292"
FT                   /old_locus_tag="TBFG_00284"
FT   CDS_pept        352765..353073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10292"
FT                   /old_locus_tag="TBFG_00284"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0285"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04635"
FT                   /protein_id="ABR04635.1"
FT                   /translation="MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADP
FT                   VSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG"
FT   gene            353076..354617
FT                   /locus_tag="TBFG_10293"
FT                   /old_locus_tag="TBFG_00285"
FT   CDS_pept        353076..354617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10293"
FT                   /old_locus_tag="TBFG_00285"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0286"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04636"
FT                   /protein_id="ABR04636.1"
FT                   /translation="MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTA
FT                   AELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTAL
FT                   AAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGA
FT                   ALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQF
FT                   LQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPA
FT                   GLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAA
FT                   GAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAA
FT                   TRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKE
FT                   RRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK"
FT   gene            354666..354959
FT                   /locus_tag="TBFG_10294"
FT                   /old_locus_tag="TBFG_00286"
FT   CDS_pept        354666..354959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10294"
FT                   /old_locus_tag="TBFG_00286"
FT                   /product="Esat-6 like protein esxG"
FT                   /note="Mapped to H37Rv Rv0287"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04637"
FT                   /protein_id="ABR04637.1"
FT                   /translation="MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQG
FT                   ESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF"
FT   gene            354989..355279
FT                   /locus_tag="TBFG_10295"
FT                   /old_locus_tag="TBFG_00287"
FT   CDS_pept        354989..355279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10295"
FT                   /old_locus_tag="TBFG_00287"
FT                   /product="low molecular weight protein antigen 7 esxH (10
FT                   kda antigen) (protein TB10.4)"
FT                   /note="Mapped to H37Rv Rv0288"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04638"
FT                   /protein_id="ABR04638.1"
FT                   /translation="MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQG
FT                   DTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG"
FT   gene            355290..356177
FT                   /locus_tag="TBFG_10296"
FT                   /old_locus_tag="TBFG_00288"
FT   CDS_pept        355290..356177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10296"
FT                   /old_locus_tag="TBFG_00288"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0289"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04639"
FT                   /protein_id="ABR04639.1"
FT                   /translation="MDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGA
FT                   FVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGI
FT                   VALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEF
FT                   SLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGR
FT                   HTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWF
FT                   PGQRVSRDFSTQSS"
FT   gene            356224..357642
FT                   /locus_tag="TBFG_10297"
FT                   /old_locus_tag="TBFG_00289"
FT   CDS_pept        356224..357642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10297"
FT                   /old_locus_tag="TBFG_00289"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0290"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04640"
FT                   /protein_id="ABR04640.1"
FT                   /translation="MSGTVMQIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPSA
FT                   QNGDGGQADSGAAVQLSLAPVGGQPFSLDASLDTVGVVDGDLLVLQPVPAGPAAPGIVE
FT                   DIADAAMIFSTSRLKPWGIAHIQRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAG
FT                   IAVASALAGLLITIRSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWS
FT                   LIALMIPSAERERVVAFFTAAAVVGASVALAAGAQLLWQLPLLSIGCGLIVAALLVTIQ
FT                   AAQLSALWARFPLPVIPAPGDPTPSAPPLRLLEDLPRRVRVSDAHQSGFIAAAVLLSVL
FT                   GSVAIAVRPEALSVVGWYLVAATAAAATLRARVWDSAACKAWLLAQPYLVAGVLLVFYT
FT                   ATGRYVAAFGAVLVLAVLMLAWVVVALNPGIASPESYSLPLRRLLGLVAAGLDVSLIPV
FT                   MAYLVGLFAWVLNR"
FT   gene            357639..359024
FT                   /locus_tag="TBFG_10298"
FT                   /old_locus_tag="TBFG_00290"
FT   CDS_pept        357639..359024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10298"
FT                   /old_locus_tag="TBFG_00290"
FT                   /product="membrane-anchored mycosin mycP3"
FT                   /note="Mapped to H37Rv Rv0291"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04641"
FT                   /protein_id="ABR04641.1"
FT                   /translation="MIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPV
FT                   APMEQRGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQPGPRL
FT                   PNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAARLLSIRAMSTKFS
FT                   PRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINVSTITCLPADRMVDQAALGAAIR
FT                   YAAVDKDAVIVAAAGNTGASGSVSASCDSNPLTDLSRPDDPRNWAGVTSVSIPSWWQPY
FT                   VLSVASLTSAGQPSKFSMPGPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSG
FT                   TSYAAGYVSGVAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDAVAALTW
FT                   QLPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATVAIARRRRE
FT                   PTE"
FT   gene            359021..360016
FT                   /locus_tag="TBFG_10299"
FT                   /old_locus_tag="TBFG_00291"
FT   CDS_pept        359021..360016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10299"
FT                   /old_locus_tag="TBFG_00291"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0292"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04642"
FT                   /protein_id="ABR04642.1"
FT                   /translation="MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVV
FT                   IGLFGFWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLI
FT                   ARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVA
FT                   ARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSADAELPD
FT                   TLPAIRSRPAQETWIALEIAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNH
FT                   VPALTALDPRSTRRLDGHTDAPADLLTRLHWPTPTAGAHRAPLTNAVSRT"
FT   gene            complement(360003..361205)
FT                   /locus_tag="TBFG_10300"
FT                   /old_locus_tag="TBFG_00292"
FT   CDS_pept        complement(360003..361205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10300"
FT                   /old_locus_tag="TBFG_00292"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0293c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04643"
FT                   /protein_id="ABR04643.1"
FT                   /translation="MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVES
FT                   SAIADVALRTAVASVLSATVTPAVVANALRHVNEGSERSNLNFYAELAAAHDPAKSFPA
FT                   PTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSALTANNIVHAQHWR
FT                   HRDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGYDVLLYTLPFHGQRAEKFSPFSG
FT                   FGYFTSGLSGFAEAMAQAVYDFRSIVDYLRHIGVDRIALTGISLGGYTSALLASVESRL
FT                   EAVIPNCPVVMPAKLFDEWFPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKD
FT                   RRMIITGLGDRMAPPEHAVTLWKQWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMF
FT                   D"
FT   gene            361312..362097
FT                   /locus_tag="TBFG_10301"
FT                   /old_locus_tag="TBFG_00293"
FT   CDS_pept        361312..362097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10301"
FT                   /old_locus_tag="TBFG_00293"
FT                   /product="trans-aconitate methyltransferase tam"
FT                   /note="Mapped to H37Rv Rv0294"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04644"
FT                   /protein_id="ABR04644.1"
FT                   /translation="MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTR
FT                   YLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPE
FT                   HSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQ
FT                   SPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQ
FT                   ELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG"
FT   gene            complement(362086..362889)
FT                   /locus_tag="TBFG_10302"
FT                   /old_locus_tag="TBFG_00294"
FT   CDS_pept        complement(362086..362889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10302"
FT                   /old_locus_tag="TBFG_00294"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0295c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04645"
FT                   /protein_id="ABR04645.1"
FT                   /translation="MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTG
FT                   MAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWN
FT                   QTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWR
FT                   GHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIV
FT                   ASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT"
FT   gene            complement(362899..364296)
FT                   /locus_tag="TBFG_10303"
FT                   /old_locus_tag="TBFG_00295"
FT   CDS_pept        complement(362899..364296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10303"
FT                   /old_locus_tag="TBFG_00295"
FT                   /product="hypothetical sulfatase"
FT                   /note="Mapped to H37Rv Rv0296c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04646"
FT                   /protein_id="ABR04646.1"
FT                   /translation="MTSERATGQRENLLIVHWHDLGRYLGVYHHPDVYSPRLDRLAAEG
FT                   ILFTRAHATAPLCTPSRGSLFTGRYPQSNGLVGLAHHGWEYRTGVQTLPQLLSESGWYS
FT                   ALFGMQHETSYPKRLGFDEFDVSNSYCEYVVAKAQDWLHNRVPALDGQRFLLTAGFFET
FT                   HRPYPHERYRPADSAAVELPDYLPDTPEVRQDVAEFYGSIATADEAVGRLLDTLADTGL
FT                   DASTWVVFVTDHGPAFPRAKSTLYDAGTGIALIIRPPTRRAMAPRVYDELFSGVDLVPT
FT                   LLDLLRLEVPADVEGVSHAPALLAPDTENAAVRDHVYTAKTYHDSFDPIRAIRTKEYSY
FT                   IENYAPRPLLDLPWDIQESPAGMAVAPLVKAPRPQRELYDLRADPTETNNLLAGDDSTQ
FT                   GVAAIAADLAVRLHDWRQRTADVIPSDFAGSRIAERYTETYLRIHRKTPTGRSAIAADR
FT                   GIDEHCS"
FT   gene            364382..366250
FT                   /locus_tag="TBFG_10304"
FT                   /old_locus_tag="TBFG_00296"
FT   CDS_pept        364382..366250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10304"
FT                   /old_locus_tag="TBFG_00296"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0297"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04647"
FT                   /protein_id="ABR04647.1"
FT                   /translation="MMAVGSLIESRRRRRRVVSWRPGVTSRREVPVSFVIAQPEMIAAA
FT                   AGELASIRSAINAANAAAAAQTTGVMSAAADEVSTAVAALFSSHAQAYQAASAQAAAFH
FT                   AQVVRTLTVDAGAYVSAEAANAGPNMLAAVNAPAQALLGRPLIGNGANGAPGTGQAGGD
FT                   GGLLFGNGGNGGSGAPGQAGGAGGAAGFFGNGGNGGDGGAGANGGAGGTAGWFFGFGGN
FT                   GGAGGIGVAGINGGLGGAGGDGGNAGFFGNGGNGGMGGAGAAGVNAVNPGLATPVTPAA
FT                   NGGNGLNLVGVPGTAGGGADGANGSAIGQAGGAGGDGGNASTSGGIGIAQTGGAGGAGG
FT                   AGGDGAPGGNGGNGGSVEHTGATGSSASGGNGATGGNGGVGAPGGAGGNGGHVSGGSVN
FT                   TAGAGGKGGNGGTGGAGGPGGHGGSVLSGPVGDSGNGGAGGDGGAGVSATDIAGTGGRG
FT                   GNGGHGGLWIGNGGDGGAGGVGGVGGAGAAGAIGGHGGDGGSVNTPIGGSEAGDGGKGG
FT                   LGGDGGGRGIFGQFGAGGAGGAGGVGGAGGAGGTGGGGGNGGAIFNAGTPGAAGTGGDG
FT                   GVGGTGAAGGKGGAGGSGGVNGATGADGAKGLDGATGGKGNNGNPG"
FT   gene            366393..366620
FT                   /locus_tag="TBFG_10305"
FT                   /old_locus_tag="TBFG_00297"
FT   CDS_pept        366393..366620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10305"
FT                   /old_locus_tag="TBFG_00297"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0298"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10305"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04648"
FT                   /protein_id="ABR04648.1"
FT                   /translation="MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVA
FT                   LRDYTAKTVPALDIDAYAQRVYQANRAAGS"
FT   gene            366617..366919
FT                   /locus_tag="TBFG_10306"
FT                   /old_locus_tag="TBFG_00298"
FT   CDS_pept        366617..366919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10306"
FT                   /old_locus_tag="TBFG_00298"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0299"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04649"
FT                   /protein_id="ABR04649.1"
FT                   /translation="MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRV
FT                   PEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPLGNAGVAALREAASVVTALLC"
FT   gene            367185..367610
FT                   /locus_tag="TBFG_10307"
FT                   /old_locus_tag="TBFG_00299"
FT   CDS_pept        367185..367610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10307"
FT                   /old_locus_tag="TBFG_00299"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0301"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04650"
FT                   /protein_id="ABR04650.1"
FT                   /translation="MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVG
FT                   FSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAA
FT                   TAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA"
FT   gene            367746..368378
FT                   /locus_tag="TBFG_10308"
FT                   /old_locus_tag="TBFG_00300"
FT   CDS_pept        367746..368378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10308"
FT                   /old_locus_tag="TBFG_00300"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR/acrR-family"
FT                   /note="Mapped to H37Rv Rv0302"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04651"
FT                   /protein_id="ABR04651.1"
FT                   /translation="MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACG
FT                   LAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEAHGPVEQRSERQLTELVSLQSQ
FT                   HPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAE
FT                   LTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET"
FT   gene            368375..369283
FT                   /locus_tag="TBFG_10309"
FT                   /old_locus_tag="TBFG_00301"
FT   CDS_pept        368375..369283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10309"
FT                   /old_locus_tag="TBFG_00301"
FT                   /product="hypothetical dehydrogenase/reductase"
FT                   /note="Mapped to H37Rv Rv0303"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04652"
FT                   /protein_id="ABR04652.1"
FT                   /translation="MNTGTAVITGASSGLGLQCARALLRRDASWHVVLAVRDPARGRAA
FT                   MEELGEPNRCSVLEVDLASVRSVRSFVETVRTTPLPPIRALVCNAGLQVVSGIAFTDDG
FT                   VEMTFGVNHLGHFALVTGILDWLARPARIVVVSSGTHDPSKHTGMPDPRYTCAADLAHP
FT                   PTDQNTPAEGRRRYTTSKLCNVLFTYELDRRLDHGEQGVMVNAFDPGLMPGSGLARDYP
FT                   PILRLAYRLLSPMLRVLPFVHSTRVSGEHLAALAVDPRFAGVTGQYFAGAKAIRSSAES
FT                   YDRAKALDLWETSERLLAQVT"
FT   gene            complement(369291..378791)
FT                   /locus_tag="TBFG_10310"
FT                   /old_locus_tag="TBFG_00302"
FT   CDS_pept        complement(369291..378791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10310"
FT                   /old_locus_tag="TBFG_00302"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0303"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04653"
FT                   /protein_id="ABR04653.1"
FT                   /translation="MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWF
FT                   GSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAAT
FT                   VHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVS
FT                   ALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGF
FT                   GNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIG
FT                   FGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDV
FT                   NTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGN
FT                   YSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTS
FT                   IVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFG
FT                   NSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGN
FT                   TISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANL
FT                   GDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGL
FT                   TGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFG
FT                   IGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDYNT
FT                   GMANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVDVNIPIHIPIT
FT                   ASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVGGPTTAINIGA
FT                   TVVVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAASGFMNLVSTT
FT                   SGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTNIAGLLRDGAG
FT                   TAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLANLGSYNIGFG
FT                   NLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGFGNTGSNNVGI
FT                   GLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFNTGIGNTGNTN
FT                   TGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNYNTGIANTGDV
FT                   DTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPITASAGNITLMG
FT                   VTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITITGGGAIRIPL
FT                   ISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATSGASGLLNVGA
FT                   LGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGTMVLNLGLANH
FT                   GTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLANLGSYNIGFGN
FT                   FGDDNLGFANTGSNNIGFANTGSNNIGIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIG
FT                   FFNSGNGNVGIGNTGTANFGLGNTGSTNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNT
FT                   GDFNPGSYNTGLGNTGDVDTGAFISGSYSNGFLWSGNYQGLIGLHAALAIPEIALTFGV
FT                   DIPIHIPINIDAGVVTLQGFSIVAAENNIDFTPIIIPTINITLPTAAITVGGPTTSIGI
FT                   TASAGIGSITIPIIDIPATSGFGNSTTSPSSGFFNSGAGSASGFLNVVAGASGISGYLN
FT                   VGALGSGVTNVGHTVSGFYNASALDLVTPAFASGLMRDGMGTMTLNLGLANLGSNNAGF
FT                   GNTGIFDVGVANLGNYNIGFGNFGDDNLGFANLGSYNIGVANTGSNNIGFANTGSNNIG
FT                   IGLTGTGQIGIGALNSGSGNIGLFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGST
FT                   STGLFNSGDGNTGGFNPGNFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGD
FT                   VSTGAFISGNYSNGILWRGDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVV
FT                   DNFTIPIIGFESFAFSFHIHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGL
FT                   GPITIPIIDIPAAPGIGNSTTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVS
FT                   GLLNVGALGSGVANVGNTISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAG
FT                   LGNLNVGLANLGGSNFGIGNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIA
FT                   NTGSANIGFANTGSGNIGIGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNV
FT                   GIGNTGTANFGIANSGSFNTGLGNTGSTNTGLFNPGNVNTGVGNTGSINTGSINTGSFN
FT                   TGSTNTGSFNLGDHNTGSFNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFF
FT                   WRGDYQGLIGLSTTITIPEIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGP
FT                   AAVLVNEMIGPITIDVNQVIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTG
FT                   PSSGFFHTGAGHVSGFGNFGAGNMSGSGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLA
FT                   NLGNTISGVYNTSTLDLATPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAG
FT                   IGNLGSVNIGFVNTGDSNLGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNI
FT                   GLANLGDDNLGFGNAGSYNIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQ
FT                   IGIGSLNSGSNNIGLFNSGSGNIGFFNSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAG
FT                   STNTGVFNPGDLNTGSFNPGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFIT
FT                   GSYSNGFLVSGDYQGLIGLPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGL
FT                   SGYLNTGALGSGVANVGNTISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG"
FT   gene            378994..379665
FT                   /locus_tag="TBFG_10311"
FT                   /old_locus_tag="TBFG_00303"
FT   CDS_pept        378994..379665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10311"
FT                   /old_locus_tag="TBFG_00303"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0306"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04654"
FT                   /protein_id="ABR04654.1"
FT                   /translation="MFSAPERRAVYRVIAERRDMRRFVPGGVVSEDVLARLLHAAHAAP
FT                   SVGLMQPWRFIRITDETLKRRIHALVDDERLLTAEALGAREEEFLALKVEGILDCAELL
FT                   VVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGWVSLFDPQRLAALL
FT                   AMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPLAEFVSENRWSYPSALATDHHHG
FT                   E"
FT   gene            complement(379653..380135)
FT                   /locus_tag="TBFG_10312"
FT                   /old_locus_tag="TBFG_00304"
FT   CDS_pept        complement(379653..380135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10312"
FT                   /old_locus_tag="TBFG_00304"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0307c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04655"
FT                   /protein_id="ABR04655.1"
FT                   /translation="MAVIVRKWFGLGRLPADLRCQVEAEGLIYLAEYVAVTRRFTGVIP
FT                   GLRASHSIASYVGALAFTEQRVLGTLSMVPKLAGRVVDARWDGPQAGAATAEISPTGLQ
FT                   LDLDVADVDPKFSGQLALHFKATIGEDVLSRLPRRSLAFDVPAEYVNLAVGVTYSP"
FT   gene            380193..380909
FT                   /locus_tag="TBFG_10313"
FT                   /old_locus_tag="TBFG_00305"
FT   CDS_pept        380193..380909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10313"
FT                   /old_locus_tag="TBFG_00305"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0308"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10313"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04656"
FT                   /protein_id="ABR04656.1"
FT                   /translation="MTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAA
FT                   HDIGIKNPAWVRFWDGVSLILGPVVLRPLGLLAAMVALAKRKIRIALLLLACLPLNAIM
FT                   TIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLPMLHSRFTRHIAIT
FT                   VGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLVCLCVFRPPSIFGAQRASHALSP
FT                   PVEVSRQPEPEVDTAR"
FT   gene            381011..381667
FT                   /locus_tag="TBFG_10314"
FT                   /old_locus_tag="TBFG_00306"
FT   CDS_pept        381011..381667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10314"
FT                   /old_locus_tag="TBFG_00306"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0309"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04657"
FT                   /protein_id="ABR04657.1"
FT                   /translation="MSRLLALLCAAVCTGCVAVVLAPVSLAVVNPWFANSVGNATQVVS
FT                   VVGTGGSTAKMDVYQRTAAGWQPLKTGITTHIGSAGMAPEAKSGYPATPMGVYSLDSAF
FT                   GTAPNPGGGLPYTQVGPNHWWSGDDNSPTFNSMQVCQKSQCPFSTADSENLQIPQYKHS
FT                   VVMGVNKAKVPGKGSAFFFHTTDGGPTAGCVAIDDATLVQIIRWLRPGAVIAIAK"
FT   gene            complement(381737..382228)
FT                   /locus_tag="TBFG_10315"
FT                   /old_locus_tag="TBFG_00307"
FT   CDS_pept        complement(381737..382228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10315"
FT                   /old_locus_tag="TBFG_00307"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0310c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04658"
FT                   /protein_id="ABR04658.1"
FT                   /translation="MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDV
FT                   TGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDR
FT                   VIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD
FT                   "
FT   gene            382252..383481
FT                   /locus_tag="TBFG_10316"
FT                   /old_locus_tag="TBFG_00308"
FT   CDS_pept        382252..383481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10316"
FT                   /old_locus_tag="TBFG_00308"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0311"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04659"
FT                   /protein_id="ABR04659.1"
FT                   /translation="MSQSRYAGLSRSELAVLLPELLLIGQLIDRSGMAWCIQAFGRQEM
FT                   LQIAIEEWAGASPIYTKRMQKALNFEGDDVPTIFKGLQLDIGAPPQFMDFRFTLHDRWH
FT                   GEFHLDHCGALLDVEPMGDDYVVGMCHTIEDPTFDATAIATNPRAQVRPIHRPPRKPAD
FT                   RHPHCAWTVIIDESYPEAEGIPALDAVRETKAATWELDNVDASDDGLVDYSGPLVSDLD
FT                   FGAFSHSALVRMADEVCLQMHLLNLSFAIAVRKRAKADAQLAISVNTRQLIGVAGLGAE
FT                   RIHRAMALPGGIEGALGVLELHPLLNPAGYVLAETSPDRLVVHNSPAHADGAWISLCTP
FT                   ASVQPLQAIATAVDPHLKVRISGTDTDWTAELIEADAPASELPEVLVAKVSRGSVFQFE
FT                   PRRSLPLTVK"
FT   gene            383636..385498
FT                   /locus_tag="TBFG_10317"
FT                   /old_locus_tag="TBFG_00309"
FT   CDS_pept        383636..385498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10317"
FT                   /old_locus_tag="TBFG_00309"
FT                   /product="conserved proline and threonine rich protein"
FT                   /note="Mapped to H37Rv Rv0312"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04660"
FT                   /protein_id="ABR04660.1"
FT                   /translation="MYDPLGLSIGTTNLVAAGNGGPPVTRRAVLTLYPHCAPKIGVPSQ
FT                   NPNLIEPGALMSGFVERIGDAVALVSPDGSVHDPDLLLVEALDAMVLTAGADASSSEIA
FT                   IAVPAHWKPGAVHALRNGLRTHVGFVRSGMAPRLVSDAIAALTAVNSELGLPHGSVVGL
FT                   LDFGGSATYVTLVETKSDSRTSDFQPVSATARYQDFSGSQIDQALLLRVIDQFGYGDDV
FT                   DPASTAAVGQLGQLREQCRAAKERLSTDVATELFAELAGCSSSIEMTREQLEDLIQDPL
FT                   TGFIYAFDDMLARHNASWADLAAVVTVGGGANIPLVTQRLSFHTRRPVLTASQPGCAAA
FT                   MGALLLANRGGERDSRTRTSIGLATAAAAGTSVIELPAGDVMVIDHEALTDRELAWSQT
FT                   DFPSEAPARFEGDSYNEGGPCWSMRLNAVEPPKGPAWRRIRVSQLLIGVSAVVAMTAIG
FT                   GVALTLTAIERRPSPLPTPIVPGLAPMPPGSVVPSSRAPTPPPPPSTVAPLPSAAPAPT
FT                   TVAPAPPPPTQVVTTTTAPPVTTTPRPSPTTTTTTAPPSTTTTTEPPVTTTSTIPTIPT
FT                   TTTTVKMTTEWLHVPFLPVPIPVPIPQNPGAGEPQNPFGSLGSG"
FT   gene            385570..385956
FT                   /locus_tag="TBFG_10318"
FT                   /old_locus_tag="TBFG_00310"
FT   CDS_pept        385570..385956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10318"
FT                   /old_locus_tag="TBFG_00310"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0313"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04661"
FT                   /protein_id="ABR04661.1"
FT                   /translation="MGDYGPFGFDPDEFDRVIREGSEGLRDAFERIGRFLSSSGAGTGW
FT                   SAIFEDLSRRSRPAPETAGEAGDGVWAIYTVDADGGARVEQVYATELDALRANKDNTDP
FT                   KRKVRFLPYGIAVSVLDDPVDEAQ"
FT   gene            complement(385959..386621)
FT                   /locus_tag="TBFG_10319"
FT                   /old_locus_tag="TBFG_00311"
FT   CDS_pept        complement(385959..386621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10319"
FT                   /old_locus_tag="TBFG_00311"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0314c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04662"
FT                   /protein_id="ABR04662.1"
FT                   /translation="MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYT
FT                   YPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQG
FT                   NFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNT
FT                   VVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG"
FT   gene            386682..387566
FT                   /locus_tag="TBFG_10320"
FT                   /old_locus_tag="TBFG_00312"
FT   CDS_pept        386682..387566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10320"
FT                   /old_locus_tag="TBFG_00312"
FT                   /product="hypothetical beta-1,3-glucanase precursor"
FT                   /note="Mapped to H37Rv Rv0315"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04663"
FT                   /protein_id="ABR04663.1"
FT                   /translation="MLMPEMDRRRMMMMAGFGALAAALPAPTAWADPSRPAAPAGPTPA
FT                   PAAPAAATGGLLFHDEFDGPAGSVPDPSKWQVSNHRTPIKNPVGFDRPQFFGQYRDSRQ
FT                   NVFLDGNSNLVLRATREGNRYFGGLVHGLWRGGIGTTWEARIKFNCLAPGMWPAWWLSN
FT                   DDPGRSGEIDLIEWYGNGTWPSGTTVHANPDGTAFETCPIGVDGGWHNWRVTWNPSGMY
FT                   FWLDYADGIEPYFSVPATGIEDLNEPIREWPFNDPGYTVFPVLNLAVGGSGGGDPATGS
FT                   YPQEMLVDWVRVF"
FT   gene            387615..388229
FT                   /locus_tag="TBFG_10321"
FT                   /old_locus_tag="TBFG_00313"
FT   CDS_pept        387615..388229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10321"
FT                   /old_locus_tag="TBFG_00313"
FT                   /product="hypothetical muconolactone isomerase"
FT                   /note="Mapped to H37Rv Rv0316"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04664"
FT                   /protein_id="ABR04664.1"
FT                   /translation="MEFLVTMTTRVPDSMPADAVERVRAREAARSRELAAQGKLLRLWR
FT                   PPLRPGEWRTLGLFAADDNGELEQLLASMPPRSWRTDDVTPLGAHPNDPVGQGITIAPG
FT                   KGPEFLIATTIMVPPGTPAQVVDDTVAREARRAPELAGRGHLVRLWALPDGPDGQRTLG
FT                   LWRARDPGELMAILESLPLAGWMTIETTPLSPHPDDPIRMP"
FT   gene            complement(388253..389023)
FT                   /locus_tag="TBFG_10322"
FT                   /old_locus_tag="TBFG_00314"
FT   CDS_pept        complement(388253..389023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10322"
FT                   /old_locus_tag="TBFG_00314"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   glpQ2"
FT                   /note="Mapped to H37Rv Rv0317c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10322"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04665"
FT                   /protein_id="ABR04665.1"
FT                   /translation="MEFLRHGGRIAMAHRGFTSFRLPMNSMGAFQEAAKLGFRYIETDV
FT                   RATRDGVAVILHDRRLAPGVGLSGAVDRLDWRDVRKAQLGAGQSIPTLEDLLTALPDMR
FT                   VNIDIKAASAIEPTVNVIERCNAHNRVLIGSFSERRRRRALRLLTKRVASSAGTGALLA
FT                   WLTARPLGSRAYAWRMMRDIDCVQLPSRLGGVPVITPARVRGFHAAGRQVHAWTVDEPD
FT                   VMHTLLDMDVDGIITDRADLLRDVLIARGEWDGA"
FT   gene            complement(389281..389354)
FT                   /locus_tag="TBFG_14004"
FT   tRNA            complement(389281..389354)
FT                   /locus_tag="TBFG_14004"
FT                   /product="tRNA-Gly"
FT   gene            complement(389385..390179)
FT                   /locus_tag="TBFG_10323"
FT                   /old_locus_tag="TBFG_00315"
FT   CDS_pept        complement(389385..390179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10323"
FT                   /old_locus_tag="TBFG_00315"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0318c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04666"
FT                   /protein_id="ABR04666.1"
FT                   /translation="MSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGG
FT                   VVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVAL
FT                   RRFDGHGEHQDGDDVGELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEV
FT                   LFLGLAVALRLAGSGMPRIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAA
FT                   AALLWLVVEELLVEAHETPERPWMAVMFFAGFLILYGLGVME"
FT   gene            390228..390896
FT                   /locus_tag="TBFG_10324"
FT                   /old_locus_tag="TBFG_00316"
FT   CDS_pept        390228..390896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10324"
FT                   /old_locus_tag="TBFG_00316"
FT                   /product="pyrrolidone-carboxylate peptidase pcp"
FT                   /note="Mapped to H37Rv Rv0319"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04667"
FT                   /protein_id="ABR04667.1"
FT                   /translation="MSKVLVTGFGPYGVTPVNPAQLTAEELDGRTIAGATVISRIVPNT
FT                   FFESIAAAQQAIAEIEPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVG
FT                   EPTDPAGPVAYHATVPVRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLP
FT                   VRAGWIHLPCLPSVAALDHNLGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIPSRLQI
FT                   "
FT   gene            390968..391630
FT                   /locus_tag="TBFG_10325"
FT                   /old_locus_tag="TBFG_00317"
FT   CDS_pept        390968..391630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10325"
FT                   /old_locus_tag="TBFG_00317"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0320"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04668"
FT                   /protein_id="ABR04668.1"
FT                   /translation="MGRHELARDRRKSSAVLAAVLAPAAVFFATGGDVSTLAARADANP
FT                   VLGDDAPCCVQIVPVAPLAFSSQISGGEIGTGLAASQFASASRWRIVSRYLPVGVAPEQ
FT                   GLQVKTVLTARSISAAFPEIREIGGVRPDALRWHPNGLALDVMVPNPGTAEGIALGNEI
FT                   VAFVLKNATRFGMQDVIWRGAYYTPNGARTTGAGHYDHIHITTVGGGYPTGEELYIR"
FT   gene            391662..392234
FT                   /locus_tag="TBFG_10326"
FT                   /old_locus_tag="TBFG_00318"
FT   CDS_pept        391662..392234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10326"
FT                   /old_locus_tag="TBFG_00318"
FT                   /product="deoxycytidine triphosphate deaminase dcd"
FT                   /note="Mapped to H37Rv Rv0321"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10326"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04669"
FT                   /protein_id="ABR04669.1"
FT                   /translation="MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNN
FT                   TRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYG
FT                   SSRAGSKYQGQRGPTPSRSYQNFIRST"
FT   gene            392340..393671
FT                   /locus_tag="TBFG_10327"
FT                   /old_locus_tag="TBFG_00319"
FT   CDS_pept        392340..393671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10327"
FT                   /old_locus_tag="TBFG_00319"
FT                   /product="UDP-glucose 6-dehydrogenase udgA"
FT                   /note="Mapped to H37Rv Rv0322"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04670"
FT                   /protein_id="ABR04670.1"
FT                   /translation="MRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIP
FT                   FYEPGLRKLLTDNLAAGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVI
FT                   DALVPRLVRASILVGKSTVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDT
FT                   LNPDRIVLGVQDDSTRAEVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKIS
FT                   FINAISEVCEAAGADVSQLADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGEL
FT                   GADQALTFLREVDSINMRRRTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPA
FT                   LNVAGQLQLNGATVHVYDPKALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFID
FT                   LEPADLANRVRARVIVDGRNCLDVTRWRRAGWRVFRLGVPRLGH"
FT   gene            complement(393660..394331)
FT                   /locus_tag="TBFG_10328"
FT                   /old_locus_tag="TBFG_00320"
FT   CDS_pept        complement(393660..394331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10328"
FT                   /old_locus_tag="TBFG_00320"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0323c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04671"
FT                   /protein_id="ABR04671.1"
FT                   /translation="MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLC
FT                   FTHGEASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELTQRVV
FT                   DALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWALPQPIADRLNAEFS
FT                   ASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNPVLWRRLELLGDREYLRWLRRSV
FT                   P"
FT   gene            394432..395112
FT                   /locus_tag="TBFG_10329"
FT                   /old_locus_tag="TBFG_00321"
FT   CDS_pept        394432..395112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10329"
FT                   /old_locus_tag="TBFG_00321"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   arsR-family"
FT                   /note="Mapped to H37Rv Rv0324"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04672"
FT                   /protein_id="ABR04672.1"
FT                   /translation="MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIA
FT                   TATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADEHLADV
FT                   AVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAELADR
FT                   LAELTGDRDIVAYCRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPV
FT                   GHGD"
FT   gene            395119..395343
FT                   /locus_tag="TBFG_10330"
FT                   /old_locus_tag="TBFG_00322"
FT   CDS_pept        395119..395343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10330"
FT                   /old_locus_tag="TBFG_00322"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0325"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04673"
FT                   /protein_id="ABR04673.1"
FT                   /translation="MGPKGSLRLVKRQPELLVAQHEHWQDTYRAHPVLYGTRPSEPGVY
FT                   AAEVFNADGVQRVLELAAGHGRDTLYFAG"
FT   gene            395353..395808
FT                   /locus_tag="TBFG_10331"
FT                   /old_locus_tag="TBFG_00323"
FT   CDS_pept        395353..395808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10331"
FT                   /old_locus_tag="TBFG_00323"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0326"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04674"
FT                   /protein_id="ABR04674.1"
FT                   /translation="MVATDFSDVAVAQLRRSAQARGVSARVQPIVHDLRQPLPVKTGSI
FT                   DGAFAHMALCMALSTSEIHAVVAEVGRVLRPGGKFIYTVRHTGDAHYGAGQAHGDDIFE
FT                   CAGFAVHFFRRELVARLATGWVLEEVHDFEEGELPRRLWRVTVTKPA"
FT   gene            complement(395776..397125)
FT                   /locus_tag="TBFG_10332"
FT                   /old_locus_tag="TBFG_00324"
FT   CDS_pept        complement(395776..397125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10332"
FT                   /old_locus_tag="TBFG_00324"
FT                   /product="cytochrome P450 135A1 cyp135A1"
FT                   /note="Mapped to H37Rv Rv0327c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04675"
FT                   /protein_id="ABR04675.1"
FT                   /translation="MASTLTTGLPPGPRLPRYLQSVLYLRFREWFLPAMHRKYGDVFSL
FT                   RVPPYADNLVVYTRPEHIKEIFAADPRSLHAGEGNHILGFVMGEHSVLMTDEAEHARMR
FT                   SLLMPAFTRAALRGYRDMIASVAREHITRWRPHATINSLDHMNALTLDIILRVVFGVTD
FT                   PKVKAELTSRLQQIINIHPAILAGVPYPSLKRMNPWKRFFHNQTKIDEILYREIASRRI
FT                   DSDLTARTDVLSRLLQTKDTPTKPLTDAELRDQLITLLLAGHETTAAALSWTLWELAHA
FT                   PEIQSQVVWAAVGGDDGFLEAVLKEGMRRHTVIASTARKVTAPAEIGGWRLPAGTVVNT
FT                   SILLAHASEVSHPKPTEFRPSRFLDGSVAPNTWLPFGSGVRRCLGFGFALTEGAVILQE
FT                   IFRRFTITAAGPSKGETPLVRNITTVPKHGAHLRLIPQRRLGGLGDSDPP"
FT   gene            397191..397793
FT                   /locus_tag="TBFG_10333"
FT                   /old_locus_tag="TBFG_00325"
FT   CDS_pept        397191..397793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10333"
FT                   /old_locus_tag="TBFG_00325"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR/acrR-family"
FT                   /note="Mapped to H37Rv Rv0328"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04676"
FT                   /protein_id="ABR04676.1"
FT                   /translation="MQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINY
FT                   HFGSKDALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVY
FT                   ACVESYAPALRSEALRERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAV
FT                   IDGLMIQWIADPSATPRSTEVIRALASIGAVVTSQLR"
FT   gene            complement(397774..398400)
FT                   /locus_tag="TBFG_10334"
FT                   /old_locus_tag="TBFG_00326"
FT   CDS_pept        complement(397774..398400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10334"
FT                   /old_locus_tag="TBFG_00326"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0329c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04677"
FT                   /protein_id="ABR04677.1"
FT                   /translation="MRLTHPARRYLSSQAARPTGAFGRLLGRIWRAETADVNRIAVELL
FT                   APGPGERVCEIGFGPGRTLGLLAAAGAQVSGVEVSTTMIAIAAHHNAKAIAAGLISLYH
FT                   GDGVTLPVADHSLDKVLGVHNFYFWPDPRASLCDIARALRPGGRLVLTSISDDQPLAAR
FT                   FDPAIYRVPPTLDTAAWLGAAGFIDVGIKRSADHPATVWFTATAT"
FT   gene            complement(398427..399167)
FT                   /locus_tag="TBFG_10335"
FT                   /old_locus_tag="TBFG_00327"
FT   CDS_pept        complement(398427..399167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10335"
FT                   /old_locus_tag="TBFG_00327"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0330c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04678"
FT                   /protein_id="ABR04678.1"
FT                   /translation="MARSIPADRFSAIVAASARVFIAHGYQRTQVQDVADALALAKGTL
FT                   YGYAQGKAALFAAAVRYGDAQEALPLASELPVAAPVAGEIAAVVSARLAGEVTDMRLTH
FT                   ALRATLPPGATTGDARAELAGIVTDLYSRLARHRIALKLVDRCAPELPDLAEVWFGTGR
FT                   NAQVDAVQAYLVHRERAGLLILPGPAPMVARTIVELCALWAVHLHFDPSPEPWSIVQPG
FT                   VIDDDAIAATLAEFVVRATTASSD"
FT   gene            399281..400447
FT                   /locus_tag="TBFG_10336"
FT                   /old_locus_tag="TBFG_00328"
FT   CDS_pept        399281..400447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10336"
FT                   /old_locus_tag="TBFG_00328"
FT                   /product="hypothetical dehydrogenase/reductase"
FT                   /note="Mapped to H37Rv Rv0331"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10336"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04679"
FT                   /protein_id="ABR04679.1"
FT                   /translation="MSKTVLILGAGVGGLTTADTLRQLLPPEDRIILVDRSFDGTLGLS
FT                   LLWVLRGWRRPDDVRVRPTAASLPGVEMVTATVAHIDIAAQVVHTDNSVIGYDALVIAL
FT                   GAALNTDAVPGLSDALDADVAGQFYTLDGAAELRAKVEALEHGRIAVAIAGVPFKCPAA
FT                   PFEAAFLIAAQLGDRYATGTVQIDTFTPDPLPMPVAGPEVGEALVSMLKDHGVGFHPRK
FT                   ALARVDEAARTMHFGDGTSEPFDLLAVVPPHVPSAAARSAGLSESGWIPVDPRTLSTSA
FT                   DNVWAIGDATVLTLPNGKPLPKAAVFAEAQAAVVAHGVARHLGYDVAERHFTGTGACYV
FT                   ETGDHQAAKGDGDFFAPSAPSVTLYPPSREFHEEKVAQELAWLTRWKT"
FT   gene            400522..401307
FT                   /locus_tag="TBFG_10337"
FT                   /old_locus_tag="TBFG_00329"
FT   CDS_pept        400522..401307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10337"
FT                   /old_locus_tag="TBFG_00329"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0332"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04680"
FT                   /protein_id="ABR04680.1"
FT                   /translation="MRKPASSLAKVDYSSAYLEQTHAFGELIRNVDQSTPVPTCPGWSL
FT                   GQLFRHVGRGDRWAAQIVRDRLDHFLDPRSVEGGKPPPDPDDAISWLYGGARLLVDAVE
FT                   QTGVETPVWTFLGPRPAGWWVRRRLHEVAVHRADVAITVGGEFTLEPNVAADGISEFLE
FT                   RIAVQAGSGGTPLPLEDDDTLHLHATDPGLLEAGEWTVRRDERGVTWSHRHGKGAVALR
FT                   GGATELLLAMVRRLSVADTGIELLGDAGVWQKWLDRTPL"
FT   gene            401334..401708
FT                   /locus_tag="TBFG_10338"
FT                   /old_locus_tag="TBFG_00330"
FT   CDS_pept        401334..401708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10338"
FT                   /old_locus_tag="TBFG_00330"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0333"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04681"
FT                   /protein_id="ABR04681.1"
FT                   /translation="MTTSEIATVLAWHDALNAADIETLVALSTDDIDIGDAHGAVQGHD
FT                   ALRGWASSLTTTAELGRMYVHHGVVVVEQKITSGEDPGIARTGAAAFRVVQDHVASVFR
FT                   HEDLASALAATELTEDDLVD"
FT   gene            401738..402604
FT                   /locus_tag="TBFG_10339"
FT                   /old_locus_tag="TBFG_00331"
FT   CDS_pept        401738..402604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10339"
FT                   /old_locus_tag="TBFG_00331"
FT                   /product="alpha-D-glucose-1-phosphate thymidylyltransferase
FT                   rmlA"
FT                   /note="Mapped to H37Rv Rv0334"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04682"
FT                   /protein_id="ABR04682.1"
FT                   /translation="MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAG
FT                   IRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVAL
FT                   VLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTP
FT                   KSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLD
FT                   TGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYL
FT                   LELLERN"
FT   gene            complement(402615..403130)
FT                   /locus_tag="TBFG_10340"
FT                   /old_locus_tag="TBFG_00332"
FT   CDS_pept        complement(402615..403130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10340"
FT                   /old_locus_tag="TBFG_00332"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0335c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10340"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04683"
FT                   /protein_id="ABR04683.1"
FT                   /translation="MRSMGFLHRACRAPSSLPAPLMARPGRSVLARPAATPPGPLCATT
FT                   RPRPPQGNQPPASRISNFPPKRHKTRVLAAAEDEVSAAVAALISAHGRRHHSLNNQAAA
FT                   FHGQFAQNLNVGAGSCASAETTADAPTQALLGPADRQRRQRRAVRQWLVRWAAHPGRAT
FT                   RGFHNHRQ"
FT   gene            403248..404783
FT                   /locus_tag="TBFG_10341"
FT                   /old_locus_tag="TBFG_00333"
FT   CDS_pept        403248..404783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10341"
FT                   /old_locus_tag="TBFG_00333"
FT                   /product="13E12 repeat family protein"
FT                   /note="Mapped to H37Rv Rv0336"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04684"
FT                   /protein_id="ABR04684.1"
FT                   /translation="MFDQVRGRMPSPEAIAHFDERFECHAPRTTRVSAAFIDRICSATR
FT                   AENRAAAAQLVALGELFAYRWSRCGGREEWVMDTMAAVAAEVAAALRISQGLAASRLRY
FT                   ARAMRERLPKTAEVFSAGDIGYLMFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMT
FT                   KARLAGQVDKIVARADADAVRRRKEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDAR
FT                   LSALAGTVCEHDPRSREQRRADALGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLI
FT                   AEAATINGTGSAPASQMNADGLITAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALA
FT                   DFVRCRDLTCRWPGCDEPATNCDLDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRD
FT                   QQLPDGTLILTSPSGHTYVSTPGSALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPK
FT                   RRRTRAQDRAYRIATERRQNHAARQRAQVLTQTAAATDTHGPPPDPNDDPPPF"
FT   gene            complement(404953..406242)
FT                   /locus_tag="TBFG_10342"
FT                   /old_locus_tag="TBFG_00334"
FT   CDS_pept        complement(404953..406242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10342"
FT                   /old_locus_tag="TBFG_00334"
FT                   /product="aspartate aminotransferase aspC"
FT                   /note="Mapped to H37Rv Rv0337c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10342"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04685"
FT                   /protein_id="ABR04685.1"
FT                   /translation="MDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPV
FT                   HQHAARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRA
FT                   VVTRYELVPGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSL
FT                   AGGTPVHYLCDETQGWQPDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLA
FT                   RKHQLLLLADEIYDKILYDDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITG
FT                   PKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWT
FT                   KLNEIPGVSCVKPAGALYAFPRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAP
FT                   DHLRLVTLPWSRDLAAAIERLGNFLVSYRQ"
FT   gene            complement(406273..408921)
FT                   /locus_tag="TBFG_10343"
FT                   /old_locus_tag="TBFG_00335"
FT   CDS_pept        complement(406273..408921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10343"
FT                   /old_locus_tag="TBFG_00335"
FT                   /product="hypothetical iron-sulfur-binding reductase"
FT                   /note="Mapped to H37Rv Rv0338c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04686"
FT                   /protein_id="ABR04686.1"
FT                   /translation="MTTQTLIRLILGMSMTAVVGVFALRRVWWLYKLVMSGQPASGRTD
FT                   NLGTRIWTQISEVLGQRRLLKWSIPGLAHFFTMWGFFILLTVYIEAYGLLFEERFHIPV
FT                   IGRWDALGFLQDFFATAVFLGITTFAIIRILRNPREIGRSSRFYGSHNGGAWLVLLMIF
FT                   NVIWTYVLVRGSAVNNGTLPYGNGAFLSQLFGAILRPLGQPANEIIETTALLLHIGVML
FT                   AFLILVLHSKHLHIFLAPINVTFKRLPDGLGPLLPLEADGKPIDFENPSEDAVFGRGKI
FT                   EDFTWKGMLDFATCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGQKDA
FT                   SAGGEAGHQEHHHVPESGFGRVPGHGPEQATRPLVGTEEQGGVIDPDVLWSCVTCGACV
FT                   EQCPVDIEHVDHIVDMRRYQVMMESEFPSELSVLFKNLETKGNPWGQNASDRTNWIDEV
FT                   DFDVPVYGQDVDSFDGYEYLFWVGCAGAYDDKAKKTTKAVAELLAVAGVKYLVLGAGET
FT                   CNGDSARRSGNEFLFQQLAQQAVETLDGLFEGVETVDRKIVVTCPHCFNTIGKEYRQLG
FT                   ANYTVLHHTQLLNRLVRDKRLVPVTPVSQDITYHDPCYLGRHNKVYEAPRELIGAAGAS
FT                   LTEMPRHADRSFCCGAGGARMWMEEHIGKRINHERVDEALATDATAIATACPFCRVMVT
FT                   DGVNDRQEEAGRSGVEVLDVAQVLLGSLDHDKAQLPAKGTAAKQAQERAPKAAPKAAAP
FT                   VTPVEAPAEAPQAPAPAAPAAPVKGLGMAAGAKRPGAKKAAPTPAAPAAPAAPVKGLGI
FT                   AAGAKRPGAKKTPPPAPGLAEPAAQPQPEAKPQPEPAAPPKPQTDGDPAAPAAPVKGLG
FT                   IARGARPPGKR"
FT   gene            complement(409030..411528)
FT                   /locus_tag="TBFG_10344"
FT                   /old_locus_tag="TBFG_00336"
FT   CDS_pept        complement(409030..411528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10344"
FT                   /old_locus_tag="TBFG_00336"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0339c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04687"
FT                   /protein_id="ABR04687.1"
FT                   /translation="MQHRGCKNRGQAYDASVTDSLTEVPPAARRALLELANAPTVPVKV
FT                   LITGGIGTGKTTVLAAARDTLRRSGLTVLACPPPDGEPPETALVIDDAQLLTDTELLRL
FT                   TERVADSRLTVVAAAEAREHHRALRALTMALERDRPRISLGPLPVAEHLRDCTAGLPFL
FT                   IHAVSARAQAPAQAAKVALIERLRRLDEPTLDTLLMMSLTHELGVSDVAAALGISVTDA
FT                   RGLVDRAHASGLIESSHTAAFLQSVHDAIAQIVGNAHHHEVETSLLRSQLDISPVSAEL
FT                   ALRLAEHGLRDERLADILTRYAADTRDASVRCARLYRAAVHAGAKGLTVRLADALARTG
FT                   DCTAAATLADDLLSSPDATERAAAVRVAASVAVHDGNTGHAAELFGWLGPHPDTMVSSA
FT                   ATIVFAANGDLATARATLRLKDAGPPTMAARCARNLAEGLLLTMDQPYPVAMAKLGQAI
FT                   ATEQSLSQVIPDSPAALVTLAAIHAGDPVRARSVIGRAVRAGADPLFQRRHLLLSGWIK
FT                   MQEGQLPSASADVAAASAGTHLHRRDALWAAALQTAISRRTGDIGALQQHWYAAMEALA
FT                   EYSLDLFALLPLGELWVAAARMRQVDQLQHTLDQALTLLDSLGNPALWSNSLHWAGVHA
FT                   GILANSPESVAPHGQALGAMVAHSTLAQALSDAGRTWLRVLAENVDADEVTAAARSLSH
FT                   VGLTSDATRLAGQAALQTSDARVSGAMLQLARDLKLGNDFGEPPSGAGDTEPASGTPPA
FT                   PRQPPAGSPLSDREREVAELLLLGMPYRDIGARLFISAKTVEHHVARIRQRLGAGSRSE
FT                   MLSMLRAMLAPESLTADERR"
FT   gene            411714..412253
FT                   /locus_tag="TBFG_10345"
FT                   /old_locus_tag="TBFG_00337"
FT   CDS_pept        411714..412253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10345"
FT                   /old_locus_tag="TBFG_00337"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0340"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04688"
FT                   /protein_id="ABR04688.1"
FT                   /translation="MANSLLDFVISLVRDPEAAARYAANPERSIAEAHLTDVTRADVNS
FT                   LIPVVSDSLSMSEPIGAAGGAHAGDRGNVWASGAATAALDAFAPHADAGVVQQHGAVGS
FT                   VLNQPTPPGPGVTPTDPRPFRAGPHETSALLTSAEIPDTTSEDGGLPTDHPAVWNHPVV
FT                   DPHTVEPDHHGYDIHG"
FT   gene            412442..413881
FT                   /locus_tag="TBFG_10346"
FT                   /old_locus_tag="TBFG_00338"
FT   CDS_pept        412442..413881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10346"
FT                   /old_locus_tag="TBFG_00338"
FT                   /product="isoniazid inductible gene protein iniB"
FT                   /note="Mapped to H37Rv Rv0341"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04689"
FT                   /protein_id="ABR04689.1"
FT                   /translation="MTSLIDYILSLFRSEDAARSFVAAPGRAMTSAGLIDIAPHQISSV
FT                   AANVVPGLNLGAGDPMSGLRQAVAARHGFAQDVANVGFAGDAGAGVASVITTDVGAGLA
FT                   SGLGAGFLGQGGLALAASSGGFGGQVGLAAQVGLGFTAVIEAEVGAQVGAGLGIGTGLG
FT                   AQAGMGFGGGVGLGLGGQAGGVIGGSAAGAIGAGVGGRLGGNGQIGVAGQGAVGAGVGA
FT                   GVGGQAGIASQIGVSAGGGLGGVGNVSGLTGVSSNAVLASNASGQAGLIASEGAALNGA
FT                   AMPHLSGPLAGVGVGGQAGAAGGAGLGFGAVGHPTPQPAALGAAGVVAKTEAAAGVVGG
FT                   VGGATAAGVGGAHGDILGHEGAALGSVDTVNAGVTPVEHGLVLPSGPLIHGGTGGYGGM
FT                   NPPVTDAPAPQVPARAQPMTTAAEHTPAVTQPQHTPVEPPVHDKPPSHSVFDVGHEPPV
FT                   THTPPAPIELPSYGLFGLPGF"
FT   gene            413918..415840
FT                   /locus_tag="TBFG_10347"
FT                   /old_locus_tag="TBFG_00339"
FT   CDS_pept        413918..415840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10347"
FT                   /old_locus_tag="TBFG_00339"
FT                   /product="isoniazid inductible gene protein iniA"
FT                   /note="Mapped to H37Rv Rv0342"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04690"
FT                   /protein_id="ABR04690.1"
FT                   /translation="MVPAGLCAYRDLRRKRARKWGDTVTQPDDPRRVGVIVELIDHTIA
FT                   IAKLNERGDLVQRLTRARQRITDPQVRVVIAGLLKQGKSQLLNSLLNLPAARVGDDEAT
FT                   VVITVVSYSAQPSARLVLAAGPDGTTAAVDIPVDDISTDVRRAPHAGGREVLRVEVGAP
FT                   SPLLRGGLAFIDTPGVGGLGQPHLSATLGLLPEADAVLVVSDTSQEFTEPEMWFVRQAH
FT                   QICPVGAVVATKTDLYPRWREIVNANAAHLQRARVPMPIIAVSSLLRSHAVTLNDKELN
FT                   EESNFPAIVKFLSEQVLSRATERVRAGVLGEIRSATEQLAVSLGSELSVVNDPNLRDRL
FT                   ASDLERRKREAQQAVQQTALWQQVLGDGFNDLTADVDHDLRTRFRTVTEDAERQIDSCD
FT                   PTAHWAEIGNDVENAIATAVGDNFVWAYQRSEALADDVARSFADAGLDSVLSAELSPHV
FT                   MGTDFGRLKALGRMESKPLRRGHKMIIGMRGSYGGVVMIGMLSSVVGLGLFNPLSVGAG
FT                   LILGRMAYKEDKQNRLLRVRSEAKANVRRFVDDISFVVSKQSRDRLKMIQRLLRDHYRE
FT                   IAEEITRSLTESLQATIAAAQVAETERDNRIRELQRQLGILSQVNDNLAGLEPTLTPRA
FT                   SLGRA"
FT   gene            415837..417318
FT                   /locus_tag="TBFG_10348"
FT                   /old_locus_tag="TBFG_00340"
FT   CDS_pept        415837..417318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10348"
FT                   /old_locus_tag="TBFG_00340"
FT                   /product="isoniazid inductible gene protein iniC"
FT                   /note="Mapped to H37Rv Rv0343"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04691"
FT                   /protein_id="ABR04691.1"
FT                   /translation="MSTSDRVRAILHATIQAYRGAPAYRQRGDVFCQLDRIGARLAEPL
FT                   RIALAGTLKAGKSTLVNALVGDDIAPTDATEATRIVTWFRHGPTPRVTANHRGGRRANV
FT                   PITRRGGLSFDLRRINPAELIDLEVEWPAEELIDATIVDTPGTSSLACDASERTLRLLV
FT                   PADGVPRVDAVVFLLRTLNAADVALLKQIGGLVGGSVGALGIIGVASRADEIGAGRIDA
FT                   MLSANDVAKRFTRELNQMGICQAVVPVSGLLALTARTLRQTEFIALRKLAGAERTELNR
FT                   ALLSVDRFVRRDSPLPVDAGIRAQLLERFGMFGIRMSIAVLAAGVTDSTGLAAELLERS
FT                   GLVALRNVIDQQFAQRSDMLKAHTALVSLRRFVQTHPVPATPYVIADIDPLLADTHAFE
FT                   ELRMLSLLPSRATTLNDDEIASLRRIIGGSGTSAAARLGLDPANSREAPRAALAAAQHW
FT                   RRRAAHPLNDPFTTRACRAAVRSAEAMVAEFSARR"
FT   gene            complement(417461..418021)
FT                   /locus_tag="TBFG_10349"
FT                   /old_locus_tag="TBFG_00341"
FT   CDS_pept        complement(417461..418021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10349"
FT                   /old_locus_tag="TBFG_00341"
FT                   /product="lipoprotein lpqJ"
FT                   /note="Mapped to H37Rv Rv0344c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04692"
FT                   /protein_id="ABR04692.1"
FT                   /translation="MRLSLIARGMAALLAATALVAGCNTTIDGRPVASPGSGPTEPTFP
FT                   TPRPTTAPPGTTAPTLPTTPVSPTAPAGAIPLPPDSNGYVFIETKSGMTRCQINRDSVG
FT                   CEAPFTNSPLRDGEHANGIHITAGGSVQWVLGNLGAIPTVSIDYRTYEAQGWTIDATTD
FT                   GTRFTNNRTGHGMFVSIEKVDTF"
FT   gene            418130..418540
FT                   /locus_tag="TBFG_10350"
FT                   /old_locus_tag="TBFG_00342"
FT   CDS_pept        418130..418540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10350"
FT                   /old_locus_tag="TBFG_00342"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0345"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04693"
FT                   /protein_id="ABR04693.1"
FT                   /translation="MLPSTVVGVLLAAGAGRWYGKPKVLVDGWLDTAVGALRDGGCNDV
FT                   ILVLGAVEVSAPAGVTAITAPDWQQGLSASVRAGLAQADREHADYAVLHVIDTPDVNAK
FT                   VVARVLGRALVSRSGLAGRGRIPAHSARRRGC"
FT   gene            complement(418582..420045)
FT                   /locus_tag="TBFG_10351"
FT                   /old_locus_tag="TBFG_00343"
FT   CDS_pept        complement(418582..420045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10351"
FT                   /old_locus_tag="TBFG_00343"
FT                   /product="L-asparagine permease ansP2"
FT                   /note="Mapped to H37Rv Rv0346c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04694"
FT                   /protein_id="ABR04694.1"
FT                   /translation="MPPLDITDERLTREDTGYHKGLHSRQLQMIALGGAIGTGLFLGAG
FT                   GRLASAGPGLFLVYGICGIFVFLILRALGELVLHRPSSGSFVSYAREFYGEKVAFVAGW
FT                   MYFLNWAMTGIVDTTAIAHYCHYWRAFQPIPQWTLALIALLVVLSMNLISVRLFGELEF
FT                   WASLIKVIALVTFLIVGTVFLAGRYKIDGQETGVSLWSSHGGIVPTGLLPIVLVTSGVV
FT                   FAYAAIELVGIAAGETAEPAKIMPRAINSVVLRIACFYVGSTVLLALLLPYTAYKEHVS
FT                   PFVTFFSKIGIDAAGSVMNLVVLTAALSSLNAGLYSTGRILRSMAINGSGPRFTAPMSK
FT                   TGVPYGGILLTAGIGLLGIILNAIKPSQAFEIVLHIAATGVIAAWATIVACQLRLHRMA
FT                   NAGQLQRPKFRMPLSPFSGYLTLAFLAGVLILMYFDEQHGPWMIAATVIGVPALIGGWY
FT                   LVRNRVTAVAHHAIDHTKSVAVVHSADPI"
FT   gene            420384..421370
FT                   /locus_tag="TBFG_10352"
FT                   /old_locus_tag="TBFG_00344"
FT   CDS_pept        420384..421370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10352"
FT                   /old_locus_tag="TBFG_00344"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0347"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04695"
FT                   /protein_id="ABR04695.1"
FT                   /translation="MPGARELTLRVERGALFRRRWAASAASSARAAIRRDPRRCALGTR
FT                   PRWVSFLVIVLVIMNVVTAHPKYPNDPLALVLIELRHPRTEPPVPSAISILKEELARWT
FT                   PILEQEEVRQVNLETGEHTAHSQKKLVARDRRTAITFRPDAMTLEVTDYPGWEEFRSIV
FT                   HAMVTARQDVAPVDGCIRIGLRYINEIRASLAEPSGWAYWVAESLLGPGTQLADLKLTT
FT                   TAQRHVIQCEGPEPGDSLTLRYAGARGAVIQSTPFLQRLKEPPAEGDFFLIDIDSAWSD
FT                   PCKGIPALDAHLVDEVAERLHTPIGPLFESLITSELRTKVLQQPGQE"
FT   gene            421373..422026
FT                   /locus_tag="TBFG_10353"
FT                   /old_locus_tag="TBFG_00345"
FT   CDS_pept        421373..422026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10353"
FT                   /old_locus_tag="TBFG_00345"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0348"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04696"
FT                   /protein_id="ABR04696.1"
FT                   /translation="MTISFSSSNLRDDATSGNGDYRLDKLPETTPSTSVFDRADVTYRQ
FT                   FTELHGQARDTRREAHVVELESKTGERARCAPMHALEQLADYGFAWRDIARVVGVSVPA
FT                   ITKWRKGAGVTGENRLKIARLLALIDMLSDRFIGEPASWLEMPIQAGVGITRMDLLERG
FT                   RYDLVLALASTHTGDGTVEYVLNETDKDWRETVVDNAFESYTAEDGVISIRPKR"
FT   gene            422029..422688
FT                   /locus_tag="TBFG_10354"
FT                   /old_locus_tag="TBFG_00346"
FT   CDS_pept        422029..422688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10354"
FT                   /old_locus_tag="TBFG_00346"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0349"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10354"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04697"
FT                   /protein_id="ABR04697.1"
FT                   /translation="MPELETPDDPESIYLARLEDVGEHRPTFTGDIYRLGDGRMVMILQ
FT                   HPCALRHGVDLHPRLLVAPVRPDSLRSNWARAPFGTMPLPKLIDGQDHSADFINLELID
FT                   SPTLPTCERIAVLSQSGVNLVMQRWVYHSTRLAVPTHTYSDSTVGPFDEADLIEEWVTD
FT                   RVDDGADPQAAEHECASWLDERISGRTRRALLSDRQHASSIRREARSHRKSVKLAD"
FT   gene            422915..424792
FT                   /locus_tag="TBFG_10355"
FT                   /old_locus_tag="TBFG_00347"
FT   CDS_pept        422915..424792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10355"
FT                   /old_locus_tag="TBFG_00347"
FT                   /product="chaperone protein dnaK (hsp-70)"
FT                   /note="Mapped to H37Rv Rv0350"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04698"
FT                   /protein_id="ABR04698.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTVRSVKRHMGSDWSIEIDGKKYTAPEISARILMKLKRDAE
FT                   AYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDQRVVDWLVDKFKGTSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRI
FT                   TQDLLDRTRKPFQSVIADTGISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEEDRKRREEADVRNQAETLV
FT                   YQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAEAKAALGGSDISAIKSAMEKLGQESQA
FT                   LGQAIYEAAQAASQATGAAHPGGEPGGAHPGSADDVVDAEVVDDGREAK"
FT   gene            424789..425496
FT                   /locus_tag="TBFG_10356"
FT                   /old_locus_tag="TBFG_00348"
FT   CDS_pept        424789..425496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10356"
FT                   /old_locus_tag="TBFG_00348"
FT                   /product="chaperone grpE (hsp-70 cofactor)"
FT                   /note="Mapped to H37Rv Rv0351"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04699"
FT                   /protein_id="ABR04699.1"
FT                   /translation="MTDGNQKPDGNSGEQVTVTDKRRIDPETGEVRHVPPGDMPGGTAA
FT                   ADAAHTEDKVAELTADLQRVQADFANYRKRALRDQQAAADRAKASVVSQLLGVLDDLER
FT                   ARKHGDLESGPLKSVADKLDSALTGLGLVAFGAEGEDFDPVLHEAVQHEGDGGQGSKPV
FT                   IGTVMRQGYQLGEQVLRHALVGVVDTVVVDAAELESVDDGTAVADTAENDQADQGNSAD
FT                   TSGEQAESEPSGS"
FT   gene            425532..426719
FT                   /locus_tag="TBFG_10357"
FT                   /old_locus_tag="TBFG_00349"
FT   CDS_pept        425532..426719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10357"
FT                   /old_locus_tag="TBFG_00349"
FT                   /product="chaperone protein dnaJ1"
FT                   /note="Mapped to H37Rv Rv0352"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04700"
FT                   /protein_id="ABR04700.1"
FT                   /translation="MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGN
FT                   PAAGERFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGD
FT                   GAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAK
FT                   GVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGS
FT                   GSIIEHPCEECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTV
FT                   HVRPDKIFGRDGDDLTVTVPVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRG
FT                   RGVPKRSGGSGDLLVTVKVAVPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR"
FT   gene            426719..427099
FT                   /locus_tag="TBFG_10358"
FT                   /old_locus_tag="TBFG_00350"
FT   CDS_pept        426719..427099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10358"
FT                   /old_locus_tag="TBFG_00350"
FT                   /product="heat shock protein transcriptional repressor hspR
FT                   (merR family)"
FT                   /note="Mapped to H37Rv Rv0353"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04701"
FT                   /protein_id="ABR04701.1"
FT                   /translation="MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSG
FT                   GGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRA
FT                   NQRREVAVVPKSTALVVWKPRR"
FT   gene            complement(427326..427877)
FT                   /locus_tag="TBFG_10359"
FT                   /old_locus_tag="TBFG_00351"
FT   CDS_pept        complement(427326..427877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10359"
FT                   /old_locus_tag="TBFG_00351"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0354c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04702"
FT                   /protein_id="ABR04702.1"
FT                   /translation="MSVCVIYIPFKGCVKHVSVTIPITTEHLGPYEIDASTINPDQPID
FT                   TAFTQTLDFAGSGTVGAFPFGFGWQQSPGFFNSTTTPSSGFFNSGAGGASGFLNDAAAA
FT                   VSGLGNVFTETSGFFNAGGVGNSGFQNFGNLLSGWANLGNTVSGFYNTSMLDLATQALI
FT                   SGFGNHGARLSGILNNGSGP"
FT   gene            complement(427960..437847)
FT                   /locus_tag="TBFG_10360"
FT                   /old_locus_tag="TBFG_00352"
FT   CDS_pept        complement(427960..437847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10360"
FT                   /old_locus_tag="TBFG_00352"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0355c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04703"
FT                   /protein_id="ABR04703.1"
FT                   /translation="MSFAVLPPEINSARLYVGAGLAPMLDAAAAWDGLADELGSAAASF
FT                   SAVTAGLAGSSWLGAASTAMTGAAAPYLGWLSAAAAQAQQAATQTRLAAAAFEAALAAT
FT                   VHPAIISANRALFVSLVVSNLLGQNAPAIAATEAAYEQMWAQDVAAMFGYHAGASAAVS
FT                   ALTPFGQALPTVAGGGALVSAAAAQVTTRVFRNLGLANVGEGNVGNGNVGNFNLGSANI
FT                   GNGNIGSGNIGSSNIGFGNVGPGLTAALNNIGFGNTGSNNIGFGNTGSNNIGFGNTGDG
FT                   NRGIGLTGSGLLGFGGLNSGTGNIGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGFGN
FT                   SGDANTGFFNSGIANTGVGNAGNYNTGSYNPGNSNTGGFNMGQYNTGYLNSGNYNTGLA
FT                   NSGNVNTGAFITGNFNNGFLWRGDHQGLIFGSPGFFNSTSAPSSGFFNSGAGSASGFLN
FT                   SGANNSGFFNSSSGAIGNSGLANAGVLVSGVINSGNTVSGLFNMSLVAITTPALISGFF
FT                   NTGSNMSGFFGGPPVFNLGLANRGVVNILGNANIGNYNILGSGNVGDFNILGSGNLGSQ
FT                   NILGSGNVGSFNIGSGNIGVFNVGSGSLGNYNIGSGNLGIYNIGFGNVGDYNVGFGNAG
FT                   DFNQGFANTGNNNIGFANTGNNNIGIGLSGDNQQGFNIASGWNSGTGNSGLFNSGTNNV
FT                   GIFNAGTGNVGIANSGTGNWGIGNPGTDNTGILNAGSYNTGILNAGDFNTGFYNTGSYN
FT                   TGGFNVGNTNTGNFNVGDTNTGSYNPGDTNTGFFNPGNVNTGAFDTGDFNNGFLVAGDN
FT                   QGQIAIDLSVTTPFIPINEQMVIDVHNVMTFGGNMITVTEASTVFPQTFYLSGLFFFGP
FT                   VNLSASTLTVPTITLTIGGPTVTVPISIVGALESRTITFLKIDPAPGIGNSTTNPSSGF
FT                   FNSGTGGTSGFQNVGGGSSGVWNSGLSSAIGNSGFQNLGSLQSGWANLGNSVSGFFNTS
FT                   TVNLSTPANVSGLNNIGTNLSGVFRGPTGTIFNAGLANLGQLNIGSANLGDFNLGSGNV
FT                   GSFNVFSGNQGSYNIGPANLGNYNIGFANLGNYNIGFGNAGDFNQGFANTGNNNIGFAN
FT                   TGNNNIGIGLSGDNQQGFNFAGGWNSGTANIGLFNSGTNNVGIGNSGTGNWGIGNSGSG
FT                   NTGIGNTGSTNTGFFNTGIVNTGVANAGSYNTGWYNTGDTNTGIANLGDFNTGFYNTGN
FT                   FSTGFANQGDIATGAFITGDMGNGAFWRGDQQGLFSAGYRVHVPEIPAHVTVEVPVNIP
FT                   ITASFTNTVYSGITLEQINFGFTIDIAGIPLLAGAISKAVLPPITGTGPAITVNIGDPG
FT                   GSTAIRIPATASVGPFDVTFVNIAATTGFFNATTDPSSGFFNGGPGTVSGIANIGANIS
FT                   GFQNVANSATSGFNNYGSLQSGLANLGDTVSGVFNTGIGAPANVSGMFNIGSNLAGFFH
FT                   DQATGMSMFNLGLGNIGQFNVGFSNVGDSNAGLANIGSFNLGSGNLGSFNVFGGNQGSY
FT                   NIGPANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANTGNNNIGFANTGNNNIGIGLSGD
FT                   NQQGFNFAGGWNSGSGNSGLFNSGTNNIGLFNSGTGNIGIGNSGTGNWGIANTGDTNTG
FT                   IFNTGDVNTGLLNAGNVNTGIFNTGHYNTGSFNAGSFNTAGFNPGSYNTGYLNTGSYNT
FT                   GLANSGDVNTGGFITGNYSNGFWWRGDYQGLAGISQTITVPDTAVPVKLHVPIFLDIPV
FT                   TGTLGTFTVHGFRFPEITGDIFLIGIPFNAATLDAFSFPNISIVLPNIGINLGSGPDPL
FT                   IDIAGTGGLLPIKIPLIDIPAAPGFGNSTTTPSSGFFNAGTGTVSGVGNVGSNSSGFFN
FT                   LTSGSSGISGVQNFGELISGGFNFGNTVSGLVNASTLGLSMPANLSGGGNVGATVAGFV
FT                   NNTQILNLGFGNVGSGNVGHGNIGDSNVGLGNLGNANVGHGNIGSFNVFSGNRGSYNIG
FT                   PANLGNYNIGLGNLGSYNFGFGNAGDFNLGFANSGSNNIGFANTGNNNIGIGLSGHNQQ
FT                   GFGSWNSGTANTGLFNSGTNNIGLFNSGTGNIGIGNSGIGNTGIGNPGVGNTGLGNSGT
FT                   GNWGLWNPGTGNMGVANVGTYNTGGYNVGSTNTGIANVGIANTGSYNTGSTNTGSFNDG
FT                   DFNTGFYNTGDYNTGFYNTGDVNTGAFIGGNFSNGAFWQSDHQGQWGAHYAITVPQIPL
FT                   LNFSLNIPVNIPIHLDFGTLAVNGFQIPAITLRALGVTHFSVGPIIVPRIAGTLPVIDI
FT                   NIGDPGGSSSIPITITSGAGPVVIPLLDIPPAPGFGNSTTGPSSGFFNSGTGSSSGFGN
FT                   VGANNSGFWNTAFAGIGNSGLQNFGSLQSGWANLGNTVSGFYNTSAADFATPANLSGLS
FT                   NVGADLTGVLRGPNGSTFNAGLANLGQFNVGSANLGSANLGSANLGNSNVGFGNIGNAN
FT                   IGGANIGDFNVGIANTGPGLTAAVNNIGIGNTGNYNIGVGNTGNYNIGFGNTGNNNIGI
FT                   GLSGDNQIGFGPLNAGIANMGLFNLGDNNFGMANAGNFNQGIANTGNNNIGLFNTGNNN
FT                   VGIGLTGDGLSGFSSLNSGAGNTGFFNSGTANTGLFNSGTGNTGLFNSGTGNVGIGNMG
FT                   TGGFGVGLSGDSQVGIGGTNSGSFNIGLFNSGTGNVGIGNSGTGNVGIGNTGTGNTGIG
FT                   NSGNYNTGLLNAGLVNTGIANPGNHNTGLFNIGTFNTGIANPGHYNTGSYNTGSYNTGM
FT                   ANAGDYGTGAFITGSMNNGLLWRADRQGLLAANYTITIERPAAFLNVDIPVNIPITGDI
FT                   TNVSIPAITFPRIDASGSVDIGILSGTVLAPVGPITLHGGDASAPLDTPIEIDFGPSPA
FT                   INLNIGKPDGSTVINIVGGAGAGPISIPIIDLRPAPGFFNATTGPSSGFLNWGAGSASG
FT                   LLNFGNNSGLYNFATSSMGNSGFQNYGSLQSGWANLGNSISGIYNTGLGAPANVSGLLN
FT                   IGTNLAGWLQNGPTETTFSVGLANLGFWNLGSANIGNYNLGSANIGVYNLGSANIGDFN
FT                   LGSANIGDFNLGSANIGSSNIGFGNVGPGLTAAIGNIGFGNTGNGNIGIGNTGTGNIGF
FT                   GNTGNGNIGIGLTGDTMTGFGGWNSGTGNIGLFNSGTGNIGFGNSGTGNWGIGNSGDYN
FT                   TGIGNTGSTNSGFFNTGLVNTGIGNSGDYNTGLFNAGNTNTGSFNPGDYNTGGFNPGNY
FT                   NTGYFNPGNSNTGIANSGDVNTGAFNSGNYSNGFFWRGDYQGLGGFAYQSAVSEIPWSY
FT                   DRFQH"
FT   gene            complement(437998..438627)
FT                   /locus_tag="TBFG_10361"
FT                   /old_locus_tag="TBFG_00353"
FT   CDS_pept        complement(437998..438627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10361"
FT                   /old_locus_tag="TBFG_00353"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0356c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04704"
FT                   /protein_id="ABR04704.1"
FT                   /translation="MHPDELDPEYHHHGGFPEYGPASPGAGFGQFVATMRRLQDLAVAA
FT                   DPGDAVWDEAAERAAALVELLSPFEADEGKAPAGRTPGLPGMGSLLLPPWTVTRYGTDG
FT                   VEMRGSFSRFHVGGNSAVHGGVLPLLFDHMFGMISHAAGRPISRTAFLHVDYRRITPID
FT                   VPLIVRGRVTNTEGRKAFVCAELFDSDETLLAEGNGLMVRLLPGQP"
FT   gene            complement(438639..439937)
FT                   /locus_tag="TBFG_10362"
FT                   /old_locus_tag="TBFG_00354"
FT   CDS_pept        complement(438639..439937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10362"
FT                   /old_locus_tag="TBFG_00354"
FT                   /product="adenylosuccinate synthetase purA"
FT                   /note="Mapped to H37Rv Rv0357c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04705"
FT                   /protein_id="ABR04705.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGVLTPGVTNVIGNGVVIDPGVLLNELRGLQDRGVDTAKLLISADAH
FT                   LLMPYHIAIDKVTERYMGSKKIGTTGRGIGPCYQDKIARIGIRVADVLDPEQLTHKVEA
FT                   ACEFKNQVLVKIYNRKALDPAQVVDALLEQAEGFKHRIADTRLLLNAALEAGETVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGAAVGSGIGPTRIGTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGEYLSKTGREFGVTTGRRRRCGWFDAVIARYAARVNGITDYFLTKLDVLSSLES
FT                   VPVCVGYEIDGRRTRDMPMTQRDLCRAKPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEQLAGAPVSCIGVGPGREQTIVRRDVLQDRP"
FT   gene            440028..440675
FT                   /locus_tag="TBFG_10363"
FT                   /old_locus_tag="TBFG_00355"
FT   CDS_pept        440028..440675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10363"
FT                   /old_locus_tag="TBFG_00355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0358"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04706"
FT                   /protein_id="ABR04706.1"
FT                   /translation="MYTAENAPGVAVLLSGDADVPGPLTGLPTHQDNLDTVIGRYSRLI
FT                   VVGADADLGAVLTRLLRTDRLDVEVGYVPRRRSPATRAYRLPAGRRAARRARCGVARRV
FT                   PLIRDETGSVIVGRAQWLPAEEQALIHGEAVVDDTVLFDGDVAGVCIEPTLTLPGLRAA
FT                   VDGAGKWRRWIGGRAAQLGTTGAAVLRDGVAAPRPVRRSTFYRNVEGWLLVR"
FT   gene            440686..441465
FT                   /locus_tag="TBFG_10364"
FT                   /old_locus_tag="TBFG_00356"
FT   CDS_pept        440686..441465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10364"
FT                   /old_locus_tag="TBFG_00356"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0359"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04707"
FT                   /protein_id="ABR04707.1"
FT                   /translation="MSETGQRESVRPSPIFLGLLGLTAVGGALAWLAGETVQPLAYAGV
FT                   FVMVIAGWLVSLCLHEFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPMLFIA
FT                   LGGIGLPGAAVYVHTWFMTTARRTLVSLAGPTVNLALAMLLLAATRLLFDPIHAVLWAG
FT                   VAFLAFLQLTALVLNLLPIPGLDGYAALEPHLRPETQRALAPAKQFALVFLLVLFLAPT
FT                   LNGWFFGVVYWLFDLSGVSHRLAAAGSVLARFWSIWF"
FT   gene            complement(441470..441907)
FT                   /locus_tag="TBFG_10365"
FT                   /old_locus_tag="TBFG_00357"
FT   CDS_pept        complement(441470..441907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10365"
FT                   /old_locus_tag="TBFG_00357"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0360c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04708"
FT                   /protein_id="ABR04708.1"
FT                   /translation="MTKRTITPMTSMGDLLGPEPILLPGDSDAEAELLANESPSIVAAA
FT                   HPSASVAWAVLAEGALADDKTVTAYAYARTGYHRGLDQLRRHGWKGFGPVPYSHQPNRG
FT                   FLRCVAALARAAAAIGETDEYGRCLDLLDDCDPAARPALGL"
FT   gene            441990..442817
FT                   /locus_tag="TBFG_10366"
FT                   /old_locus_tag="TBFG_00358"
FT   CDS_pept        441990..442817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10366"
FT                   /old_locus_tag="TBFG_00358"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0361"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04709"
FT                   /protein_id="ABR04709.1"
FT                   /translation="MSNAPEPDRSAGESGSEPAGERSADPGEERTESYPLVPHDAETET
FT                   VVITTSDNDAAVTQPEAQRERRFTAPGFDAKETQVIVTAHEAATEVFQTNQAPTTPPRM
FT                   PTGMPPKTAVPQSIPPRTEATSVRQRTWGWALAVVVIVLALAAIAILGTVLLTRGKHSK
FT                   MSQEDQVRQAIQSLDIAIQTGDLTALRSLTCGSTRDGYVDYDERDWAETYRRVSAAKQY
FT                   PVIASIDQVVVNGAHAEANVTTFMAFDPQVRSTRSLDLQFRDDQWKICQSSSN"
FT   gene            443039..444421
FT                   /locus_tag="TBFG_10367"
FT                   /old_locus_tag="TBFG_00359"
FT   CDS_pept        443039..444421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10367"
FT                   /old_locus_tag="TBFG_00359"
FT                   /product="Mg2+ transport transmembrane protein mgtE"
FT                   /note="Mapped to H37Rv Rv0362"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04710"
FT                   /protein_id="ABR04710.1"
FT                   /translation="MSIRPAENSTLDIRHVIGIGTPKAVDLWLDVVTELPDRARELGSL
FT                   SKAELGKLGPLLDGTNAVELFESIDDKLAAEALHAMDPSLAATFLEALDSDHAANILRE
FT                   FKEPKREALLTLLPLERAMVLRGLLSWPEDCAAAHMVPETLTVRPNMTVSQAVASVRER
FT                   ASGLRSDARTTAYVYVTDADSHLLGVIAFRALVLANPEQRVRELMGDDLIVVSPLTDKE
FT                   LAAQTIMGHNLMAVPVVDADNRLLGIIAEDEAIDIAEEEATEDAERQGGSAPLEVPYLR
FT                   ASPWLLWRKRVVWLLVLFAAEAYTGSVLRAFSDEMEAVIALAFFIPLLIGTGGNTGTQI
FT                   ATTLVRAMATGQVRFRDVPAVLAKELSTGVLVGLTMAAAAVVRAWTLGVGPQVTLTVAL
FT                   TVAAIVVWSSLVAAVLPPLLKKLRIDPAIVSGPMIATIVDGTGLLIYFLVAHLTLTELH
FT                   GL"
FT   gene            complement(444433..445467)
FT                   /locus_tag="TBFG_10368"
FT                   /old_locus_tag="TBFG_00360"
FT   CDS_pept        complement(444433..445467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10368"
FT                   /old_locus_tag="TBFG_00360"
FT                   /product="fructose-bisphosphate aldolase fba"
FT                   /note="Mapped to H37Rv Rv0363c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04711"
FT                   /protein_id="ABR04711.1"
FT                   /translation="MPIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDS
FT                   YVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIG
FT                   VVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKL
FT                   RPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQY
FT                   AFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGK
FT                   SLTH"
FT   gene            445563..446246
FT                   /locus_tag="TBFG_10369"
FT                   /old_locus_tag="TBFG_00361"
FT   CDS_pept        445563..446246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10369"
FT                   /old_locus_tag="TBFG_00361"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0364"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04712"
FT                   /protein_id="ABR04712.1"
FT                   /translation="MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFP
FT                   LLPGESLLFTGGLLSASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDS
FT                   RFFKKHYVTESHAFFEKYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGV
FT                   AWGAGVTLAGYFLGSVPFVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDP
FT                   LVLPE"
FT   gene            complement(446235..447365)
FT                   /locus_tag="TBFG_10370"
FT                   /old_locus_tag="TBFG_00362"
FT   CDS_pept        complement(446235..447365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10370"
FT                   /old_locus_tag="TBFG_00362"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0365c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04713"
FT                   /protein_id="ABR04713.1"
FT                   /translation="MNLANRAASAETAVTQRHLRRLWALPGTQLAVVAWPSTRRDRLFG
FT                   SWHYWWQAHLLDCLVDAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAWLALA
FT                   LERADRVAGVRRRRALPKLTNQFVEAWVPEDGGGIPWRKQDQFFNAPANGPAGLFLARY
FT                   PDQYGKRLKRAEQMADWIDRTLIDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELA
FT                   VRTGPAARARHCARVHRLVAAVNEHMAPLGVLRGAGGGDGGLFAGITARYLALVATTLP
FT                   GDSADDAAARDTARAIVLASAQSAWDYRQTVDGLPVFGAFWDREAELPTAGGEQARSVR
FT                   GAVHSSAIAERDLSVQLSGWMLMEAAHSAAAVSSLG"
FT   gene            complement(447390..447983)
FT                   /locus_tag="TBFG_10371"
FT                   /old_locus_tag="TBFG_00363"
FT   CDS_pept        complement(447390..447983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10371"
FT                   /old_locus_tag="TBFG_00363"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0366c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04714"
FT                   /protein_id="ABR04714.1"
FT                   /translation="MKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPD
FT                   DPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVI
FT                   PEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDKSRLAGPRI
FT                   VAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA"
FT   gene            complement(448012..448401)
FT                   /locus_tag="TBFG_10372"
FT                   /old_locus_tag="TBFG_00364"
FT   CDS_pept        complement(448012..448401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10372"
FT                   /old_locus_tag="TBFG_00364"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0367c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04715"
FT                   /protein_id="ABR04715.1"
FT                   /translation="MPKAVDRVTRVAADLVDSAAAEGARQSRSAKQQLDHWARVGRAVS
FT                   NQHTASRRRVEAALAGHLPMTDLTLEEGVVFNAEISAAIEERLSRTNYGDVLAAQGITT
FT                   VALNDAGDIVEHRPDGTSVVLAATP"
FT   gene            complement(448482..449693)
FT                   /locus_tag="TBFG_10373"
FT                   /old_locus_tag="TBFG_00365"
FT   CDS_pept        complement(448482..449693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10373"
FT                   /old_locus_tag="TBFG_00365"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0368c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04716"
FT                   /protein_id="ABR04716.1"
FT                   /translation="MATPALLPGVDLAAFAAALAARLRDAGIPVSASGQASLVQALQQL
FT                   VPRTPAALYWGARLTLVSRVDELATFDAVFASLFGVFGSAEPDGANRPPPPIAGPRTPV
FT                   AGVGHRAKRRSCAAQAQNLPWDTRSLTMASAGQGGPSRTLPDVLPSRIVARADEPFDQF
FT                   DPDDLRLLGAWLEATMARWPRRRSMRFESSPHGKRIDLRATMNASRSTGWESVLLARIR
FT                   PRRRPRRVLLLCDVSRSMQPYAAIYLRLMRAAVLRRAGGHPEVFAFSTSLTRLTSVLSH
FT                   RSAEMALHRANARVTDRYGGTFIGRSVAALLAPPHGNALRGAVVIIASDGWDSDPPDVL
FT                   VHALTRVRRRAELLVWLNPRAAHPEFQPRAGSMAAALPYCDLFLPAHSLAGLHQLLLAL
FT                   AGAR"
FT   gene            complement(449699..450301)
FT                   /locus_tag="TBFG_10374"
FT                   /old_locus_tag="TBFG_00366"
FT   CDS_pept        complement(449699..450301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10374"
FT                   /old_locus_tag="TBFG_00366"
FT                   /product="hypothetical membrane oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0369c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04717"
FT                   /protein_id="ABR04717.1"
FT                   /translation="MKIANEFTVSAPIEQAWSRLCDLEQMIPLMPGAQLIGHEGDEYLG
FT                   KVKVKVGPVTSEFSGKVHFVEQDRNQHRAVFDAKGKEARGTGNAAATVAAQLHEVGERT
FT                   RVTVDTDLKIVGKLAQFGSGMLQQVSEKLLGQFVDSLEAELAAQSSESPQGTPPATEAA
FT                   PIDLLQLADGGQLKKYGSALLAALTVLLLIWVLRRRR"
FT   gene            complement(450315..451211)
FT                   /locus_tag="TBFG_10375"
FT                   /old_locus_tag="TBFG_00367"
FT   CDS_pept        complement(450315..451211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10375"
FT                   /old_locus_tag="TBFG_00367"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0370c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04718"
FT                   /protein_id="ABR04718.1"
FT                   /translation="MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPG
FT                   VGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDIS
FT                   EADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPEL
FT                   GTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPGPDRAAAIVRRTVPGATAPLIE
FT                   NATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDD
FT                   RTQIRDAYQAFTECSHA"
FT   gene            complement(451208..451801)
FT                   /locus_tag="TBFG_10376"
FT                   /old_locus_tag="TBFG_00368"
FT   CDS_pept        complement(451208..451801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10376"
FT                   /old_locus_tag="TBFG_00368"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0371c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10376"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04719"
FT                   /protein_id="ABR04719.1"
FT                   /translation="MTATQITGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAG
FT                   FDQLILTLGGAASAVRAAMALDGTDVVVVEDVERGCAASLRVALARVHPRATGIVLMLG
FT                   DQPQVAPATLRRIIDVGPATEIMVCRYADGVGHPFWFSRTVFGELARLHGDKGVWKLVH
FT                   SGRHPVRELAVDGCVPLDVDTWDDYRRLLESVPS"
FT   gene            complement(451798..452553)
FT                   /locus_tag="TBFG_10377"
FT                   /old_locus_tag="TBFG_00369"
FT   CDS_pept        complement(451798..452553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10377"
FT                   /old_locus_tag="TBFG_00369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0372c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04720"
FT                   /protein_id="ABR04720.1"
FT                   /translation="MSISDRAAQLVAARTPFVRATVVRAQQPTSARPGDEAILLADGTI
FT                   EGFVGGHCAQNSVRKAAMGVLQAGESVLLRVLPDGDVHFPEAPGACVVVNPCLAGGSLE
FT                   IFLTPQLPAPLIQIYGETPIADALIELCGLLGYDARRDTDPADTDALPTAIVIASHGGP
FT                   EAEIIRTALDNGVGYVGLVASTVRGASILDSLDLSDAERARVHTPVGLAIGAKTPAEIA
FT                   VSIAAELIATLRGGGPRGRKALADENGGA"
FT   gene            complement(452572..454971)
FT                   /locus_tag="TBFG_10378"
FT                   /old_locus_tag="TBFG_00370"
FT   CDS_pept        complement(452572..454971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10378"
FT                   /old_locus_tag="TBFG_00370"
FT                   /product="hypothetical carbon monoxyde dehydrogenase large
FT                   subunit"
FT                   /note="Mapped to H37Rv Rv0373c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04721"
FT                   /protein_id="ABR04721.1"
FT                   /translation="MTTIESRPPSPEDLADNAQQPCGHGRMMRKEDPRFIRGRGTYVDD
FT                   VALPGMLHLAILRSPYAHARIVRIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTLANDV
FT                   QAVLATDKTRFQGQEVAFVVAEDRYSARDACELVDVDYEPRDPVVDARTALDPSAPVIR
FT                   TDLEGKSDNHIFDWETGDAAATEAVFAKADVVVQQEIVYPRVHPAPMETCGAVADLDPV
FT                   TGKLTLWTTSQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVAS
FT                   LLLDKPVKWMEDRSENLTSTGFARDYIMVGEIAANRDGKILAIRSNVLADHGAFNAQAA
FT                   PAKYPAGFFGVFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCL
FT                   AFELKMDPAELRLRNLLRPNQFPYQSKTGWVYDSGDYETTMRKAMNMIGYEALRAEQKQ
FT                   RRARGELMGIGMSFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVLRLSVQTQGQ
FT                   GHETTFAQIVAEELGIAPDDIEVVHGDTDQTPFGLGTYGSRSTPVSGGAAALVARKVRD
FT                   KAKIIASGMLEVSVADLQWEKGKFHVKGDPSAAVTIADIAMRAHGAGDLPEGIEGGLDA
FT                   EVCYNPSNLTYPYGAYFCVVDIDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVD
FT                   GIGMALMEMIAFDEDGNCLGGSLMDYLIPTALEVPHLETGHTVTPSPHHPIGAKGIGES
FT                   ATVGSPPAVVNAVVDALAPFGVRHADMPLTPSRVWEAMQGRATPPI"
FT   gene            complement(454968..455447)
FT                   /locus_tag="TBFG_10379"
FT                   /old_locus_tag="TBFG_00371"
FT   CDS_pept        complement(454968..455447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10379"
FT                   /old_locus_tag="TBFG_00371"
FT                   /product="hypothetical carbon monoxyde dehydrogenase small
FT                   subunit"
FT                   /note="Mapped to H37Rv Rv0374c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04722"
FT                   /protein_id="ABR04722.1"
FT                   /translation="MQVNMTVNGEPVTAEVEPRMLLVHFLRDQLRLTGTHWGCDTSNCG
FT                   TCVVEVDGVPVKSCTMLAVMASGHSIRTVEGLAGPDGQLDPVQEGFMRCHGLQCGFCTP
FT                   GMLITARALLDRNPDPDEQTIREAISGQICRCTGYTTIVRSIQWAAAHQTVKAQS"
FT   gene            complement(455462..456364)
FT                   /locus_tag="TBFG_10380"
FT                   /old_locus_tag="TBFG_00372"
FT   CDS_pept        complement(455462..456364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10380"
FT                   /old_locus_tag="TBFG_00372"
FT                   /product="hypothetical carbon monoxyde dehydrogenase medium
FT                   subunit"
FT                   /note="Mapped to H37Rv Rv0375c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04723"
FT                   /protein_id="ABR04723.1"
FT                   /translation="MQVPGPFEYERATSVDHAIGLLDRLGEGARVVAGGHSLLPMMKLR
FT                   IANPEYLVDINDLAPELGYVVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAE
FT                   RVIADPVVRNRGTLGGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPY
FT                   ETALAHNEVLIEVRIPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTILAARVGLT
FT                   AVNPDPVALAELSAGLVGQPATEEVFAEAGRRAAQACTPVTDVRGTAEYKRHLAGELTV
FT                   RTLRTAAGRVLGAPAAPEA"
FT   gene            complement(456398..457540)
FT                   /locus_tag="TBFG_10381"
FT                   /old_locus_tag="TBFG_00373"
FT   CDS_pept        complement(456398..457540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10381"
FT                   /old_locus_tag="TBFG_00373"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0376c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04724"
FT                   /protein_id="ABR04724.1"
FT                   /translation="MAIWAAGDTAGVATVVRTLRSAPRPPGAAMVVAPDGSVSGSVSGG
FT                   CVEGAVYELAAEVAQTGIPRLEHYGVSDDTAFAVGLTCGGIIDVFVEPVSRATFPELGE
FT                   LADDIGAQRPVAIATVIAHPDERRVGRRLVIRPDTKSPVTGSLGSARADAAVIDDARGL
FT                   LAVGRSEILEYGPDGQRRGEGMEVFVSSHAPRPRTLVFGAIDFAAALARQGSFLGYRVT
FT                   VCDARAVFATPARFPTADDVVVAWPHRYLAAQAEAGGIDERTVICVLTHDPKFDVPVLE
FT                   VALRLGVGYVGAMGSRKTHDDRMDRLRAAGLTDAELSRLSSPIGLDLGARTPEETAVSI
FT                   AADIIARRWGGGGRPLADIAGRIHHDAQVAGEFKDYLTRH"
FT   gene            457589..458554
FT                   /locus_tag="TBFG_10382"
FT                   /old_locus_tag="TBFG_00374"
FT   CDS_pept        457589..458554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10382"
FT                   /old_locus_tag="TBFG_00374"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   lysR-family"
FT                   /note="Mapped to H37Rv Rv0377"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04725"
FT                   /protein_id="ABR04725.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAAELGLSDAGVSMHVAALRKELDD
FT                   PLFTRTGAGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAFAEHA
FT                   APGLIELFSSRADDLSVELSVHPTSRFRELICSRAVDIAIGPASESSIGSDGSIFLRPF
FT                   LKYQIITVVAPNSPLAAGIPMPALLRHQQWMLGPSAGSVDGEIATMLRGLAIPESQQRI
FT                   FQSDAAALEEVMRVGGATLAIGFAVAKDLAAGRLVHVTGPGLDRAGEWCVATLAPSARQ
FT                   PAVSELVGFISTPRCIQAMIPGSGVGVTRFRPKVHVTLWS"
FT   gene            458805..459026
FT                   /locus_tag="TBFG_10383"
FT                   /old_locus_tag="TBFG_00375"
FT   CDS_pept        458805..459026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10383"
FT                   /old_locus_tag="TBFG_00375"
FT                   /product="conserved glycine rich protein"
FT                   /note="Mapped to H37Rv Rv0378"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04726"
FT                   /protein_id="ABR04726.1"
FT                   /translation="MSGRWEAGNADGNGGSAGLIGSGGAGGDGGSGGATGAGGEGGDAG
FT                   ASGSINGNAGDPGNSGERGAVGKPGAPG"
FT   gene            459145..459360
FT                   /locus_tag="TBFG_10384"
FT                   /old_locus_tag="TBFG_00376"
FT   CDS_pept        459145..459360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10384"
FT                   /old_locus_tag="TBFG_00376"
FT                   /product="protein transport protein secE2"
FT                   /note="Mapped to H37Rv Rv0379"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04727"
FT                   /protein_id="ABR04727.1"
FT                   /translation="MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDM
FT                   AVDSAGKITYRIKLEVSFKMRPAQPR"
FT   gene            complement(459436..460098)
FT                   /locus_tag="TBFG_10385"
FT                   /old_locus_tag="TBFG_00377"
FT   CDS_pept        complement(459436..460098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10385"
FT                   /old_locus_tag="TBFG_00377"
FT                   /product="hypothetical RNA methyltransferase (RNA
FT                   methylase)"
FT                   /note="Mapped to H37Rv Rv0380c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04728"
FT                   /protein_id="ABR04728.1"
FT                   /translation="MDLAMSALGPGPTEWGAPTGGVGPWAGDLPDDPRYDPVLLRDGDA
FT                   RNVVDAYRYWTREAIIADIDTRRHPLHVAIENFGHDANIGSVVRTANAFAVHTVHIVGR
FT                   RRWNRRGAMVTDRYQRLCHHDSTTGLLEFAAGAGLTVVAVDNVPGAARLEQTALPRECL
FT                   LLFGQEGPGITDDARAGAAVTVSIAQFGSTRSINAGVAAGIAMHAWIRQHADLGRAW"
FT   gene            complement(460083..460991)
FT                   /locus_tag="TBFG_10386"
FT                   /old_locus_tag="TBFG_00378"
FT   CDS_pept        complement(460083..460991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10386"
FT                   /old_locus_tag="TBFG_00378"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0381c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04729"
FT                   /protein_id="ABR04729.1"
FT                   /translation="MRILVAWATCGAVVLSGLTGCSGSSHSGRTYGAQSARTGESLAVL
FT                   GWNMSVSNLRWSGDYVLIDVDASPTDPHAPHAKPEDIRFGLYGALAHPMESAALGSCGD
FT                   AMAHVRDVVSPLSAPAGRLTGTVCLGPLKERSAVRGVYTYSPRDRIPGTAAAYPAAFPV
FT                   GMLPTNQNDAGLVVKTTSVSAWRADGMQLGKPQLGDPVAFTGNGYMLLGLEVDAVPDRY
FT                   RDDSAARGGPMMLLAAPTLPGRGLSPACATYGSSVLILPDALLDAVHISASLCTQGEIN
FT                   EALLYATVATVGTHAALWTSR"
FT   gene            complement(461009..461548)
FT                   /locus_tag="TBFG_10387"
FT                   /old_locus_tag="TBFG_00379"
FT   CDS_pept        complement(461009..461548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10387"
FT                   /old_locus_tag="TBFG_00379"
FT                   /product="orotate phosphoribosyltransferase pyrE"
FT                   /note="Mapped to H37Rv Rv0382c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04730"
FT                   /protein_id="ABR04730.1"
FT                   /translation="MAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHR
FT                   ASALIGRLMRELTADWDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQR
FT                   LIEGSEVTGQRVLVVEDTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAE
FT                   GLRYRSVLGLADLGLD"
FT   gene            complement(461629..462483)
FT                   /locus_tag="TBFG_10388"
FT                   /old_locus_tag="TBFG_00380"
FT   CDS_pept        complement(461629..462483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10388"
FT                   /old_locus_tag="TBFG_00380"
FT                   /product="conserved secreted protein"
FT                   /note="Mapped to H37Rv Rv0383c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04731"
FT                   /protein_id="ABR04731.1"
FT                   /translation="MVPLWFTLSALCFVGAVVLLYVDIDRRRGRSRRRKSWARSHGFDY
FT                   ERESTEILKRWTRGVMSTVGDVAAHNVVLGQIRGEAVYIFDLEEVATVIALHRKVGTNV
FT                   VVDLRLKGLKEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQNWTLVSMPIASTRAQWDEGLRTVRQFNDLLRVLPPLPQEMPQQTGVGPRGAAPGRP
FT                   VAPGGPAELPPRRAQPDPATTVLPDPARRAPEPIRRDEGRSEGVRRPPPAGRNGQQATN
FT                   YQH"
FT   gene            complement(462624..465170)
FT                   /locus_tag="TBFG_10389"
FT                   /old_locus_tag="TBFG_00381"
FT   CDS_pept        complement(462624..465170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10389"
FT                   /old_locus_tag="TBFG_00381"
FT                   /product="endopeptidase ATP binding protein subunit B clpB"
FT                   /note="Mapped to H37Rv Rv0384c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04732"
FT                   /protein_id="ABR04732.1"
FT                   /translation="MDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATELDDE
FT                   YVSTEHVMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQK
FT                   YSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGEGAMDAGNMIKPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVG
FT                   EPSVEDTIGILRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAE
FT                   LTTRWQNEKNAIEIVRDLKEQLEALRGESERAERDGDLAKAAELRYGRIPEVEKKLDAA
FT                   LPQAQAREQVMLKEEVGPDDIADVVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQK
FT                   AAVTAVSDAVRRSRAGVSDPNRPTGAFMFLGPTGVGKTELAKALADFLFDDERAMVRID
FT                   MSEYGEKHTVARLIGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGHGRTVDFRNTILILTSNLGSGGSAEQVLAAVRATFKPEFINRLDDVLIF
FT                   EGLNPEELVRIVDIQLAQLGKRLAQRRLQLQVSLPAKRWLAQRGFDPVYGARPLRRLVQ
FT                   QAIGDQLAKMLLAGQVHDGDTVPVNVSPDADSLILG"
FT   gene            465198..466475
FT                   /locus_tag="TBFG_10390"
FT                   /old_locus_tag="TBFG_00382"
FT   CDS_pept        465198..466475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10390"
FT                   /old_locus_tag="TBFG_00382"
FT                   /product="hypothetical monooxygenase"
FT                   /note="Mapped to H37Rv Rv0385"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04733"
FT                   /protein_id="ABR04733.1"
FT                   /translation="MLVGLFNAVNVESVPLNFTHLCIRRRFAASLESRSVGLEDRDALR
FT                   VLQNAFKLDDPELVRRFYAHWFALDASVRDLFPPDMGAQRAAFGQALHWVYGELVAQRA
FT                   EEPVAFLAQLGRDHRKYGVLPTQYDTLRRALYTTLRDYLGHPSRGAWTDAVDEAAGQSL
FT                   NLIIGVMSGAADADDAPAWWDGTVVEHIRVSRDLAVARLQLDRPLHYYPGQYVNVHVPQ
FT                   CPRRWRYLSPAIPADPNGRIEFHVRVVPGGLVSNAIVGETRPGDRWRLSGPHGAFRVDR
FT                   DGGDVLMVAGSTGLAPLRALIIDLSRFAVNPRVHLFFGARYACELYDLPTLWQIAAHNP
FT                   WLSVSPVSEYNGDPAWAADYPDVSAPRGLHVRQTGRLPDVVSRYGGWGDRQILICGGPA
FT                   MVRATKAALIAKGAPPERIQHDPLSR"
FT   gene            466579..469836
FT                   /locus_tag="TBFG_10391"
FT                   /old_locus_tag="TBFG_00383"
FT   CDS_pept        466579..469836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10391"
FT                   /old_locus_tag="TBFG_00383"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   luxR/uhpA-family"
FT                   /note="Mapped to H37Rv Rv0386"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04734"
FT                   /protein_id="ABR04734.1"
FT                   /translation="MSKLLPRGTVTLLLADVEGSTWLWETHPDDMGAAVARLDKAVSGV
FT                   IAAHDGVRPVEQGEGDSFVLAFACASDAVAAALDLQRARLAPIRLRIGVHTGEVALRDE
FT                   GNYAGPTINRTARLRDLAHGGQTVLSGVTESLVIDRLPDKAWLVDLGTHALRDLSRPER
FT                   VMQLCHPELRIDFPPLRVANDDVAHGLPVHLTRFVGRGAQITEVHRLVTDNRLVTLTGA
FT                   GGVGKTRLAAQLAAQIAGEFGRAWFVDLAPITDPDLVPVTVAGALGLHDQPGRSTTDTV
FT                   LRFLGGRPALVVLDNCEHLLDATAALVLALVKACRGVRLLATCREPLRVEGEVSYRVPS
FT                   LSLSDEAVEMFCYRAQRVRPDFRLTDDNSAAVTEICKRLDGLPLAIELAAARLRSMTLD
FT                   EIIDGLRDRFALLTGGARTAAHRQQTLWASVDWSYTLLTEPERTLFRRLAVFVGCFFVD
FT                   DAQAVACSGDVQRYQVLDEITLLVDKSLVMADDNSGRTCYRLCETMRHYALEKLSEAGE
FT                   VDAVFARHRDYYTALAARVDNPGPSDYSHCLDQAETEIDNLRAAFVWNRENSDTEGALA
FT                   LASSLLRVWMTRGRIQEGRAWFDSILADENARHLEVAAAVRARALADKALLDIFVDAAA
FT                   GMEQAQQALVIAREVDEPALLSRALTACGLIAVAVARADAAASYFAEAIDLARAVDDRW
FT                   RLAQILTFQAVDAVVAGDPVAARPAAQEARELAAAIGDHSNALWCRWCLGYAQLMRGEL
FT                   AAAAAQFGEVVDEAEASQEVLHKANSLQGLAFALAYQGELSAARAAADAALEAAELGEY
FT                   FAGMGYSALTTAALAAGDVQTAQHASEAAWRNLSLALPLSAAVQRAFNAQAALAGGDLS
FT                   AARRWCDDAVQSMTGHHLAMALATCARIAVAEGKREEAERDAHKALACAAESGAHLDLP
FT                   DVLECLAGLASDAGTHHAAARLFGAAEAIRQQIGSVRFAIYRSDYVQSVTALRDAMGEK
FT                   DFDAAWAEGAALSIKETIAYAQRGHSWRKRPATGWESLTPTEIDVVRLVGEGLANKDIA
FT                   TRLFVSPRTVQTHLTHVYTKLGFTSRLQLAQAAARRT"
FT   gene            complement(469840..471171)
FT                   /locus_tag="TBFG_10392"
FT                   /old_locus_tag="TBFG_00384"
FT   CDS_pept        complement(469840..471171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10392"
FT                   /old_locus_tag="TBFG_00384"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0386"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04735"
FT                   /protein_id="ABR04735.1"
FT                   /translation="MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASY
FT                   SSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAAT
FT                   VPPTVIAANRRTMLSLVKTNVFGQNTPAIATSEAQYGEMWAQDIVAMEGYAGASAAASQ
FT                   LPPFTPPPATTSGAGSLSDAAATAAQAVVPAAAATDVSLLPTLQSFLPPPFDAIPNPIE
FT                   DLDVLVAAAVAVAAGSLGVSAAQLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDL
FT                   PEVGGRVTSPPQPPVAALTGYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSS
FT                   DGSYAGLAAAGLAGTGLAGLAARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAA
FT                   AAGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ"
FT   gene            471505..472764
FT                   /locus_tag="TBFG_10393"
FT                   /old_locus_tag="TBFG_00385"
FT   CDS_pept        471505..472764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10393"
FT                   /old_locus_tag="TBFG_00385"
FT                   /product="phosphoribosylglycinamide formyltransferase 2
FT                   purT"
FT                   /note="Mapped to H37Rv Rv0389"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04736"
FT                   /protein_id="ABR04736.1"
FT                   /translation="MIDGWTEEQHEPTVRHERPAAPQDVRRVMLLGSAEPSRELAIALQ
FT                   GLGAEVIAVDGYVGAPAHRIADQSVVVTMTDAEELTAVIRRLQPDFLVTVTAAVSVDAL
FT                   DAVEQADGECTELVPNARAVRCTADREGLRRLAADQLGLPTAPFWFVGSLGELQAVAVH
FT                   AGFPLLVSPVAGVAGQGSSVVAGPNEVEPAWQRAAGHQVQPQTGGVSPRVCAESVVEIE
FT                   FLVTMIVVCSQGPNGPLIEFCAPIGHRDADAGELESWQPQKLSTAALDAAKSIAARIVK
FT                   ALGGRGVFGVELMINGDEVYFADVTVCPAGSAWVTVRSQRLSVFELQARAILGLAVDTL
FT                   MISPGAARVINPDHTAGRAAVGAAPPADALTGALGVPESDVVIFGRGLGVALATAPEVA
FT                   IARERAREVASRLNVPDSRE"
FT   gene            472761..473183
FT                   /locus_tag="TBFG_10394"
FT                   /old_locus_tag="TBFG_00386"
FT   CDS_pept        472761..473183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10394"
FT                   /old_locus_tag="TBFG_00386"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0390"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04737"
FT                   /protein_id="ABR04737.1"
FT                   /translation="MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLG
FT                   REVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAG
FT                   ITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG"
FT   gene            473180..474400
FT                   /locus_tag="TBFG_10395"
FT                   /old_locus_tag="TBFG_00387"
FT   CDS_pept        473180..474400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10395"
FT                   /old_locus_tag="TBFG_00387"
FT                   /product="O-succinylhomoserine sulfhydrylase metZ"
FT                   /note="Mapped to H37Rv Rv0391"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04738"
FT                   /protein_id="ABR04738.1"
FT                   /translation="MTDESSVRTPKALPDGVSQATVGVRGGMLRSGFEETAEAMYLTSG
FT                   YVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLRLIEGAPAAFATASGMAAVFTS
FT                   LGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPTQAVF
FT                   FETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHID
FT                   GQGRVLGGAILGDREYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQ
FT                   RIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVL
FT                   DKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIA
FT                   DIDRALS"
FT   gene            complement(474397..475809)
FT                   /locus_tag="TBFG_10396"
FT                   /old_locus_tag="TBFG_00388"
FT   CDS_pept        complement(474397..475809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10396"
FT                   /old_locus_tag="TBFG_00388"
FT                   /product="membrane NADH dehydrogenase ndhA"
FT                   /note="Mapped to H37Rv Rv0392c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04739"
FT                   /protein_id="ABR04739.1"
FT                   /translation="MTLSSGEPSAVGGRHRVVIIGSGFGGLNAAKALKRADVDITLISK
FT                   TTTHLFQPLLYQVATGILSEGDIAPTTRLILRRQKNVRVLLGEVNAIDLKAQTVTSKLM
FT                   DMTTVTPYDSLIVAAGAQQSYFGNDEFATFAPGMKTIDDALELRGRILGAFEAAEVSTD
FT                   HAERERRLTFVVVGAGPTGVEVAGQIVELAERTLAGAFRTITPSECRVILLDAAPAVLP
FT                   PMGPKLGLKAQRRLEKMDVEVQLNAMVTAVDYKGITIKEKDGGERRIECACKVWAAGVA
FT                   ASPLGKMIAEGSDGTEIDRAGRVIVEPDLTVKGHPNVFVVGDLMFVPGVPGVAQGAIQG
FT                   ARYATTVIKHMVKGNDDPANRKPFHYFNKGSMATISRHSAVAQVGKLEFAGYFAWLAWL
FT                   VLHLVYLVGYRNRIAALFAWGISFMGRARGQMAITSQMIYARLVMTLMEQQAQGALAAA
FT                   EQAEHAEQEAAG"
FT   gene            475951..477276
FT                   /locus_tag="TBFG_10397"
FT                   /old_locus_tag="TBFG_00389"
FT   CDS_pept        475951..477276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10397"
FT                   /old_locus_tag="TBFG_00389"
FT                   /product="13E12 repeat family protein"
FT                   /note="Mapped to H37Rv Rv0393"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04740"
FT                   /protein_id="ABR04740.1"
FT                   /translation="MAVGRCAIPRFDQAASGSAINGGQVHLSDGSTSPARQLPAPWPGD
FT                   AGAAAEGRAGVCCRGNRLPHVSDVGVSHRFDHRPAGVGAGGCRAGAAGAGLAVDDPGQL
FT                   AAAIDRIVAVADPDAVRQVRERARDREVSIWNSADGMGEVYAQLYATDAQALDARLNAL
FT                   VATVCAGDPRSTDQRRADALGALAAGADRLACRCDNPDCAAEGRPVSAVVIHVVAEQAS
FT                   VKGHGQAPAALLGGDGLIPAELVAELAKTAGLQPIPVPAGTEPGYRPSVKLAAFVRARD
FT                   LTCRAPGCDRPATQCDLDHTIAFADGGATHAANLKCLCRLHHLLATFCGWRAQQLPDGT
FT                   VIWTLPGNQTYVTTPGSALLFPALCTPTGDPPAPEPARADRRGQRTAMMPRRASTRTQN
FT                   RAHCIAAERHRNHQARRIAQAAVIATETHGPPPDPDDDPPPF"
FT   gene            complement(477292..478011)
FT                   /locus_tag="TBFG_10398"
FT                   /old_locus_tag="TBFG_00390"
FT   CDS_pept        complement(477292..478011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10398"
FT                   /old_locus_tag="TBFG_00390"
FT                   /product="hypothetical secreted protein"
FT                   /note="Mapped to H37Rv Rv0394c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04741"
FT                   /protein_id="ABR04741.1"
FT                   /translation="MTEPRPVFAVVISAGLSAIPMVGGPLQTVFDAIEERTRHRAETTT
FT                   REICESVGGADTVLSRIDKNPELEPLLSQAIEAATRTSMEAKRRLLAQAAAAALEDDQK
FT                   VEPASLIVATLSQLEPVHIHALVRLAKAAKSSPDQDEIQRREVMRAASKVEPVPVLAAL
FT                   IQTGVAIATTTVWHGNGTGTPAEESGHILIHDVSDFGHRLLAYLRAADAGAELLILPSG
FT                   GSAPTGDHPTPHPSTSR"
FT   gene            478110..478514
FT                   /locus_tag="TBFG_10399"
FT                   /old_locus_tag="TBFG_00391"
FT   CDS_pept        478110..478514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10399"
FT                   /old_locus_tag="TBFG_00391"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0395"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04742"
FT                   /protein_id="ABR04742.1"
FT                   /translation="MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVL
FT                   DEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSAFCVVIDKGTSFPSRLRNPDKGFPN
FT                   VALLRLRDMAPSEHGSRCSSARGRLCLSMS"
FT   gene            478520..478912
FT                   /locus_tag="TBFG_10400"
FT                   /old_locus_tag="TBFG_00392"
FT   CDS_pept        478520..478912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10400"
FT                   /old_locus_tag="TBFG_00392"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0396"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04743"
FT                   /protein_id="ABR04743.1"
FT                   /translation="MRALGWLREDRKPLLNAKLLVLGHLALNVYDPDNGYGEEVLDFEP
FT                   RTVWWGSANWTVRAGSHLEVGFACDDPTLVEEATAFVADVIAFSEPIDTTCAGPEPNLV
FT                   QVEFDDAAMAEAMEEMAEPDDDGEDW"
FT   gene            478986..479354
FT                   /locus_tag="TBFG_10401"
FT                   /old_locus_tag="TBFG_00393"
FT   CDS_pept        478986..479354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10401"
FT                   /old_locus_tag="TBFG_00393"
FT                   /product="13E12 repeat family protein"
FT                   /note="Mapped to H37Rv Rv0397"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04744"
FT                   /protein_id="ABR04744.1"
FT                   /translation="MLATFWGWRAQQLPDGTVIWTLPGDQTYVTTPGSALLFPALCTPT
FT                   GDPPRPDPARADRRGQRTAMMPRRASTRAQNRAHYIAAERHRNHQARRIAHVVTQTATT
FT                   APETNGPPPDPDDDPPPF"
FT   gene            479564..479812
FT                   /locus_tag="TBFG_10402"
FT                   /old_locus_tag="TBFG_00394"
FT   CDS_pept        479564..479812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10402"
FT                   /old_locus_tag="TBFG_00394"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0397"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04745"
FT                   /protein_id="ABR04745.1"
FT                   /translation="MHALRLVGLAILTAIAPIAVLIGSSPAHADTDIGQPCSPEGAKLW
FT                   GNPGPIYCERTADGQLQWVSIPAWALCVAFCDRPGGP"
FT   gene            complement(479849..480490)
FT                   /locus_tag="TBFG_10403"
FT                   /old_locus_tag="TBFG_00395"
FT   CDS_pept        complement(479849..480490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10403"
FT                   /old_locus_tag="TBFG_00395"
FT                   /product="hypothetical secreted protein"
FT                   /note="Mapped to H37Rv Rv0398c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04746"
FT                   /protein_id="ABR04746.1"
FT                   /translation="MGVIARVVGVAACGLSLAVLAAAPTAGAEPTGALPPMTSSGSGPV
FT                   IGDGDAALRQRISQQLFSFGDPTVQEVDGSDAAQFITAAAAVADRDVASVFLPLQRVLG
FT                   CQQNTAGSGAGFGARAYRRTDGQWGGAMLVVAKSTVSDVDALKACVKSGWRKATAGTPT
FT                   SMCNNGWTYPPFADTRRGEEGYFVLLAGTASDFCSAPNANYRTTASSWPG"
FT   gene            complement(480497..481726)
FT                   /locus_tag="TBFG_10404"
FT                   /old_locus_tag="TBFG_00396"
FT   CDS_pept        complement(480497..481726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10404"
FT                   /old_locus_tag="TBFG_00396"
FT                   /product="lipoprotein lpqK"
FT                   /note="Mapped to H37Rv Rv0399c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04747"
FT                   /protein_id="ABR04747.1"
FT                   /translation="MPVLRRLGCSVLALGLLAGCAPPRTGPASSPTNNGAKADAVIRIV
FT                   RDFMTQAHLKAVLVRVTVAGKEVVTRAVGDSMTGVPATTAMHFRNGAVAISYVATLLLK
FT                   LVDEKKLRLDDKLSRWLPDFPHADRVTLGQLAQMTSGYPDYVLGNEAFDAELYANPFRQ
FT                   WTTQELLDQISSRPLLYDPGTNWNYAHTNYLLLGLALEKAAGQDMPTLLQRKVLSPLGL
FT                   TATANSDTPAIPEPALHAFTSERRAALKIPAGVPFYEESTFWNPSWTITHGAIQTTTIY
FT                   DMEATAVGIGSGRLLSADSYKKMVSTELRGKTRAQPGCPTCFEQNDGYSYGLGIVISGH
FT                   WLLQNPMFAGYAAVEAYLPSQRVAVAVAVTYAPEAFDDQGNYRNQADILFRKIGAEVAP
FT                   NDAPPMPPGR"
FT   gene            complement(481736..482923)
FT                   /locus_tag="TBFG_10405"
FT                   /old_locus_tag="TBFG_00397"
FT   CDS_pept        complement(481736..482923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10405"
FT                   /old_locus_tag="TBFG_00397"
FT                   /product="acyl-CoA dehydrogenase fadE7"
FT                   /note="Mapped to H37Rv Rv0400c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04748"
FT                   /protein_id="ABR04748.1"
FT                   /translation="MSTPTPPALDRDDPLGLDASLSSDEIAVRDTVRRFCAEHVTPHVA
FT                   AWFEDGDLPVARDLAKQFGELGLLGMQLHGHGCGGASAVHYGLACRELEAADSGIRSLV
FT                   SVQGSLAMFAIASFGSDEQKRQWLPGMATGDLLGCFGLTEPDVGSDPAAMKTRARRDGP
FT                   DWVITGGKMWITNGSVADVAIVWAATDDGIRGFIVPTDTPGFTANTIGHKLSLRASITS
FT                   ELVLDNVRLPADAMLPGATGLRAPLACLSEARYGIVWGAMGAARSAWQCALDYARQRTQ
FT                   FGRPIAGFQLTQAKLVDMAVELHKGQLLSLHLGRLKDRVGLRPDQVSFGKLNNTREALK
FT                   ICRTARTILGGNGISLEYPVIRHMVNLESVLTYEGTPEMHQLVLGQAFTGLAAFR"
FT   gene            482959..483330
FT                   /locus_tag="TBFG_10406"
FT                   /old_locus_tag="TBFG_00398"
FT   CDS_pept        482959..483330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10406"
FT                   /old_locus_tag="TBFG_00398"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0401"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04749"
FT                   /protein_id="ABR04749.1"
FT                   /translation="MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFL
FT                   TGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAV
FT                   LLLGWRAAVALMAPHRADG"
FT   gene            complement(483525..486401)
FT                   /locus_tag="TBFG_10407"
FT                   /old_locus_tag="TBFG_00399"
FT   CDS_pept        complement(483525..486401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10407"
FT                   /old_locus_tag="TBFG_00399"
FT                   /product="transmembrane transport protein mmpL1"
FT                   /note="Mapped to H37Rv Rv0402c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04750"
FT                   /protein_id="ABR04750.1"
FT                   /translation="MRSQRLAGHLSAAARTIHALSLPIILFWVALTIVVNVVAPQLQSV
FT                   ARTHSVALGPHDAPSLIAMKRIGKDFQQFDSDTTAMVLLEGQEKLGDEAHRFYDVLVTK
FT                   LSQDTTHVQHIENFWGDPLTAAGSQSADGKAAYVQLNLTGDQGGSQANESVAAVQRIVD
FT                   SVPPPPGIKAYVTGPGPLGADRVVYGDRSLHTITGISIAVIAIMLFIAYRSLSAALIML
FT                   LTVGLELLAVRGIISTFAVNDLMGLSTFTVNVLVALTIAASTDYIIFLVGRYQEARATG
FT                   QNREAAYYTMFGGTAHVVLASGLTVAGAMYCLGFTRLPYFNTLASPCAIGLVTVMLASL
FT                   TLAPAIIAVASRFGLFDPKRATTKRRWRRIGTVVVRWPGPVLAATLLIALIGLLALPKY
FT                   QTNYNERYYIPSAAPSNIGYLASDRHFPQARMEPEVLMVEADHDLRNPTDMLILDRIAK
FT                   TVFHTPGIARVQSITRPLGAPIDHSSIPFQLGMQSTMTIENLQNLKDRVADLSTLTDQL
FT                   QRMIDITQRTQELTRQLTDATHDMNAHTRQMRDNANELRDRIADFDDFWRPLRSFTYWE
FT                   RHCFDIPICWSMRSLLNSMDNVDKLTEDLANLTDDTERMDTTQRQLLAQLDPTIATMQT
FT                   VKDLAQTLTSAFSGLVTQMEDMTRNATVMGRTFDAANNDDSFYLPPEAFQNPDFQRGLK
FT                   LFLSPDGTCARFVITHRGDPASAEGISHIDPIMQAADEAVKGTPLQAASIYLAGTSSTY
FT                   KDIHEGTLYDVMIAVVASLCLIFIIMLGITRSVVASAVIVGTVALSLGSAFGLSVLIWQ
FT                   HILHMPLHWLVLPMAIIVMLAVGSDYNLLLIARFQEEIGAGLKTGMIRAMAGTGRVVTI
FT                   AGLVFAFTMGSMVASDLRVVGQIGTTIMIGLLFDTLVVRSYMTPALATLLGRWFWWPRR
FT                   VDRLARQPQVLGPRRTTALSAERAALLQ"
FT   gene            complement(486398..486826)
FT                   /locus_tag="TBFG_10408"
FT                   /old_locus_tag="TBFG_00400"
FT   CDS_pept        complement(486398..486826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10408"
FT                   /old_locus_tag="TBFG_00400"
FT                   /product="membrane protein mmpS1"
FT                   /note="Mapped to H37Rv Rv0403c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04751"
FT                   /protein_id="ABR04751.1"
FT                   /translation="MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLD
FT                   PIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVV
FT                   ARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA"
FT   gene            487147..488904
FT                   /locus_tag="TBFG_10409"
FT                   /old_locus_tag="TBFG_00401"
FT   CDS_pept        487147..488904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10409"
FT                   /old_locus_tag="TBFG_00401"
FT                   /product="fatty-acid-CoA ligase fadD30"
FT                   /note="Mapped to H37Rv Rv0404"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04752"
FT                   /protein_id="ABR04752.1"
FT                   /translation="MSVISTLRDRATTTPSDEAFVFMDYDTKTGDQIDRMTWSQLYSRV
FT                   TAVSAYLISYGRHADRRRTAAISAPQGLDYVAGFLGALCAGWTPVPLPEPLGSLRDKRT
FT                   GLAVLDCAADVVLTTSQAETRVRATIATHGASVTTPVIALDTLDEPSGDNCDLDSQLSD
FT                   WSSYLQYTSGSTANPRGVVLSMRNVTENVDQIIRNYFRHEGGAPRLPSSVVSWLPLYHD
FT                   MGLMVGLFIPLFVGCPVILTSPEAFIRKPARWMQLLAKHQAPFSAAPNFAFDLAVAKTS
FT                   EEDMAGLDLGHVNTIINGAEQVQPNTITKFLRRFRPYNLMPAAVKPSYGMAEAVVYLAT
FT                   TKAGSPPTSTEFDADSLARGHAELSTFETERATRLIRYHSDDKEPLLRIVDPDSNIELG
FT                   PGRIGEIWIHGKNVSTGYHNADDALNRDKFQASIREASAGTPRSPWLRTGDLGFIVGDE
FT                   FYIVGRMKDLIIQDGVNHYPDDIETTVKEFTGGRVAAFSVSDDGVEHLVIAAEVRTEHG
FT                   PDKVTIMDFSTIKRLVVSALSKLHGLHVTDFLLVPPGALPKTTSGKISRAACAKQYGAN
FT                   KLQRVATFP"
FT   gene            488901..493109
FT                   /locus_tag="TBFG_10410"
FT                   /old_locus_tag="TBFG_00402"
FT   CDS_pept        488901..493109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10410"
FT                   /old_locus_tag="TBFG_00402"
FT                   /product="membrane bound polyketide synthase pks6"
FT                   /note="Mapped to H37Rv Rv0405"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04753"
FT                   /protein_id="ABR04753.1"
FT                   /translation="MTDGSVTADKLQKWFREYLSTHIECHPNEVSLDVPIRDLGLKSID
FT                   VLAIPGDLGDRFGFCIPDLAVWDNPSANDLIDSLLNQRSADSLRESHGHADRNTQGRGS
FT                   INEPVAVIGVGCRFPGDIDGPERLWDFLTEKKCAITAYPDRGFTNAGTFAESGGFLKDV
FT                   AGFDNRFFDIPPDEALRMDPQQRLLLEVSWEALEHAGIIPESLRLSRTGVFVGVSSTDY
FT                   VRLVSASAQQKSTIWDNTGGSSSIIANRISYFLDIQGPSIVIDTACSSSLVAVHLACRS
FT                   LSTWDCDIALVGGTNVLISPEPWGGFREAGILSQTGCCHAFDKSADGMVRGEGCGVIVL
FT                   QRLSDARLEGRRILAILTGSAVNQDGKSNGIMAPNPSAQIGVLENACKSARVDPLEIGY
FT                   VEAHGTGTSLGDRIEAHALGMVFGRKRPGSGPLMIGSIKPNIGHLEGAAGIAGLIKAVL
FT                   MVERGSLLPSGGFTEPNPAIPFTELGLRVVDELQEWPVVAGRPRRAGVSSFGFGGTNAH
FT                   VIVEEAGSVGADTVSGRADVGGSGGGVVAWVISGKTASALAAQAGRLGRYVRARPALDV
FT                   VDVGYSLVSTRSVFDHRAVVVGQTRDELLAGLAGVVAGRPEAGVVCGVGKPAGKTAFVF
FT                   AGQGSQWLGMGSELYAAYPVFAEALDAVVDELDRHLRYPLRDVIWGHDQDLLNTTEFAQ
FT                   PALFAVEVALYRLLMSWGVRPGLVLGHSVGELAAAHVAGALCLPDAAMLVAARGRLMQA
FT                   LPAGGAMFAVQAREDEVAPMLGHDVSIAAVNGPASVVISGAHDAVSAIADRLRGQGRRV
FT                   HRLAVSHAFHSALMEPMIAEFTAVAAELSVGLPTIPVISNVTGQLVADDFASADYWARH
FT                   IRAVVRFGDSVRSAHCAGASRFIEVGPGGGLTSLIEASLADAQIVSVPTLRKDRPEPVS
FT                   VMTAAAQGFVSGMGLDWASVFSGYRPKRVELPTYAFQHQKFWLAPAPSVSDPTAAGQIG
FT                   ASDGGAELLASSGFAARLAGRSADEQLAAAIEVVCEHAAAVLGRDGAAGLDAGQAFADS
FT                   GFNSLSAVELRNRLTAVTAVTLPATAIFDHPTPTELAQYLITQIDGHGSSAAAAANPAE
FT                   RIDALTDLFLQACDAGRDADGWKMVALASNTRERMSSPVRNNVSKNVALLADGISDVVV
FT                   ICIPTLTVLSDQREYRDIANAMTGRHSVYSLTLPGFDSSDALPQNADMIVETVSNAIID
FT                   VVGGSCRFVLSGYSSGGVLAYALCSHLSVKHQRNPLGVALIDTYLPSQIANPSMNEGFS
FT                   PNDTGKGLSREVIRVARMLNRLTATRLTAAATYAAIFQAWEPGRSMAPVLNIVAKDRIA
FT                   TVENLREERINRWRTAAAEAAYSVAEVPGDHFGMMSTSSEAIATEIHDWISGLVRGPHP
FT                   "
FT   gene            complement(493057..493875)
FT                   /locus_tag="TBFG_10411"
FT                   /old_locus_tag="TBFG_00403"
FT   CDS_pept        complement(493057..493875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10411"
FT                   /old_locus_tag="TBFG_00403"
FT                   /product="beta lactamase like protein"
FT                   /note="Mapped to H37Rv Rv0406c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04754"
FT                   /protein_id="ABR04754.1"
FT                   /translation="MVATRGTRLAALALAPRLAGMAELVQITDKVHLARGHAVNWVLVT
FT                   DDTGVLLIDAGYPGDRAEVLASLNKLGYTPGDVRAIVLTHAHIDHLGSAIWFAREHSTP
FT                   VYCHAEEVGHAKREYRENASVFDVALRSWRPRVAVWGIHLLRRGGLTGDGIPTAQPLTA
FT                   EAAAGLPGQPMAIFTPGHTSGHCSYVVDGVLASGDALITGHPMLRHRGPQLLPAVFSHS
FT                   QQNSIRSLAALALLETNILAPGHGELWHGPIRKATDEALERAQKSNHVFR"
FT   gene            493953..494963
FT                   /locus_tag="TBFG_10412"
FT                   /old_locus_tag="TBFG_00404"
FT   CDS_pept        493953..494963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10412"
FT                   /old_locus_tag="TBFG_00404"
FT                   /product="F420-dependent glucose-6-phosphate dehydrogenase
FT                   fgd1"
FT                   /note="Mapped to H37Rv Rv0407"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04755"
FT                   /protein_id="ABR04755.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWR
FT                   HQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLG
FT                   VGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIY
FT                   DVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSV
FT                   DGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIA
FT                   KRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRRLG"
FT   gene            494956..497028
FT                   /locus_tag="TBFG_10413"
FT                   /old_locus_tag="TBFG_00405"
FT   CDS_pept        494956..497028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10413"
FT                   /old_locus_tag="TBFG_00405"
FT                   /product="phosphate acetyltransferase pta"
FT                   /note="Mapped to H37Rv Rv0408"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04756"
FT                   /protein_id="ABR04756.1"
FT                   /translation="MADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRL
FT                   SAERDYILELLLAHTSAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECDAVVV
FT                   VGSDYTDVTSPTELSVNGRIAVNLGAPVLLTVRAKDRTPDQVASVVEVCLAELDTQRAH
FT                   TAAVVANRCELSAIPAVTDALRRFTPPSYVVPEEPLLSAPTVAELTQAVNGAVVSGDVA
FT                   LREREVMGVLAAGMTADHVLERLTDGMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVL
FT                   NGGFQLHPAIAALVSGLRLRLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELM
FT                   DRHVDVAGLLAQLTIPIPTVTTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLL
FT                   QRGIVDLTILGDEAKVRLRAAELGVDLDGATVIEPCASELHDQFADQYAQLRKAKGITV
FT                   EHAREIMNDATYFGTMLVHNCHADGMVSGAAHTTAHTVRPALEIIKTVPGISTVSSIFL
FT                   MCLPDRVLAYGDCAIIPNPTVEQLADIAICSARTAAQFGIEPRVAMLSYSTGDSGKGAD
FT                   VDKVRAATELVRAREPQLPVEGPIQYDAAVEPSVAATKLRDSPVAGRATVLIFPDLNTG
FT                   NNTYKAVQRSAGAIAIGPVLQGLRKPVNDLSRGALVDDIVNTVAITAIQAQGVHE"
FT   gene            497021..498178
FT                   /locus_tag="TBFG_10414"
FT                   /old_locus_tag="TBFG_00406"
FT   CDS_pept        497021..498178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10414"
FT                   /old_locus_tag="TBFG_00406"
FT                   /product="acetate kinase ackA (acetokinase)"
FT                   /note="Mapped to H37Rv Rv0409"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04757"
FT                   /protein_id="ABR04757.1"
FT                   /translation="MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVAD
FT                   HAQALHRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALA
FT                   PLHNPPAVLGIKVARRLLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGF
FT                   HGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVM
FT                   GTRSGDLDPGVISYLWRTARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSA
FT                   QLAYEVFIHRLRKYLGAYLAVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQD
FT                   RNLGPGHGARRISSDDSPIAVLVVPTNEELAIARDCLRVLGGRRA"
FT   gene            complement(498232..500484)
FT                   /locus_tag="TBFG_10415"
FT                   /old_locus_tag="TBFG_00407"
FT   CDS_pept        complement(498232..500484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10415"
FT                   /old_locus_tag="TBFG_00407"
FT                   /product="serine/threonine-protein kinase pknG"
FT                   /note="Mapped to H37Rv Rv0410c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04758"
FT                   /protein_id="ABR04758.1"
FT                   /translation="MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDN
FT                   FPHPTLGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKR
FT                   FCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLG
FT                   WIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDR
FT                   HGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPEN
FT                   IMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL
FT                   DLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREV
FT                   VAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLV
FT                   DPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGD
FT                   VAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLAL
FT                   AATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRH
FT                   FTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLK
FT                   DNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF"
FT   gene            complement(500484..501470)
FT                   /locus_tag="TBFG_10416"
FT                   /old_locus_tag="TBFG_00408"
FT   CDS_pept        complement(500484..501470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10416"
FT                   /old_locus_tag="TBFG_00408"
FT                   /product="glutamine-binding lipoprotein glnH"
FT                   /note="Mapped to H37Rv Rv0411c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10416"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04759"
FT                   /protein_id="ABR04759.1"
FT                   /translation="MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTP
FT                   VGMEIMPPQPPLPPDSSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNL
FT                   FSFRDPITGEITGFDVDIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTM
FT                   SITCERRKLVNFSTVYLDANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAP
FT                   PPVIVSVVNWADCLVALQQREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGIN
FT                   LDNTGLVRFVNGTLERIRNDGTWNTLYRKWLTVLGPAPAPPTPRYVD"
FT   gene            complement(501470..502789)
FT                   /locus_tag="TBFG_10417"
FT                   /old_locus_tag="TBFG_00409"
FT   CDS_pept        complement(501470..502789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10417"
FT                   /old_locus_tag="TBFG_00409"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0412c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04760"
FT                   /protein_id="ABR04760.1"
FT                   /translation="MTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAA
FT                   LGVASAFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPG
FT                   GVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNP
FT                   VGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAF
FT                   AHRWLARRTRRRINPGLVVGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNL
FT                   AITAQQARADETLSLIRRGDEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQ
FT                   LLVRWRQANDRINSYISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLR
FT                   HDILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR"
FT   gene            502883..503536
FT                   /locus_tag="TBFG_10418"
FT                   /old_locus_tag="TBFG_00410"
FT   CDS_pept        502883..503536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10418"
FT                   /old_locus_tag="TBFG_00410"
FT                   /product="mutator protein mutT3"
FT                   /note="Mapped to H37Rv Rv0413"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04761"
FT                   /protein_id="ABR04761.1"
FT                   /translation="MPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPD
FT                   GTPAVLLQHRALWSHQGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVV
FT                   TAEVCGVDDTHWTYTTVVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQR
FT                   LRTAPATVPLARCDERRQRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL"
FT   gene            complement(503520..504188)
FT                   /locus_tag="TBFG_10419"
FT                   /old_locus_tag="TBFG_00411"
FT   CDS_pept        complement(503520..504188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10419"
FT                   /old_locus_tag="TBFG_00411"
FT                   /product="thiamine-phosphate pyrophosphorylase thiE"
FT                   /note="Mapped to H37Rv Rv0414c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04762"
FT                   /protein_id="ABR04762.1"
FT                   /translation="MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKG
FT                   SPGELRFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPV
FT                   NVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVA
FT                   AELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
FT                   "
FT   gene            504318..505340
FT                   /locus_tag="TBFG_10420"
FT                   /old_locus_tag="TBFG_00412"
FT   CDS_pept        504318..505340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10420"
FT                   /old_locus_tag="TBFG_00412"
FT                   /product="thiamine biosynthesis oxidoreductase thiO"
FT                   /note="Mapped to H37Rv Rv0415"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04763"
FT                   /protein_id="ABR04763.1"
FT                   /translation="MASDLHTGSLAVIGGGVIGLSVARRAAQAGWPVRVHRSDERGASW
FT                   VAGGMLAPHSEGWPGEERLLRLGLQSLRLWREGSFLDGLGPQLVTAHESLVVAVDRADV
FT                   ADLRTVADWLSAQGHPVIWESAARDVEPLLAQGIRHGFRAPTELAVDNRALLDALCRDC
FT                   ERLGVRWSSQVSSLSDVDAHTVVIANGIDAPALWPGLPIRPVKGEVLRLRWRPGCMPLP
FT                   QRVIRARVRGRQVYLVPRSDGVVVGATQYEHGRDTAPVVSGVRDLLDDACTVLPALGEY
FT                   ELAECEAGLRPMTPDNLPLVQRLDSRTLVAAGHGRSGFLLAPWTAEQIVSELVSVGAAS
FT                   "
FT   gene            505337..505543
FT                   /locus_tag="TBFG_10421"
FT                   /old_locus_tag="TBFG_00413"
FT   CDS_pept        505337..505543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10421"
FT                   /old_locus_tag="TBFG_00413"
FT                   /product="hypothetical protein thiS"
FT                   /note="Mapped to H37Rv Rv0416"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04764"
FT                   /protein_id="ABR04764.1"
FT                   /translation="MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSD
FT                   WATKICELRKPVRLEVVTAVQGG"
FT   gene            505536..506294
FT                   /locus_tag="TBFG_10422"
FT                   /old_locus_tag="TBFG_00414"
FT   CDS_pept        505536..506294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10422"
FT                   /old_locus_tag="TBFG_00414"
FT                   /product="thiamin biosynthesis protein thiG"
FT                   /note="Mapped to H37Rv Rv0417"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04765"
FT                   /protein_id="ABR04765.1"
FT                   /translation="MAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVA
FT                   IRRVDADGGTGLLDLLNRLGITPLPNTAGCRSAAEAVLTAQLAREALNTNWVKLEVIAD
FT                   ERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLG
FT                   IANPHNIEMIVAGARVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAA
FT                   MAAAVTAGYLARCAGRIPKRFWAQASSPAR"
FT   gene            506666..508168
FT                   /locus_tag="TBFG_10423"
FT                   /old_locus_tag="TBFG_00415"
FT   CDS_pept        506666..508168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10423"
FT                   /old_locus_tag="TBFG_00415"
FT                   /product="lipoprotein aminopeptidase lpqL"
FT                   /note="Mapped to H37Rv Rv0418"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04766"
FT                   /protein_id="ABR04766.1"
FT                   /translation="MVNKSRMMPAVLAVAVVVAFLTTGCIRWSTQSRPVVNGPAAAEFA
FT                   VALRNRVSTDAMMAHLSKLQDIANANDGTRAVGTPGYQASVDYVVNTLRNSGFDVQTPE
FT                   FSARVFKAEKGVVTLGGNTVEARALEYSLGTPPDGVTGPLVAAPADDSPGCSPSDYDRL
FT                   PVSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNIDEQAMGGTLGANTDVKIPVVSV
FT                   TKSVGFQLRGQSGPTTVKLTASTQSFKARNVIAQTKTGSSANVVMAGAHLDSVPEGPGI
FT                   NDNGSGVAAVLETAVQLGNSPHVSNAVRFAFWGAEEFGLIGSRNYVESLDIDALKGIAL
FT                   YLNFDMLASPNPGYFTYDGDQSLPLDARGQPVVPEGSAGIERTFVAYLKMAGKTAQDTS
FT                   FDGRSDYDGFTLAGIPSGGLFSGAEVKKSAEQAELWGGTADEPFDPNYHQKTDTLDHID
FT                   RTALGINGAGVAYAVGLYAQDLGGPNGVPVMADRTRHLIAKP"
FT   gene            508256..509752
FT                   /locus_tag="TBFG_10424"
FT                   /old_locus_tag="TBFG_00416"
FT   CDS_pept        508256..509752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10424"
FT                   /old_locus_tag="TBFG_00416"
FT                   /product="lipoprotein peptidase lpqM"
FT                   /note="Mapped to H37Rv Rv0419"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10424"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04767"
FT                   /protein_id="ABR04767.1"
FT                   /translation="MHGRGRYRPLVRCVRPRRVAASVRTPIACLAAVVVIAGCTTVVDG
FT                   RALSILNDPFRVGGLPATNGPSGARPDAPAASGTVINTNNGAIDKLSLLSVNDIEDYWM
FT                   AVYSESLKGTFRPVGKLVSYDSNDPSSPIVCHIDTYQLVNAFFSSRCNLIAWDRGVFMA
FT                   VAQEYFGDMSVNGVLAHEFGHALQVMANLVTRKDPTIVREQQADCFAGVYLWWVAEGKS
FT                   TRFTLSTADGLDHVLAGIITTRDPVMEADAENDDEHGSALDRVSAFQLGFINGTPACAA
FT                   IDEDEVERRRGDLPTALRVDASGNPETGEVGINEETLSTLMELMGKIFSPKNPPTLSYQ
FT                   PAGCPDAKPSPPAAYCPATNTIVVDLPALARMGKVASAAEHSLPQGDDTSLSIVMSRYA
FT                   LAVQHERGLPMQSPWTALRTACLTGVAHRKMAVPIDLPSGQQLVLTAGDLDEAVSGLLT
FT                   NRMVASDADGVSVPAGFTRIAAFRAGVGGDMDACYARYPG"
FT   gene            complement(509731..510141)
FT                   /locus_tag="TBFG_10425"
FT                   /old_locus_tag="TBFG_00417"
FT   CDS_pept        complement(509731..510141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10425"
FT                   /old_locus_tag="TBFG_00417"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0420c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04768"
FT                   /protein_id="ABR04768.1"
FT                   /translation="MRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMA
FT                   LWFPVYLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRAWAIP
FT                   SVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA"
FT   gene            complement(510302..510931)
FT                   /locus_tag="TBFG_10426"
FT                   /old_locus_tag="TBFG_00418"
FT   CDS_pept        complement(510302..510931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10426"
FT                   /old_locus_tag="TBFG_00418"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0421c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04769"
FT                   /protein_id="ABR04769.1"
FT                   /translation="MNLDQIAGVAHQPAGPPHGVVVLTHGAGGSRESTLLQQVCAEWTR
FT                   RGWLAVRYNLPYRRRRPTGPPSGSGSGDRAGIVEAIQLCRGLAEGPLIAGGHSYGGRQT
FT                   SMVVAAGQAPVDVLTLFSYPVHPPGKPERVRTEHLPGIAVPTVFTHGTADPFGTLAQVR
FT                   SAAAMVSAPTEVVEITGARHDLGSKTLDVARLAVDAALRLSAGQIA"
FT   gene            complement(510928..511725)
FT                   /locus_tag="TBFG_10427"
FT                   /old_locus_tag="TBFG_00419"
FT   CDS_pept        complement(510928..511725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10427"
FT                   /old_locus_tag="TBFG_00419"
FT                   /product="phosphomethylpyrimidine kinase thiD"
FT                   /note="Mapped to H37Rv Rv0422c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04770"
FT                   /protein_id="ABR04770.1"
FT                   /translation="MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQN
FT                   TLGVKDIHEVPNDVVAGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELSVPLV
FT                   VDPVCASMHGDPLLAPSALDSLRGQLFPLATLLTPNLDEARLLVDIEVVDAESQRAAAK
FT                   ALHALGPQWVLVKGGHLRSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGGGDTLATAIAA
FT                   ALAHGFTVPDAVDFGKRWVTECLRAAYPLGRGHGPVSPLFRLS"
FT   gene            complement(511752..513395)
FT                   /locus_tag="TBFG_10428"
FT                   /old_locus_tag="TBFG_00420"
FT   CDS_pept        complement(511752..513395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10428"
FT                   /old_locus_tag="TBFG_00420"
FT                   /product="thiamine biosynthesis protein thiC"
FT                   /note="Mapped to H37Rv Rv0423c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04771"
FT                   /protein_id="ABR04771.1"
FT                   /translation="MTITVEPSVTTGPIAGSAKAYREIEAPGSGATLQVPFRRVHLSTG
FT                   DHFDLYDTSGPYTDTDTVIDLTAGLPHRPGVVRDRGTQLQRARAGEITAEMAFIAARED
FT                   MSAELVRDEVARGRAVIPANHHHPESEPMIIGKAFAVKVNANIGNSAVTSSIAEEVDKM
FT                   VWATRWGADTIMDLSTGKNIHETREWILRNSPVPVGTVPIYQALEKVKGDPTELTWEIY
FT                   RDTVIEQCEQGVDYMTVHAGVLLRYVPLTAKRVTGIVSRGGSIMAAWCLAHHRESFLYT
FT                   NFEELCDIFARYDVTFSLGDGLRPGSIADANDAAQFAELRTLGELTKIAKAHGAQVMIE
FT                   GPGHIPMHKIVENVRLEEELCEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAM
FT                   LCYVTPKEHLGLPDRKDVKDGVIAYKIAAHAADLAKGHPRAQERDDALSTARFEFRWND
FT                   QFALSLDPDTAREFHDETLPAEPAKTAHFCSMCGPKFCSMRITQDVREYAAEHGLETEA
FT                   DIEAVLAAGMAEKSREFAEHGNRVYLPITQ"
FT   gene            complement(513547..513822)
FT                   /locus_tag="TBFG_10429"
FT                   /old_locus_tag="TBFG_00421"
FT   CDS_pept        complement(513547..513822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10429"
FT                   /old_locus_tag="TBFG_00421"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0424c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04772"
FT                   /protein_id="ABR04772.1"
FT                   /translation="MAEKNTRRATSQREAVAKIREAETIVMNLPICGQVKIPRPEHLAY
FT                   YGGLAALAALELIDWPVALVIATGHILANNHHNRVLEELGEAMEEA"
FT   gene            complement(513872..518491)
FT                   /locus_tag="TBFG_10430"
FT                   /old_locus_tag="TBFG_00422"
FT   CDS_pept        complement(513872..518491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10430"
FT                   /old_locus_tag="TBFG_00422"
FT                   /product="metal cation transporter P-type ATPase ctpH"
FT                   /note="Mapped to H37Rv Rv0425c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04773"
FT                   /protein_id="ABR04773.1"
FT                   /translation="MPVRAVATGFRATATLTGASITAATAVSATLAKTGVGTGMKVAII
FT                   PLRAGAKALSGELSRETLGRTCWRGERRAWIEVRGLRSGGDDELGRVVLNAIQAHPGVG
FT                   SASLNYPLSRVVVAIDDPDTSLRELCRIVDDAEKAERHRHPDQAADQLAQSPGSLPGDG
FT                   VLLAVRAVTVAATAAGLGLALGGRALRWPRFPLVIEAAVAAVDHQPLLRRLLEDRIGTE
FT                   ATATVLELAMAAAHTVTLSPAALSVDLTIQALKAAECRAGARAWRRHEPQLALHADEPA
FT                   DQPQSLWPRPARSTQPVQRSVARFALIQALSAVLVGAGTRDADMAATATLVATPKASRT
FT                   TPEAFAAALGQGLADQHAVLPLRPESLRRLDRVDAIVIDPRVLCTDDLRVARIRGCGAD
FT                   ELSTAWNRAQLVLTESGLRPGWHRVPGVSASGSDSAVEALFRPMHDRLASAVVAEAHRT
FT                   GADLVSVDVDALGELRPVFDDIRPLDDGASGSLDEALARAVAELRQAGRTVAVLSSVGK
FT                   QALSAADVALGVLPPPGAGAPPWYADVLLPDLGAAWRVLHAIPAARAARQRGNEISGGA
FT                   SALGALLMLPGVRGLGPGPVTTGAAAGLLSGYLLARKVVDAQAPRPAPAHEWHAMSVEQ
FT                   VRKALPSPDEQAPAKAPPSPYPARALAGGLHTAKRGAQITQAPLNALWQLTKAVRAELS
FT                   DPLTPMLALGAMASAVLGSPVDAVMVGSVLTGNSILAASQRLRAESRLNRLLAQQIPPA
FT                   RKVLAGADDQPRYIEVRAEELRPGDIIEVRTHEVVPADARVIEEVDVEVDESALTGESL
FT                   SVTKQVEPTPGVDLIERRCMLYAGTTVVSGTAVAVVTAVGPDTQERRAAELVSGDLSSV
FT                   GLQHQLSRLTNQAWPVSMTGGALVTGLGLLRRRGLRQAVASGIAVTVAAVPEGMPLVAT
FT                   LAQQASARRLSHFGALVRIPRSVEALGRVDMVCFDKTGTLSENRLRVAQVRPVAGHSRE
FT                   EVLRCAAHAAPASNGPQVHATDVAIVQAAAAAAASGTDGAEPGAAEPAAHLPFRSGRSF
FT                   SASVSGTELTVKGAPEVVLAACEGIGSSMDDAVAELAANGLRVIAVAHRQLTAQQAQSV
FT                   VDDPDEIARLCRDELSLVGFLGLSDTPRAQAAALLADLHEHDLDIRLITGDHPITAAAI
FT                   AEELGMQVSPEQVISGAEWDALSRKDQERAVAERVIFARMTPENKVQIVQTLEHSGRVC
FT                   AMVGDGSNDAAAIRAATVGIGVVAHGSDPARVAADLVLVDGRIESLLPAILEGRQLWQR
FT                   VQAAVSVLLGGNAGEVAFAIIGSAITGTSPLNTRQLLLVNMLTDALPAAALAVSKPSDP
FT                   VTPATRGPDQRELWRAVGIRGATTAAAATVAWVMAGFTGLPRRASTVALVALVAAQLGQ
FT                   TLVDSHAWLVVLTALGSLAALATLISIPVVSQLLGCTPLDPLGWAQATAAATAATVAVA
FT                   VLNRVLTGRDKSGQPNPQPPETDALSRDASPGAPPGPRRRRRATARRKAPVKAPSATRQ
FT                   TTKPKGPPAHRSSSTYPRR"
FT   gene            complement(518543..519118)
FT                   /locus_tag="TBFG_10431"
FT                   /old_locus_tag="TBFG_00423"
FT   CDS_pept        complement(518543..519118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10431"
FT                   /old_locus_tag="TBFG_00423"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0426c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04774"
FT                   /protein_id="ABR04774.1"
FT                   /translation="MAGLHFESAEQKSRQRCECRVRVNECRTVAKPFVNECSLGQGVIM
FT                   SVVGGTVRTVGRTVSGAATATTAAAGAVGGAAVSGIVGGVTGAAKGIQKGLSSGSKSTA
FT                   AAALAIGAIGVAGLVDWPILLAVGGGALLLRKLNRTPEVAAPPVKAKLAPVPDKPAAAK
FT                   EAPAKASKTTARKTSGRRAGTAELRSTN"
FT   gene            complement(519187..520062)
FT                   /locus_tag="TBFG_10432"
FT                   /old_locus_tag="TBFG_00424"
FT   CDS_pept        complement(519187..520062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10432"
FT                   /old_locus_tag="TBFG_00424"
FT                   /product="exodeoxyribonuclease III protein xthA
FT                   (exonuclease III)"
FT                   /note="Mapped to H37Rv Rv0427c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04775"
FT                   /protein_id="ABR04775.1"
FT                   /translation="MPDGTIDGGHPQRPASPRLRSPLLRLATWNVNSIRTRLDRVLDWL
FT                   GRADVDVLAMQETKCPDGQFPALPLFELGYDVAHVGFDQWNGVAIASRVGLDDVRVGFD
FT                   GQPSWSGKPEVAATTEARALGATCGGIRVWSLYVPNGRALDDPHYTYKLDWLAALRDTA
FT                   EGWLRDDPAAPIALMGDWNIAPTDDDVWSTEFFAGCTHVSEPERKAFNAIVDAQFTDVV
FT                   RPFTPGPGVYTYWDYTQLRFPKKQGMRIDFILGSPALAARVMDAQIVREERKGKAPSDH
FT                   APVLVDLHAG"
FT   gene            complement(520065..520973)
FT                   /locus_tag="TBFG_10433"
FT                   /old_locus_tag="TBFG_00425"
FT   CDS_pept        complement(520065..520973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10433"
FT                   /old_locus_tag="TBFG_00425"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0428c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04776"
FT                   /protein_id="ABR04776.1"
FT                   /translation="MVSWPGLGTRVTVRYRRPAGSMPPLTDAVGRLLAVDPTVRVQTKT
FT                   GTIVEFSPVDVVALRVLTDAPVRTAAIRALEHAAAAAWPGVERTWLDGWLLRAGHGAVL
FT                   AANSAVPLDISAHTNTITEISAWYASRDLQPWLAVPDRLLPLPADLAGERREQVLVRDV
FT                   STGEPDRSVTLLDHPDDTWLRLYHQRLPLDMATPVIDGELAFGSYLGVAVARAAVTDAP
FT                   DGTRWVGLSAMRAADEQSATGSAGRQLWEALLGWGAGRGATRGYVRVHDTATSVLAESL
FT                   GFRLHHHCRYLPAQSVGWDTF"
FT   gene            complement(520973..521566)
FT                   /locus_tag="TBFG_10434"
FT                   /old_locus_tag="TBFG_00426"
FT   CDS_pept        complement(520973..521566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10434"
FT                   /old_locus_tag="TBFG_00426"
FT                   /product="polypeptide deformylase def (formylmethionine
FT                   deformylase)"
FT                   /note="Mapped to H37Rv Rv0429c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04777"
FT                   /protein_id="ABR04777.1"
FT                   /translation="MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMD
FT                   AANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDE
FT                   GCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH"
FT   gene            521903..522211
FT                   /locus_tag="TBFG_10435"
FT                   /old_locus_tag="TBFG_00427"
FT   CDS_pept        521903..522211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10435"
FT                   /old_locus_tag="TBFG_00427"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0430"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10435"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04778"
FT                   /protein_id="ABR04778.1"
FT                   /translation="MDSAMARAIRSGDDAEVADGLTRREHDILAFERQWWKFAGVKEEA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
FT   gene            522243..522737
FT                   /locus_tag="TBFG_10436"
FT                   /old_locus_tag="TBFG_00428"
FT   CDS_pept        522243..522737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10436"
FT                   /old_locus_tag="TBFG_00428"
FT                   /product="hypothetical tuberculin related peptide"
FT                   /note="Mapped to H37Rv Rv0431"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04779"
FT                   /protein_id="ABR04779.1"
FT                   /translation="MLVTVGSMNERVPDSSGLPLRAMVMVLLFLGVVFLLLVWQALGSS
FT                   PNSEDDSSAISTMTTTTAAPTSTSVKPAAPRAEVRVYNISGTEGAAARTADRLKAAGFT
FT                   VTDVGNLSLPDVAATTVYYTEVEGERATADAVGRTLGAAVELRLPELSDQPPGVIVVVT
FT                   G"
FT   gene            522770..523492
FT                   /locus_tag="TBFG_10437"
FT                   /old_locus_tag="TBFG_00429"
FT   CDS_pept        522770..523492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10437"
FT                   /old_locus_tag="TBFG_00429"
FT                   /product="periplasmic superoxide dismutase [Cu-Zn] sodC"
FT                   /note="Mapped to H37Rv Rv0432"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04780"
FT                   /protein_id="ABR04780.1"
FT                   /translation="MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGT
FT                   TPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTG
FT                   VGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQ
FT                   VRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETT
FT                   LTTGDAGKRVACGVIGSG"
FT   gene            523494..524624
FT                   /locus_tag="TBFG_10438"
FT                   /old_locus_tag="TBFG_00430"
FT   CDS_pept        523494..524624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10438"
FT                   /old_locus_tag="TBFG_00430"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0433"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04781"
FT                   /protein_id="ABR04781.1"
FT                   /translation="MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVIA
FT                   EIGENPRVHKELLRNTVEIVSGICECTAEAMQDLRDTLGPARQIVRDRGMELFCAGTHP
FT                   FARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGIRSAHKVMPIMTSLLNYYPH
FT                   LLALSASSPWWGGEDTGYASNRAMMFQQLPTAGLPFHFQRWAEFEGFVYDQKKTGIIDH
FT                   MDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALTHCLIVDLDRRLDAGETLPTMP
FT                   PWHVQENKWRAARYGLDAVIILDADSNERLVTDDLADVLTRLEPVAKSLNCADELAAVS
FT                   DIYRDGASYQRQLRVAQQHDGDLRAVVDALVAELVI"
FT   gene            524684..525337
FT                   /locus_tag="TBFG_10439"
FT                   /old_locus_tag="TBFG_00431"
FT   CDS_pept        524684..525337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10439"
FT                   /old_locus_tag="TBFG_00431"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0434"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04782"
FT                   /protein_id="ABR04782.1"
FT                   /translation="MADFAPVELAMFPLESAPLPDEDLPLHIFEPRYAALVRDCMDTAD
FT                   PRFGVVLISRGREVGGGDTRCDVGTLARITECADAGSGRYMLRCRVGERIRVCDWLPDD
FT                   PYPRAKVRFWPDQPGHPVTAAQLLEVEDRVVALFERIAAARGVRLPAREVVLGYPVVDP
FT                   ADTGQRLYALACRVPMGPADRYAVLATPSAADRLVRLGDALDSVAAMVEFELST"
FT   gene            complement(525517..527703)
FT                   /locus_tag="TBFG_10440"
FT                   /old_locus_tag="TBFG_00432"
FT   CDS_pept        complement(525517..527703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10440"
FT                   /old_locus_tag="TBFG_00432"
FT                   /product="ATPase"
FT                   /note="Mapped to H37Rv Rv0435c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04783"
FT                   /protein_id="ABR04783.1"
FT                   /translation="MTHPDPARQLTLTARLNTSAVDSRRGVVRLHPNAIAALGIREWDA
FT                   VSLTGSRTTAAVAGLAAADTAVGTVLLDDVTLSNAGLREGTEVIVSPVTVYGARSVTLS
FT                   GSTLATQSVPPVTLRQALLGKVMTVGDAVSLLPRDLGPGTSTSAASRALAAAVGISWTS
FT                   ELLTVTGVDPDGPVSVQPNSLVTWGAGVPAAMGTSTAGQVSISSPEIQIEELKGAQPQA
FT                   AKLTEWLKLALDEPHLLQTLGAGTNLGVLVSGPAGVGKATLVRAVCDGRRLVTLDGPEI
FT                   GALAAGDRVKAVASAVQAVRHEGGVLLITDADALLPAAAEPVASLILSELRTAVATAGV
FT                   VLIATSARPDQLDARLRSPELCDRELGLPLPDAATRKSLLEALLNPVPTGDLNLDEIAS
FT                   RTPGFVVADLAALVREAALRAASRASADGRPPMLHQDDLLGALTVIRPLSRSASDEVTV
FT                   GDVTLDDVGDMAAAKQALTEAVLWPLQHPDTFARLGVEPPRGVLLYGPPGCGKTFVVRA
FT                   LASTGQLSVHAVKGSELMDKWVGSSEKAVRELFRRARDSAPSLVFLDELDALAPRRGQS
FT                   FDSGVSDRVVAALLTELDGIDPLRDVVMLGATNRPDLIDPALLRPGRLERLVFVEPPDA
FT                   AARREILRTAGKSIPLSSDVDLDEVAAGLDGYSAADCVALLREAALTAMRRSIDAANVT
FT                   AADLATARETVRASLDPLQVASLRKFGTKGDLRS"
FT   gene            complement(527700..528560)
FT                   /locus_tag="TBFG_10441"
FT                   /old_locus_tag="TBFG_00433"
FT   CDS_pept        complement(527700..528560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10441"
FT                   /old_locus_tag="TBFG_00433"
FT                   /product="CDP-diacylglycerol-serine
FT                   o-phosphatidyltransferase pssA"
FT                   /note="Mapped to H37Rv Rv0436c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04784"
FT                   /protein_id="ABR04784.1"
FT                   /translation="MIGKPRGRRGVNLQILPSAMTVLSICAGLTAIKFALEHQPKAAMA
FT                   LIAAAAILDGLDGRVARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWPVGWV
FT                   VVLLYAVCVVLRLARYNALQDDGTQPAYAHEFFVGMPAPAGAVSMIGLLALKMQFGEGW
FT                   WTSGWFLSFWVTGTSILLVSGIPMKKMHAVSVPPNYAAALLAVLAICAAAAVLAPYLLI
FT                   WVIIIAYMCHIPFAVRSQRWLAQHPEVWDDKPKQRRAVRRASRRAHPYRPSMARLGLRK
FT                   PGRRL"
FT   gene            complement(528557..529252)
FT                   /locus_tag="TBFG_10442"
FT                   /old_locus_tag="TBFG_00434"
FT   CDS_pept        complement(528557..529252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10442"
FT                   /old_locus_tag="TBFG_00434"
FT                   /product="phosphatidylserine decarboxylase psd"
FT                   /note="Mapped to H37Rv Rv0437c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04785"
FT                   /protein_id="ABR04785.1"
FT                   /translation="MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRY
FT                   RWLRGTGLLAAAACAGFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPL
FT                   PRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAE
FT                   VVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVA
FT                   GETVLAECR"
FT   gene            complement(529313..530530)
FT                   /locus_tag="TBFG_10443"
FT                   /old_locus_tag="TBFG_00435"
FT   CDS_pept        complement(529313..530530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10443"
FT                   /old_locus_tag="TBFG_00435"
FT                   /product="molybdopterin biosynthesis protein moeA2"
FT                   /note="Mapped to H37Rv Rv0438c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04786"
FT                   /protein_id="ABR04786.1"
FT                   /translation="MRSVQEHQRVVAEMMRACRPITVPLTQAQGLVLGGDVVAPLSLPV
FT                   FDNSAMDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPT
FT                   GATAIVPVEATDGGVDSVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAA
FT                   ALGLAELPVLPRQRVLVISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATA
FT                   TAGDDVAQFGAILDRYAVDADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVA
FT                   MQPGMPQGVGRVAGTPIVTLPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTA
FT                   SLTSPRGKRQFRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQL
FT                   QVWDLT"
FT   gene            complement(530549..531484)
FT                   /locus_tag="TBFG_10444"
FT                   /old_locus_tag="TBFG_00436"
FT   CDS_pept        complement(530549..531484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10444"
FT                   /old_locus_tag="TBFG_00436"
FT                   /product="hypothetical dehydrogenase/reductase"
FT                   /note="Mapped to H37Rv Rv0439c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04787"
FT                   /protein_id="ABR04787.1"
FT                   /translation="MTANDNKTRKWSAADVPDQSGRVVVVTGANTGIGYHTAAVFADRG
FT                   AHVVLAVRNLEKGNAARARIMAARPGAHVTLQQLDLCSLDSVRAAADALRTAYPRIDVL
FT                   INNAGVMWTPKQVTKDGFELQFGTNHLGHFALTGLVLDHMLPVPGSRVVTVSSQGHRIH
FT                   AAIHFDDLQWERRYNRVAAYGQAKLANLLFTYELQRRLGEAGKSTIAVAAHPGGSNTEL
FT                   TRNLPRLIRPVATVLGPLLFQSPEMGALPTLRAATDPTTQGGQYYGPDGFGEQRGHPKV
FT                   VQSSAQSHDKDLQRRLWTVSEELTGVSFGV"
FT   gene            531778..533400
FT                   /locus_tag="TBFG_10445"
FT                   /old_locus_tag="TBFG_00437"
FT   CDS_pept        531778..533400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10445"
FT                   /old_locus_tag="TBFG_00437"
FT                   /product="60 kda chaperonin 2 groEL2"
FT                   /note="Mapped to H37Rv Rv0440"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04788"
FT                   /protein_id="ABR04788.1"
FT                   /translation="MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEA
FT                   MDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVS
FT                   SKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAI
FT                   AGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQIAFNSGLE
FT                   PGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNAASIAGLFLTTEAV
FT                   VADKPEKEKASVPGGGDMGGMDF"
FT   gene            complement(533466..533852)
FT                   /locus_tag="TBFG_10446"
FT                   /old_locus_tag="TBFG_00438"
FT   CDS_pept        complement(533466..533852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10446"
FT                   /old_locus_tag="TBFG_00438"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0441c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04789"
FT                   /protein_id="ABR04789.1"
FT                   /translation="MPDYPFAYLITVDDGHRVHTVAVEPVLRELPDGPDGPRAVVDVGL
FT                   IGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDDTARCGVVPIRALLH
FT                   RDAAPDSPTAAKGCLHDCVVFSVP"
FT   gene            complement(533920..535383)
FT                   /locus_tag="TBFG_10447"
FT                   /old_locus_tag="TBFG_00439"
FT   CDS_pept        complement(533920..535383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10447"
FT                   /old_locus_tag="TBFG_00439"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0442c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04790"
FT                   /protein_id="ABR04790.1"
FT                   /translation="MTSPHFAWLPPEINSALMFAGPGSGPLIAAATAWGELAEELLASI
FT                   ASLGSVTSELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAFEAAL
FT                   AATVQPAVVAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALDVAAMAGYHFDASA
FT                   AVAQLAPWQQVLRNLGIDIGKNGQINLGFGNTGSGNIGNNNIGNNNIGSGNTGTGNIGS
FT                   GNTGSGNLGLGNLGDGNIGFGNTGSGNIGFGITGDHQMGFGGFNSGSGNIGFGNSGTGN
FT                   VGLFNSGSGNIGIGNSGSLNSGIGTSGTINAGLGSAGSLNTSFWNAGMQNAALGSAAGS
FT                   EAALVSSAGYATGGMSTAALSSGILASALGSTGGLQHGLANVLNSGLTNTPVAAPASAP
FT                   VGGLDSGNPNPGSGSAAAGSGANPGLRSPGTSYPSFVNSGSNDSGLRNTAVREPSTPGS
FT                   GIPKSNFYPSPDRESAYASPRIGQPVGSE"
FT   gene            535565..536080
FT                   /locus_tag="TBFG_10448"
FT                   /old_locus_tag="TBFG_00440"
FT   CDS_pept        535565..536080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10448"
FT                   /old_locus_tag="TBFG_00440"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0443"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10448"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04791"
FT                   /protein_id="ABR04791.1"
FT                   /translation="MASTDAAAQELLRDAFTRLIEHVDELTDGLTDQLACYRPTPSANS
FT                   IAWLLWHSARVQDIQVAHVAGVEEVWTRDGWVDRFGLDLPRHDTGYGHRPEDVAKVRAP
FT                   ADLLSGYYHAVHKLTLEYIAGMTADELSRVVDTSWNPPVTVSARLVSIVDDCAQHLGQA
FT                   AYLRGIAR"
FT   gene            complement(536260..536958)
FT                   /locus_tag="TBFG_10449"
FT                   /old_locus_tag="TBFG_00441"
FT   CDS_pept        complement(536260..536958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10449"
FT                   /old_locus_tag="TBFG_00441"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0444c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04792"
FT                   /protein_id="ABR04792.1"
FT                   /translation="MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFN
FT                   DEVRAVRETMAVVSAATTAEPPAHLRTAILDATKPEVRRQSRWRTAAFASAAAIAVGLG
FT                   AFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNVAPP
FT                   SRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPT
FT                   GTILAELPLG"
FT   gene            complement(537002..537565)
FT                   /locus_tag="TBFG_10450"
FT                   /old_locus_tag="TBFG_00442"
FT   CDS_pept        complement(537002..537565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10450"
FT                   /old_locus_tag="TBFG_00442"
FT                   /product="alternative RNA polymerase sigma factor sigK"
FT                   /note="Mapped to H37Rv Rv0445c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04793"
FT                   /protein_id="ABR04793.1"
FT                   /translation="MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVL
FT                   RDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVR
FT                   YGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLA
FT                   ANLSTIKSRMRDALRSLRNCLDVS"
FT   gene            complement(537614..537802)
FT                   /locus_tag="TBFG_10451"
FT                   /old_locus_tag="TBFG_00443"
FT   CDS_pept        complement(537614..537802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10451"
FT                   /old_locus_tag="TBFG_00443"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0446c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04794"
FT                   /protein_id="ABR04794.1"
FT                   /translation="MITINDWAPLATVGSPLLMTYLLVDVSGARLTERYLKGRPGFAEY
FT                   QRRTAYFVPRPPRSARR"
FT   gene            complement(537860..538396)
FT                   /locus_tag="TBFG_10452"
FT                   /old_locus_tag="TBFG_00443"
FT   CDS_pept        complement(537860..538396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10452"
FT                   /old_locus_tag="TBFG_00443"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0446c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04795"
FT                   /protein_id="ABR04795.1"
FT                   /translation="MNIVVVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAV
FT                   AVAAATLGHGDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQAL
FT                   RKVFGLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEAVGDWQLWVF
FT                   KSDPANRGVIMDRGL"
FT   gene            complement(538393..539676)
FT                   /locus_tag="TBFG_10453"
FT                   /old_locus_tag="TBFG_00444"
FT   CDS_pept        complement(538393..539676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10453"
FT                   /old_locus_tag="TBFG_00444"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase
FT                   ufaA1"
FT                   /note="Mapped to H37Rv Rv0447c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04796"
FT                   /protein_id="ABR04796.1"
FT                   /translation="MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTA
FT                   THLPLRLVYSDGTATGAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKEL
FT                   TRVLTVLAGSVDELVPRSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAF
FT                   LDETMTYSCAMFTDLLAQPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGEL
FT                   CIRAAARGAHIRSVTLSVEQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEM
FT                   IEAVGYRSWPRYFAALEQLVRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLP
FT                   STQAIIDITGQHTGLRIVDAASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWE
FT                   LYLAYSEAGFRSGYLDVYQWTLIREGPP"
FT   gene            complement(539673..540404)
FT                   /locus_tag="TBFG_10454"
FT                   /old_locus_tag="TBFG_00445"
FT   CDS_pept        complement(539673..540404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10454"
FT                   /old_locus_tag="TBFG_00445"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0448c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04797"
FT                   /protein_id="ABR04797.1"
FT                   /translation="MLTQTLTPAIYRTTISHCRQVPVHHSFAYRSYSWYVDVDNLPQLP
FT                   WWLRPFARFHADDHFADPFSCPPHSSLRDRLDAFFAARGLAVPDGRITALLQARVLGYV
FT                   FNPLSIFWCHDRDGQLRHVIAEVHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGY
FT                   YLIRAPRPDRELDVTVTLHRDRRQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVV
FT                   AARIRIQGIRLWLRRVPVVPR"
FT   gene            complement(540398..541717)
FT                   /locus_tag="TBFG_10455"
FT                   /old_locus_tag="TBFG_00446"
FT   CDS_pept        complement(540398..541717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10455"
FT                   /old_locus_tag="TBFG_00446"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0449c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04798"
FT                   /protein_id="ABR04798.1"
FT                   /translation="MQQSLRRSVAVVGSGVAGLTAAYILSGRDRVTLYEADGRLGGHAH
FT                   THYLDNGGGPRGTDVVGVDSAFLVHNDRTYPTLCRLFAELGVATQESEMSMSVRADDIG
FT                   LEYAGALGARGLFACRQSLRPRYLCMLAEILRFHRAAARLLREETDNAEDKPETLEAFL
FT                   SRHHFSQYFVDYFITPLVAAVWSCGGADALRYPARYLFVFLDHHGMLSVFGSPTWRTVT
FT                   GGSANYVQAIAAQLDEVSTRTPVHSLRRLPDGVLVGAGDGPSRRFDAAVVAVHPDQALL
FT                   LLDEPTPAERAVLGAIAYSTNSAQLHTDESVLPRHHRARASWNYLVTPGQHQVVVSYDI
FT                   SRLMRLDGGRRYLVTLGGHDRVDPSSVIAEMTYSHPLYTPESVAAQRLLPTLGDNRVVF
FT                   AGAYHGWGFHEDGAASGLRAARRLGADWPAAIPQEAMVAC"
FT   gene            complement(541757..544660)
FT                   /locus_tag="TBFG_10456"
FT                   /old_locus_tag="TBFG_00447"
FT   CDS_pept        complement(541757..544660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10456"
FT                   /old_locus_tag="TBFG_00447"
FT                   /product="transmembrane transport protein mmpL4"
FT                   /note="Mapped to H37Rv Rv0450c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04799"
FT                   /protein_id="ABR04799.1"
FT                   /translation="MSTKFANDSNTNARPEKPFIARMIHAFAVPIILGWLAVCVVVTVF
FT                   VPSLEAVGQERSVSLSPKDAPSFEAMGRIGMVFKEGDSDSFAMVIIEGNQPLGDAAHKY
FT                   YDGLVAQLRADKKHVQSVQDLWGDPLTAAGVQSNDGKAAYVQLSLAGNQGTPLANESVE
FT                   AVRSIVESTPAPPGIKAYVTGPSALAADMHHSGDRSMARITMVTVAVIFIMLLLVYRSI
FT                   ITVVLLLITVGVELTAARGVVAVLGHSGAIGLTTFAVSLLTSLAIAAGTDYGIFIIGRY
FT                   QEARQAGEDKEAAYYTMYRGTAHVILGSGLTIAGATFCLSFARMPYFQTLGIPCAVGML
FT                   VAVAVALTLGPAVLHVGSRFGLFDPKRLLKVRGWRRVGTVVVRWPLPVLVATCAIALVG
FT                   LLALPGYKTSYNDRDYLPDFIPANQGYAAADRHFSQARMKPEILMIESDHDMRNPADFL
FT                   VLDKLAKGIFRVPGISRVQAITRPEGTTMDHTSIPFQISMQNAGQLQTIKYQRDRANDM
FT                   LKQADEMATTIAVLTRMHSLMAEMASTTHRMVGDTEEMKEITEELRDHVADFDDFWRPI
FT                   RSYFYWEKHCYGIPICWSFRSIFDALDGIDKLSEQIGVLLGDLREMDRLMPQMVAQIPP
FT                   QIEAMENMRTMILTMHSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNK
FT                   DFQRAMKSFLSSDGHAARFIILHRGDPQSPEGIKSIDAIRTAAEESLKGTPLEDAKIYL
FT                   AGTAAVFHDISEGAQWDLLIAAISSLCLIFIIMLIITRAFIAAAVIVGTVALSLGASFG
FT                   LSVLLWQHILAIHLHWLVLAMSVIVLLAVGSDYNLLLVSRFKQEIGAGLKTGIIRSMGG
FT                   TGKVVTNAGLVFAVTMASMAVSDLRVIGQVGTTIGLGLLFDTLIVRSFMTPSIAALLGR
FT                   WFWWPLRVRSRPARTPTVPSETQPAGRPLAMSSDRLG"
FT   gene            complement(544657..545079)
FT                   /locus_tag="TBFG_10457"
FT                   /old_locus_tag="TBFG_00448"
FT   CDS_pept        complement(544657..545079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10457"
FT                   /old_locus_tag="TBFG_00448"
FT                   /product="membrane protein mmpS4"
FT                   /note="Mapped to H37Rv Rv0451c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04800"
FT                   /protein_id="ABR04800.1"
FT                   /translation="MLMRTWIPLVILVVVIVGGFTVHRIRGFFGSENRPSYSDTNLENS
FT                   KPFNPKHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQ
FT                   GNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA"
FT   gene            545260..546021
FT                   /locus_tag="TBFG_10458"
FT                   /old_locus_tag="TBFG_00449"
FT   CDS_pept        545260..546021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10458"
FT                   /old_locus_tag="TBFG_00449"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0452"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04801"
FT                   /protein_id="ABR04801.1"
FT                   /translation="MRNGTLRYRQPSYKSHGVRYPLAVAQLGFQRARTEENKRQRAAAL
FT                   VEAARSLALETGVASVTLTAVAGRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVC
FT                   EQLGEPGPMSAPRVAEALANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAV
FT                   IALVDAIESALPALGRSGAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELLPPEWN
FT                   LDFAAALTRLLTATLLGLLAGSPCECRSPTR"
FT   gene            546343..547899
FT                   /locus_tag="TBFG_10459"
FT                   /old_locus_tag="TBFG_00450"
FT   CDS_pept        546343..547899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10459"
FT                   /old_locus_tag="TBFG_00450"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0453"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04802"
FT                   /protein_id="ABR04802.1"
FT                   /translation="MTSALIWMASPPEVHSALLSSGPGPGPVLAAATGWSSLGREYAAV
FT                   AEELGALLAAVQAGVWQGPSAESFAAACLPYLSWLTQASADCAAAAARLEAVTAAYAAA
FT                   LVAMPTLAELAANHATHGAMVATNFFGINTIPIAVNEADYVRMWLQAATTMATYQAVAD
FT                   SAVRSIPDSVPPPRILKSNAQSQHSSSNNSGGADPVDDFIAEILKIITGGRVIWDPEAG
FT                   TVNGLPYDAYTNPGTLMWWIARSLELLQDFQEFAKLLFTNPVKAFQFLVDLILFDWPTH
FT                   MLQLATWLAENPQLLVAALTPAISGLGAVSGLAGLTGLVPQPPVVPAPAPDAVVPTVLP
FT                   LAGTATPTTAPASAPAAGAAPGPPAGTATATSASVPTSAGGFPPYLVGSGPGIDFDAGT
FT                   PAGSRRAQPAADNVTAVAAAQVSARHQARRRRRAAAKERGNADEFVDMDSGPAIPPSGE
FT                   RDAWASNSGVGGLGFAGTASNETVAAPAGLTTLADDEFQCGPRMPVLPGAWDLGTWDRG
FT                   D"
FT   gene            complement(547905..548291)
FT                   /locus_tag="TBFG_10460"
FT                   /old_locus_tag="TBFG_00451"
FT   CDS_pept        complement(547905..548291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10460"
FT                   /old_locus_tag="TBFG_00451"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0453"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04803"
FT                   /protein_id="ABR04803.1"
FT                   /translation="MPLRGRGKHRGPHGLDTGARRMSQAPGNEIPHTLAALDWGGITCQ
FT                   SGAGCTNRASYVVHLHAVDECNDPDLDPFGNTVEILCIACLWHVEAKVLLQVGRLTRSP
FT                   GAFCLTCGAPVREPTDIMRDVAAL"
FT   gene            complement(548544..548990)
FT                   /locus_tag="TBFG_10461"
FT                   /old_locus_tag="TBFG_00452"
FT   CDS_pept        complement(548544..548990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10461"
FT                   /old_locus_tag="TBFG_00452"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0455c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04804"
FT                   /protein_id="ABR04804.1"
FT                   /translation="MSRLSSILRAGAAFLVLGIAAATFPQSAAADSTEDFPIPRRMIAT
FT                   TCDAEQYLAAVRDTSPVYYQRYMIDFNNHANLQQATINKAHWFFSLSPAERRDYSEHFY
FT                   NGDPLTFAWVNHMKIFFNNKGVVAKGTEVCNGYPAGDMSVWNWA"
FT   gene            complement(549058..549972)
FT                   /locus_tag="TBFG_10462"
FT                   /old_locus_tag="TBFG_00453"
FT   CDS_pept        complement(549058..549972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10462"
FT                   /old_locus_tag="TBFG_00453"
FT                   /product="enoyl-CoA hydratase echA2"
FT                   /note="Mapped to H37Rv Rv0456c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04805"
FT                   /protein_id="ABR04805.1"
FT                   /translation="MPTPDFQTLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAIGL
FT                   AERDQDIKVIVLRGAGRAFSGGYDFGGGFQHWGDAMMTDGRWDPGKDFAMVTARETGPT
FT                   QKFMAIWRASKPVIAQVHGWCVGGASDYALCADIVIASEDAVIGTPYSRMWGAYLTGMW
FT                   LYRLSLAKVKWHSLTGRPLTGVQAAEAELINEAVPFERLEARVAEIATELARIPLSQLQ
FT                   AQKLIVNQAYENMGLASTQLLGGILDGLMRNTPDALEFIRTAQTQGVRAAVERRDGPFG
FT                   DYSQAPPELRPDPTHVITPDGSM"
FT   gene            complement(550245..550526)
FT                   /locus_tag="TBFG_10463"
FT   CDS_pept        complement(550245..550526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10463"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0456A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04806"
FT                   /protein_id="ABR04806.1"
FT                   /translation="MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVV
FT                   PVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS"
FT   gene            complement(550755..552776)
FT                   /locus_tag="TBFG_10464"
FT                   /old_locus_tag="TBFG_00454"
FT   CDS_pept        complement(550755..552776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10464"
FT                   /old_locus_tag="TBFG_00454"
FT                   /product="hypothetical peptidase"
FT                   /note="Mapped to H37Rv Rv0457c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04807"
FT                   /protein_id="ABR04807.1"
FT                   /translation="MTFEPAPDGADPYLWLEDVTGAEALDWVRARNKPTTAAFCDAEFE
FT                   RMRVEALEVLDTDARIPYVNRRGNYLYNFWRDAANPRGLWRRTTLDSYRTDSPGWDVLI
FT                   DVDELGRADDQKWVWGGAGVIEPDYTRALIGLSPGGSDASIVREFDMLTREFVEDGFQL
FT                   PPAKSQITWEDPDTVLLGTDFGGDSLTTSGYPRVIKRWRRGKPLADAETIFEGAGTDVR
FT                   VNASADRTPGFERTLLGRALDFWNEEVYELRGSELIRIEAPTDASVSIHRDWLLIELRT
FT                   DWTVATTRYTAGSLLAAEYDEFLAGSAELQVVFEPDEHTALYQYAWTRDRLLIVTLADV
FT                   ASRVEIATPGSWRREPLSGIPAATNTVIVSADSHGDEFFLDSSGFDTPSRLMRGTDDGR
FT                   LAEIKSAPAFFDAENMAVTQYFATSDDGTSIPYFVVRRTDADNPGPTLLNGYGGFETSR
FT                   TPTYDGVLGRLWLARGGTYALANIRGGGEYGPGWHTQAMREGRDKVAQDFAAVATDLVT
FT                   RGITTAEQLGARGGSNGGLLMGIMLTGYPEKFGALVCDVPLLDMKRYHLLLAGASWMAE
FT                   YGDPDNPDDWKFISEYSPYQNISANRKYPPVLMTTSTRDDRVHPGHARKMTAALQAAGH
FT                   PVWYYENIEGGHAGAADNAQIAFKSALSFAFLWRMLAG"
FT   gene            552844..554367
FT                   /locus_tag="TBFG_10465"
FT                   /old_locus_tag="TBFG_00455"
FT   CDS_pept        552844..554367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10465"
FT                   /old_locus_tag="TBFG_00455"
FT                   /product="hypothetical aldehyde dehydrogenase"
FT                   /note="Mapped to H37Rv Rv0458"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04808"
FT                   /protein_id="ABR04808.1"
FT                   /translation="MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVHGRYFENPTPVTG
FT                   QPFCEVPRSDAADIDKALDAAHAAAPGWGKTAPAERAAILNMIADRIDKNAAALAVAEV
FT                   WDNGKPVREALAADIPLAVDHFRYFAAAIRAQEGALSQIDEDTVAYHFHEPLGVVGQII
FT                   PWNFPILMAAWKLAPALAAGNTAVLKPAEQTPASVLYLMSLIGDLLPPGVVNVVNGFGA
FT                   EAGKPLASSDRIAKVAFTGETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVLAAHD
FT                   DFCDKALEGFTMFALNQGEVCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETM
FT                   LGSQASNDQLEKVLSYIEIGKQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRI
FT                   FKEEIFGPVVAVTSFTDYDDAIGIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVN
FT                   CYHLYPAHAAFGGYKQSGIGREGHQMMLQHYQHTKNLLVSYSDKALGFF"
FT   gene            554367..554858
FT                   /locus_tag="TBFG_10466"
FT                   /old_locus_tag="TBFG_00456"
FT   CDS_pept        554367..554858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10466"
FT                   /old_locus_tag="TBFG_00456"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0459"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04809"
FT                   /protein_id="ABR04809.1"
FT                   /translation="MNAPAGVLITAEAAALLAGLQDRHGPVMFHQSGGCCDGSAPMCYP
FT                   RADFLVGDRDILLGVLDVGEDGVPVWISGPQYQAWKHTQLIIDVVPGRGGGFSLEAPEG
FT                   VRFLSRGRVFSDAEKAMREAAPVITGAAYECGERPLVRGLVVDLDDPDATPGVCRASRR
FT                   "
FT   gene            554879..555157
FT                   /locus_tag="TBFG_10467"
FT                   /old_locus_tag="TBFG_00457"
FT   CDS_pept        554879..555157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10467"
FT                   /old_locus_tag="TBFG_00457"
FT                   /product="conserved hydrophobic protein"
FT                   /note="Mapped to H37Rv Rv0460"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04810"
FT                   /protein_id="ABR04810.1"
FT                   /translation="MIPLPRSWQLTSAMLVGNAIGLLAGVACSVLVHARIRPDIVIAMV
FT                   VGIPSAIGLLVILFSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG"
FT   gene            555195..555719
FT                   /locus_tag="TBFG_10468"
FT                   /old_locus_tag="TBFG_00458"
FT   CDS_pept        555195..555719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10468"
FT                   /old_locus_tag="TBFG_00458"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0461"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04811"
FT                   /protein_id="ABR04811.1"
FT                   /translation="MPDFDTGAHSQRFLSLAGQQDRAGKSWPGSTPKPQEDPVGVAPSA
FT                   SVEVLGSEPAATLAHSVTVPGRYTYLKWWKFVLVVLGVWIGAGEVGLSLFYWWYHTLDK
FT                   TAAVFVVLVYVVACTVGGLILALVPGRPLITALSLGVMSGPFASVAAAAPLYGYYYCER
FT                   MSHCLVGVIPY"
FT   gene            555783..557177
FT                   /locus_tag="TBFG_10469"
FT                   /old_locus_tag="TBFG_00459"
FT   CDS_pept        555783..557177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10469"
FT                   /old_locus_tag="TBFG_00459"
FT                   /product="dihydrolipoamide dehydrogenase lpd"
FT                   /note="Mapped to H37Rv Rv0462"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10469"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04812"
FT                   /protein_id="ABR04812.1"
FT                   /translation="MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVG
FT                   CIPSKALLRNAELVHIFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKN
FT                   KITEIHGYGTFADANTLLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEE
FT                   QILSRELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQF
FT                   KKLGVTILTATKVESIADGGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKA
FT                   GVALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLG
FT                   DHRMLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVA
FT                   DAKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLV
FT                   GHMINF"
FT   gene            557185..557478
FT                   /locus_tag="TBFG_10470"
FT                   /old_locus_tag="TBFG_00460"
FT   CDS_pept        557185..557478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10470"
FT                   /old_locus_tag="TBFG_00460"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0463"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04813"
FT                   /protein_id="ABR04813.1"
FT                   /translation="MTRRASTDTPQIIMGAIGGVVTGYILWLAAISVGDGLTTVSQWSR
FT                   VVLLLSVLVAVCGAAGGLRLRSRGKLAWSAFAFSLPIPPVVLTVAVLADIYL"
FT   gene            complement(557482..558054)
FT                   /locus_tag="TBFG_10471"
FT                   /old_locus_tag="TBFG_00461"
FT   CDS_pept        complement(557482..558054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10471"
FT                   /old_locus_tag="TBFG_00461"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0464c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04814"
FT                   /protein_id="ABR04814.1"
FT                   /translation="MTGQNGQVARISPGKFRQLGPVNWLVAKLAARAVGAPQMHLFTTL
FT                   GYRQYLFWTFAIYTGRLLHGRLPGVDTELVILRVAHLRSCEYELQHHRRMARRRGLDAN
FT                   TQATIFAWPDVPDGDGPRKVLSARQQALLQATDELIKDRTITAGTWERLATHLDPRLLI
FT                   EFCLLATQYDAIAATITALAIPPDNPQ"
FT   gene            complement(558051..559475)
FT                   /locus_tag="TBFG_10472"
FT                   /old_locus_tag="TBFG_00462"
FT   CDS_pept        complement(558051..559475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10472"
FT                   /old_locus_tag="TBFG_00462"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0465c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04815"
FT                   /protein_id="ABR04815.1"
FT                   /translation="MSKTYVGSRVRQLRNERGFSQAALAQMLEISPSYLNQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLVAELREVTLDRDLDIAIDPHEVAEMVSAHPGL
FT                   ACAVVNLHRRYRITTAQLAAATEERFSDGSGRGSITMPHEEVRDYFYQRQNYLHALDTA
FT                   AEDLTAQMRMHHGDLARELTRRLTEVHGVRINKRIDLGDTVLHRYDPATNTLEISSHLS
FT                   PGQQVFKMAAELAYLEFGDLIDAMVTDGKFTSAESRTLARLGLANYFAAATVLPYRQFH
FT                   DVAENFRYDVERLSAFYSVSYETIAHRLSTLQRPSMRGVPFTFVRVDRAGNMSKRQSAT
FT                   GFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYLWVARTVELRAARYGQPGKT
FT                   FAIGLGCELRHAHRLVYSEGLDLSGDPNTAATPIGAGCRVCERDNCPQRAFPALGRALD
FT                   LDEHRSTVSPYLVKQL"
FT   gene            559627..560421
FT                   /locus_tag="TBFG_10473"
FT                   /old_locus_tag="TBFG_00463"
FT   CDS_pept        559627..560421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10473"
FT                   /old_locus_tag="TBFG_00463"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0466"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04816"
FT                   /protein_id="ABR04816.1"
FT                   /translation="MSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQ
FT                   DIGQDQLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMRVRVD
FT                   GRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWKGYLKPGSRDDASE
FT                   IHEFPVRVTDIDLFDHMNNAVYWSVIEDYLASHAELLRGPLRVTIEHEAPVALGDKLEI
FT                   ISHVHPAGSTEIFGPGLVDRAVTTLTYVVGDEPKAVASLFNL"
FT   gene            560696..561982
FT                   /locus_tag="TBFG_10474"
FT                   /old_locus_tag="TBFG_00464"
FT   CDS_pept        560696..561982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10474"
FT                   /old_locus_tag="TBFG_00464"
FT                   /product="isocitrate lyase icl"
FT                   /note="Mapped to H37Rv Rv0467"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04817"
FT                   /protein_id="ABR04817.1"
FT                   /translation="MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEE
FT                   HTLARRGAEVLWEQLHDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGH
FT                   TYPDQSLYPANSVPQVVRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALN
FT                   VYELQKALIAAGVAGSHWEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVP
FT                   TVVIARTDAEAATLITSDVDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADL
FT                   IWMETGTPDLEAARQFSEAVKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMG
FT                   FKFQFITLAGFHALNYSMFDLAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGA
FT                   GYFDRIATTVDPNSSTTALTGSTEEGQFH"
FT   gene            562064..562924
FT                   /locus_tag="TBFG_10475"
FT                   /old_locus_tag="TBFG_00465"
FT   CDS_pept        562064..562924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10475"
FT                   /old_locus_tag="TBFG_00465"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase fadB2"
FT                   /note="Mapped to H37Rv Rv0468"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10475"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04818"
FT                   /protein_id="ABR04818.1"
FT                   /translation="MSDAIQRVGVVGAGQMGSGIAEVSARAGVEVTVFEPAEALITAGR
FT                   NRIVKSLERAVSAGKVTERERDRALGLLTFTTDLNDLSDRQLVIEAVVEDEAVKSEIFA
FT                   ELDRVVTDPDAVLASNTSSIPIMKVAAATKQPQRVLGLHFFNPVPVLPLVELVRTLVTD
FT                   EAAAARTEEFASTVLGKQVVRCSDRSGFVVNALLVPYLLSAIRMVEAGFATVEDVDKAV
FT                   VAGLSHPMGPLRLSDLVGLDTLKLIADKMFEEFKEPHYGPPPLLLRMVEAGQLGKKSGR
FT                   GFYTY"
FT   gene            563039..563917
FT                   /locus_tag="TBFG_10476"
FT                   /old_locus_tag="TBFG_00466"
FT   CDS_pept        563039..563917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10476"
FT                   /old_locus_tag="TBFG_00466"
FT                   /product="mycolic acid synthase umaA"
FT                   /note="Mapped to H37Rv Rv0469"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04819"
FT                   /protein_id="ABR04819.1"
FT                   /translation="MRGSAGMTELRPFYEESQSIYDVSDEFFSLFLDPTMAYTCAYFER
FT                   EDMTLEEAQNAKFDLALDKLHLEPGMTLLDIGCGWGGGLQRAIENYDVNVIGITLSRNQ
FT                   FEYSKAKLAKIPTERSVQVRLQGWDEFTDKVDRIVSIGAFEAFKMERYAAFFERSYDIL
FT                   PDDGRMLLHTILTYTQKQMHEMGVKVTMSDVRFMKFIGEEIFPGGQLPAQEDIFKFAQA
FT                   ADFSVEKVQLLQQHYARTLNIWAANLEANKDRAIALQSEEIYNKYMHYLTGCEHFFRKG
FT                   ISNVGQFTLTK"
FT   gene            complement(564017..564880)
FT                   /locus_tag="TBFG_10477"
FT                   /old_locus_tag="TBFG_00467"
FT   CDS_pept        complement(564017..564880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10477"
FT                   /old_locus_tag="TBFG_00467"
FT                   /product="mycolic acid synthase pcaA (cyclopropane
FT                   synthase)"
FT                   /note="Mapped to H37Rv Rv0470c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04820"
FT                   /protein_id="ABR04820.1"
FT                   /translation="MSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTL
FT                   QEAQIAKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQAGHVQ
FT                   KMFDQMDTPRSRRVLLEGWEKFDEPVDRIVSIGAFEHFGHQRYHHFFEVTHRTLPADGK
FT                   MLLHTIVRPTFKEGREKGLTLTHELVHFTKFILAEIFPGGWLPSIPTVHEYAEKVGFRV
FT                   TAVQSLQLHYARTLDMWATALEANKDQAIAIQSQTVYDRYMKYLTGCAKLFRQGYTDVD
FT                   QFTLEK"
FT   gene            complement(565023..565463)
FT                   /locus_tag="TBFG_10478"
FT                   /old_locus_tag="TBFG_00468"
FT   CDS_pept        complement(565023..565463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10478"
FT                   /old_locus_tag="TBFG_00468"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0470A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04821"
FT                   /protein_id="ABR04821.1"
FT                   /translation="MGAGGWEVVLASLPYGLLCTTVLMGKHIDKIGYDEPLGIRTLPVL
FT                   LGETCARTVTLAMMVGFYLLIAVNVMLAAMPWPRCWSPGRCPGWRKCGPISCDGGPSSR
FT                   HRRFRCGRCGMPRWPGCTCVRPVRCWLWAWRSVPGGAPGDFR"
FT   gene            complement(565394..565882)
FT                   /locus_tag="TBFG_10479"
FT                   /old_locus_tag="TBFG_00469"
FT   CDS_pept        complement(565394..565882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10479"
FT                   /old_locus_tag="TBFG_00469"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0471c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04822"
FT                   /protein_id="ABR04822.1"
FT                   /translation="MPDAGAGSRLRSWAYALRTTNPPADGPTDTVTRWLVVTRAAVLPM
FT                   TLVSGLVAGLLAIGEPGLDWRWLVLWWESHAPHIANNLMNDLYDTDVGTDSATYARARY
FT                   AQHPAATGANRAAYTTPRRTTSCGSPERALEPTTPRWARAVGRSCWRRSPTGCCAPRC"
FT   gene            complement(565892..566596)
FT                   /locus_tag="TBFG_10480"
FT                   /old_locus_tag="TBFG_00470"
FT   CDS_pept        complement(565892..566596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10480"
FT                   /old_locus_tag="TBFG_00470"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0472c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04823"
FT                   /protein_id="ABR04823.1"
FT                   /translation="MAGRIPAVTVKTDGRKRRWHQHKVERRNELVDGTIEAIRRHGRFL
FT                   SMDEIAAEIGVSKTVLYRYFVDKNDLTTAVMMRFTQTTLIPNMIAALSADMDGFELTRE
FT                   IIRVYVETVAAQPEPYRFVMANSSASKSKVIADSERIIARMLAVMLRRRMQEAGMDTGG
FT                   VEPWAYLIVGGVQLATHSWMSDPRMSSDELIDYLTMLSWSALCGIVEAGGSLEKFREQP
FT                   HPSPIVPAWGQV"
FT   gene            566733..568103
FT                   /locus_tag="TBFG_10481"
FT                   /old_locus_tag="TBFG_00471"
FT   CDS_pept        566733..568103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10481"
FT                   /old_locus_tag="TBFG_00471"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0473"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04824"
FT                   /protein_id="ABR04824.1"
FT                   /translation="MVAHRAEVSGSPPPRLNLSTQPTVARRVRASFAESFAAADPEADA
FT                   ARRMALRRMKVVAVGFLVGATGVFLACRWAQADGADHAWLGYLGAAAEAGMVGALADWF
FT                   AVTALFKHPLGIPIPHTAIIKRKKDQLGEGLGTFVRENFLSPPVVETKLRDAQIPSRLG
FT                   KWLSEATHAQRVAAETATVLRVLVELLRDEDIQQVIDRMIVRRIAEPQWGPPAGRVLAT
FT                   LLAENRQEAFIQLLADRAFQWSLNAGVVIQRVVERDSPSWSPRFIDHLVGDRIHRELME
FT                   FTDKVRRNPDHELRRSATRFLFDFADDLQHDPATVARADAIKEELMARDEIATAAAAAW
FT                   KTLKRLVLEGVDDPSSALRTRITDAVIRIGESLRDDADLRDKVDSWTVRAAQHLVSEYG
FT                   VEITAIITETIERWDAEEASRRIELHVGRDLQFIRINGTVVGAMAGLAIYAIAQLLF"
FT   gene            568190..568612
FT                   /locus_tag="TBFG_10482"
FT                   /old_locus_tag="TBFG_00472"
FT   CDS_pept        568190..568612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10482"
FT                   /old_locus_tag="TBFG_00472"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0474"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04825"
FT                   /protein_id="ABR04825.1"
FT                   /translation="MSSEEKLAAKVSTKASDVASDIGSFIRSQRETAHVSMRQLAERSG
FT                   VSNPYLSQVERGLRKPSADVLSQIAKALRVSAEVLYVRAGILEPSETSQVRDAIITDTA
FT                   ITERQKQILLDIYASFTHQNEATREECPSDPTPTDD"
FT   gene            568966..569565
FT                   /locus_tag="TBFG_10483"
FT                   /old_locus_tag="TBFG_00473"
FT   CDS_pept        568966..569565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10483"
FT                   /old_locus_tag="TBFG_00473"
FT                   /product="iron-regulated heparin binding hemagglutinin hbhA
FT                   (adhesin)"
FT                   /note="Mapped to H37Rv Rv0475"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04826"
FT                   /protein_id="ABR04826.1"
FT                   /translation="MAENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTD
FT                   TRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEA
FT                   ALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKA
FT                   APAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK"
FT   gene            569677..569940
FT                   /locus_tag="TBFG_10484"
FT                   /old_locus_tag="TBFG_00474"
FT   CDS_pept        569677..569940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10484"
FT                   /old_locus_tag="TBFG_00474"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0476"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04827"
FT                   /protein_id="ABR04827.1"
FT                   /translation="MLVLLVAVLVTAVYAFVHAALQRPDAYTAADKLTKPVWLVILGAA
FT                   VALASILYPVLGVLGMAMSACASGVYLVDVRPKLLEIQGKSR"
FT   gene            569945..570391
FT                   /locus_tag="TBFG_10485"
FT                   /old_locus_tag="TBFG_00475"
FT   CDS_pept        569945..570391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10485"
FT                   /old_locus_tag="TBFG_00475"
FT                   /product="conserved secreted protein"
FT                   /note="Mapped to H37Rv Rv0477"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04828"
FT                   /protein_id="ABR04828.1"
FT                   /translation="MKALVAVSAVAVVALLGVSSAQADPEADPGAGEANYGGPPSSPRL
FT                   VDHTEWAQWGSLPSLRVYPSQVGRTASRRLGMAAADAAWAEVLALSPEADTAGMRAQFI
FT                   CHWQYAEIRQPGKPSWNLEPWRPVVDDSEMLASGCNPGSPEESF"
FT   gene            570391..571065
FT                   /locus_tag="TBFG_10486"
FT                   /old_locus_tag="TBFG_00476"
FT   CDS_pept        570391..571065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10486"
FT                   /old_locus_tag="TBFG_00476"
FT                   /product="deoxyribose-phosphate aldolase deoC"
FT                   /note="Mapped to H37Rv Rv0478"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10486"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04829"
FT                   /protein_id="ABR04829.1"
FT                   /translation="MLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELGVYAVCV
FT                   SPSMVPVAVQAGGVRVAAVTGFPSGKHVSSVKAHEAAAALASGASEIDMVIDIGAALCG
FT                   DIDAVRSDIEAVRAAAAGAVLKVIVESAVLLGQSNAHTLVDACRAAEDAGADFVKTSTG
FT                   CHPAGGATVRAVELMAETVGPRLGVKASGGIRTAADAVAMLNAGATRLGLSGTRAVLDG
FT                   LS"
FT   gene            complement(571090..572136)
FT                   /locus_tag="TBFG_10487"
FT                   /old_locus_tag="TBFG_00477"
FT   CDS_pept        complement(571090..572136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10487"
FT                   /old_locus_tag="TBFG_00477"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0479c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04830"
FT                   /protein_id="ABR04830.1"
FT                   /translation="MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGH
FT                   IQEPVSPPTQPEQQPQTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKR
FT                   RARRDPLTVFLVLIIVFSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAP
FT                   LLLWQVATRHFTNISVETAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITW
FT                   SSEGIKESVQNAIPILGAFVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIIN
FT                   FNTLGFSLPKETVQSTLNEFTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGI
FT                   QNPCFSHI"
FT   gene            complement(572133..572975)
FT                   /locus_tag="TBFG_10488"
FT                   /old_locus_tag="TBFG_00478"
FT   CDS_pept        complement(572133..572975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10488"
FT                   /old_locus_tag="TBFG_00478"
FT                   /product="hypothetical amidohydrolase"
FT                   /note="Mapped to H37Rv Rv0480c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04831"
FT                   /protein_id="ABR04831.1"
FT                   /translation="MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCR
FT                   LGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQP
FT                   DAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGA
FT                   QLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGV
FT                   GGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG"
FT   gene            complement(573157..573681)
FT                   /locus_tag="TBFG_10489"
FT                   /old_locus_tag="TBFG_00479"
FT   CDS_pept        complement(573157..573681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10489"
FT                   /old_locus_tag="TBFG_00479"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0481c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10489"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04832"
FT                   /protein_id="ABR04832.1"
FT                   /translation="MPRSFDMSADYEGSVEEVHRAFYEADYWKARLAETPVDVATLESI
FT                   RVGGDSGDDGTIEVVTLQMVRSHNLPGLVTQLHRGDLSVRREETWGPVKEGIATASIAG
FT                   SIVDAPVNLWGTAVLSPIPESGGSRMTLQVTIQVRIPFIGGKLERLIGTQLSQLVTIEQ
FT                   RFTTLWITNNV"
FT   gene            573708..574817
FT                   /locus_tag="TBFG_10490"
FT                   /old_locus_tag="TBFG_00480"
FT   CDS_pept        573708..574817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10490"
FT                   /old_locus_tag="TBFG_00480"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   murB"
FT                   /note="Mapped to H37Rv Rv0482"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04833"
FT                   /protein_id="ABR04833.1"
FT                   /translation="MKRSGVGSLFAGAHIAEAVPLAPLTTLRVGPIARRVITCTSAEQV
FT                   VAALRHLDSAAKTGADRPLVFAGGSNLVIAENLTDLTVVRLANSGITIDGNLVRAEAGA
FT                   VFDDVVVRAIEQGLGGLECLSGIPGSAGATPVQNVGAYGAEVSDTITRVRLLDRCTGEV
FT                   RWVSARDLRFGYRTSVLKHADGLAVPTVVLEVEFALDPSGRSAPLRYGELIAALNATSG
FT                   ERADPQAVREAVLALRARKGMVLDPTDHDTWSVGSFFTNPVVTQDVYERLAGDAATRKD
FT                   GPVPHYPAPDGVKLAAGWLVERAGFGKGYPDAGAAPCRLSTKHALALTNRGGATAEDVV
FT                   TLARAVRDGVHDVFGITLKPEPVLIGCML"
FT   gene            574879..576234
FT                   /locus_tag="TBFG_10491"
FT                   /old_locus_tag="TBFG_00481"
FT   CDS_pept        574879..576234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10491"
FT                   /old_locus_tag="TBFG_00481"
FT                   /product="lipoprotein lprQ"
FT                   /note="Mapped to H37Rv Rv0483"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04834"
FT                   /protein_id="ABR04834.1"
FT                   /translation="MVIRVLFRPVSLIPVNNSSTPQSQGPISRRLALTALGFGVLAPNV
FT                   LVACAGKVTKLAEKRPPPAPRLTFRPADSAADVVPIAPISVEVGDGWFQRVALTNSAGK
FT                   VVAGAYSRDRTIYTITEPLGYDTTYTWSGSAVGHDGKAVPVAGKFTTVAPVKTINAGFQ
FT                   LADGQTVGIAAPVIIQFDSPISDKAAVERALTVTTDPPVEGGWAWLPDEAQGARVHWRP
FT                   REYYPAGTTVDVDAKLYGLPFGDGAYGAQDMSLHFQIGRRQVVKAEVSSHRIQVVTDAG
FT                   VIMDFPCSYGEADLARNVTRNGIHVVTEKYSDFYMSNPAAGYSHIHERWAVRISNNGEF
FT                   IHANPMSAGAQGNSNVTNGCINLSTENAEQYYRSAVYGDPVEVTGSSIQLSYADGDIWD
FT                   WAVDWDTWVSMSALPPPAAKPAATQIPVTAPVTPSDAPTPSGTPTTTNGPGG"
FT   gene            complement(576215..576970)
FT                   /locus_tag="TBFG_10492"
FT                   /old_locus_tag="TBFG_00482"
FT   CDS_pept        complement(576215..576970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10492"
FT                   /old_locus_tag="TBFG_00482"
FT                   /product="hypothetical short-chain type oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0484c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04835"
FT                   /protein_id="ABR04835.1"
FT                   /translation="MTTIGTRKRVAVVTGASSGIGEATARTLAAQGFHVVAVARRADRI
FT                   TALANQIGGTAIVADVTDDAAVEALARALSRVDVLVNNAGGAKGLQFVADADLEHWRWM
FT                   WDTNVLGTLRVTRALLPKLIDSGDGLIVTVTSIAAIEVYDGGAGYTAAKHAQGALHRTL
FT                   RGELLGKPVRLTEIAPGAVETEFSLVRFDGDQQRADAVYAGMTPLVAADVAEVIGFVAT
FT                   RPSHVNLDQIVIRPRDQASASRRATHPVR"
FT   gene            577153..578469
FT                   /locus_tag="TBFG_10493"
FT                   /old_locus_tag="TBFG_00483"
FT   CDS_pept        577153..578469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10493"
FT                   /old_locus_tag="TBFG_00483"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0485"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04836"
FT                   /protein_id="ABR04836.1"
FT                   /translation="MYSTNRTSQSLSRKPGRKHQLRSHRYVMPPSLHLSDSAAASVFRA
FT                   VRLRGPVGRDVIAGSTSLSIATVNRQVIALLEAGLLRERADLAVSGAIGRPRVPVEVNH
FT                   EPFVTLGIHIGARTTSIVATDLFGRTLDTVETPTPRNAAGAALTSLADSADRYLQRWRR
FT                   RRALWVGVTLGGAVDSATGHVDHPRLGWRQAPVGPVLADALGLPVSVASHVDAMAGAEL
FT                   MLGMRRFAPSSSTSLYVYARETVGYALMIGGRVHCPASGPGTIAPLPVHSEMLGGTGQL
FT                   ESTVSDEAVLAAARRLRIIPGIASRTRTGGSATAITDLLRVARAGNQQAKELLAERARV
FT                   LGGAVALLRDLLNPDEVVVGGQAFTEYPEAMEQVEAAFTAGSVLAPRDIRVTVFGNRVQ
FT                   EAGAGIVSLSGLYADPLGALRRSGALDARLQDTAPEALA"
FT   gene            578517..579959
FT                   /locus_tag="TBFG_10494"
FT                   /old_locus_tag="TBFG_00484"
FT   CDS_pept        578517..579959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10494"
FT                   /old_locus_tag="TBFG_00484"
FT                   /product="mannosyltransferase"
FT                   /note="Mapped to H37Rv Rv0486"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04837"
FT                   /db_xref="GOA:A5WJJ8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WJJ8"
FT                   /protein_id="ABR04837.1"
FT                   /translation="MAGVRHDDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPR
FT                   RVALLAVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVA
FT                   PGVLVRNVVAGPFEGLDKYDLPTQLCAFAAGVLRAEAVHEPGYYDIVHSHYWLSGQVGW
FT                   LARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRTVGEQQVVDEADRLIVNTDDEAR
FT                   QVISLHGADPARIDVVHPGVDLDVFRPGDRRAARAALGLPVDERVVAFVGRIQPLKAPD
FT                   IVLRAAAKLPGVRIIVAGGPSGSGLASPDGLVRLADELGISARVTFLPPQSHTDLATLF
FT                   RAADLVAVPSYSESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWA
FT                   DAIDHLLRLCAGPRGRVMSRAAARHAATFSWENTTDALLASYRRAIGEYNAERQRRGGE
FT                   VISDLVAVGKPRHWTPRRGVGA"
FT   gene            579956..580507
FT                   /locus_tag="TBFG_10495"
FT                   /old_locus_tag="TBFG_00485"
FT   CDS_pept        579956..580507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10495"
FT                   /old_locus_tag="TBFG_00485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0487"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04838"
FT                   /protein_id="ABR04838.1"
FT                   /translation="MTSSLPTVQRVIQNALEVSQLKYSQHPRPGGAPPALIVELPGERK
FT                   LKINTILSVGEHSVRVEAFVCRKPDENREDVYRFLLRRNRRLYGVAYTLDNVGDIYLVG
FT                   QMALSAVDADEVDRVLGQVLEVVDSDFNALLELGFRSSIQREWQWRLSRGESLQNLQAF
FT                   AHLRPTTMQSAQRDEKELGG"
FT   gene            580833..581438
FT                   /locus_tag="TBFG_10496"
FT                   /old_locus_tag="TBFG_00486"
FT   CDS_pept        580833..581438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10496"
FT                   /old_locus_tag="TBFG_00486"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0488"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04839"
FT                   /protein_id="ABR04839.1"
FT                   /translation="MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVG
FT                   GFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCL
FT                   VVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFAT
FT                   PAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII"
FT   gene            581595..582344
FT                   /locus_tag="TBFG_10497"
FT                   /old_locus_tag="TBFG_00487"
FT   CDS_pept        581595..582344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10497"
FT                   /old_locus_tag="TBFG_00487"
FT                   /product="phosphoglycerate mutase 1 gpm1"
FT                   /note="Mapped to H37Rv Rv0489"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04840"
FT                   /protein_id="ABR04840.1"
FT                   /translation="MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGEL
FT                   IAEHDLLPDVLYTSLLRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAET
FT                   KARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPY
FT                   FTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMR
FT                   PLVRGGTYLDPEAAAAGAAAVAGQGRG"
FT   gene            582518..583750
FT                   /locus_tag="TBFG_10498"
FT                   /old_locus_tag="TBFG_00488"
FT   CDS_pept        582518..583750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10498"
FT                   /old_locus_tag="TBFG_00488"
FT                   /product="two component system sensor histidine kinase
FT                   senX3"
FT                   /note="Mapped to H37Rv Rv0490"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04841"
FT                   /protein_id="ABR04841.1"
FT                   /translation="MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSG
FT                   ITVSQMLQCIVTLMPLGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGG
FT                   EDVEFDLSPRKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVA
FT                   NVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQG
FT                   AERLPNMTDVDVDTIVSEAISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLV
FT                   SNAIAYSPRGSLVSISRRRRGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATG
FT                   GSGLGLAIVKHVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRS
FT                   NRSQREEELSR"
FT   gene            583954..584637
FT                   /locus_tag="TBFG_10499"
FT                   /old_locus_tag="TBFG_00489"
FT   CDS_pept        583954..584637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10499"
FT                   /old_locus_tag="TBFG_00489"
FT                   /product="two component system sensor transduction protein
FT                   regX3"
FT                   /note="Mapped to H37Rv Rv0491"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04842"
FT                   /protein_id="ABR04842.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLE
FT                   YLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLG
FT                   YKLEG"
FT   gene            complement(584634..586523)
FT                   /locus_tag="TBFG_10500"
FT                   /old_locus_tag="TBFG_00490"
FT   CDS_pept        complement(584634..586523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10500"
FT                   /old_locus_tag="TBFG_00490"
FT                   /product="hypothetical oxidoreductase GMC-type"
FT                   /note="Mapped to H37Rv Rv0492c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04843"
FT                   /protein_id="ABR04843.1"
FT                   /translation="MSRLADRAKSYPLASFGAALLPPELGGPLPAQFVQRVDRYVTRLP
FT                   ATSRFAVRAGLASLAAASYLTTGRSLPRLHPDERARVLHRIAALSPEVAAAVEGLKAIV
FT                   LLANGADTYAHELLARAQEHDAARPDAELTVILSADSPSVTRADAVVVGSGAGGAMVAR
FT                   TLARAGLDVVVLEEGRRWTVEEFRSTHPVDRYAGLYRGAGATVALGRPAVVLPMGRAVG
FT                   GTTVVNSGTCFRPSLAVQRRWRDEFGLGLADPDQLGRRLDDAEQTLRVAPVPLEIMGRN
FT                   GRLLLQAAKSLGWRAAPIPRNAPGCRGCCQCAIGCPSNAKFGVHLNALPQACAAGARII
FT                   SWARVERILHRAGRAYGVRARRPDGTTLDVLADAVVVAAGATETPGLLRRSGLGGHPRL
FT                   GHNLALHPATMLAGLFDDDVFAWRGVLQSAAVHEFHESDGVLIEATSTPPGMGSMVFPG
FT                   YGAELLRWLDRAPQIATFGAMVADRGVGTVRSVRGETVVRYDIAPGEIAKLRVALQAIG
FT                   RLLFAAGAVEVLTGIPGAPPMRSLPELQDVLRRANPRSLHLAAFHPTGTAAAGADEQLC
FT                   PVDATGRLRGVEGVWVADASILPSCPEVNPQLSIMAMALAVADQTVAKVVGVR"
FT   gene            complement(586520..586849)
FT                   /locus_tag="TBFG_10501"
FT                   /old_locus_tag="TBFG_00491"
FT   CDS_pept        complement(586520..586849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10501"
FT                   /old_locus_tag="TBFG_00491"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0492A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04844"
FT                   /protein_id="ABR04844.1"
FT                   /translation="MSFLLDPPLLFVCGVLIERRLPVDRRDAAEAAALGVFFGASFGLY
FT                   HNVPGLGMLWRPFRAQNGRDFMWNSGVFSVDVARAEWPLHAMAAAIFATYPFFIKLGRR
FT                   LGRRI"
FT   gene            complement(586846..587835)
FT                   /locus_tag="TBFG_10502"
FT                   /old_locus_tag="TBFG_00492"
FT   CDS_pept        complement(586846..587835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10502"
FT                   /old_locus_tag="TBFG_00492"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0493c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04845"
FT                   /protein_id="ABR04845.1"
FT                   /translation="MGESTTQPAGGAAVDDETRSAALPRWRGAAGRLEVWYATLSDPLT
FT                   RTGLWVHCETVAPTTGGPYAHGWVTWFPPDAPPGTERFGSQPAQPAAGPAWFDIAGVRM
FT                   APAELTGRTRSLAWELSWKDTAAPLWTFPRVAWERELLPGAQVVIAPTAVFAGSLAVGE
FT                   TTHRVDSWRGSVAHIYGHGNAKRWGWIHADLGDGDVLEVVTAVSHKPGLRRLAPLAFVR
FT                   FRIDGKDWPASPLPSLRMRTTLGVRHWQLEGRIGGREALIRVDQPPERCVSLGYTDPDG
FT                   AKAVCTNTEQADIHIELGGRHWSVLGTGHAEVGLRGTAAPAIKEGTPA"
FT   gene            587840..588568
FT                   /locus_tag="TBFG_10503"
FT                   /old_locus_tag="TBFG_00493"
FT   CDS_pept        587840..588568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10503"
FT                   /old_locus_tag="TBFG_00493"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0494"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04846"
FT                   /protein_id="ABR04846.1"
FT                   /translation="MVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPE
FT                   RDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPD
FT                   FLVELLEIRAALGPLIGRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVL
FT                   IHSTRNRALGLLYRWVEHAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAAT
FT                   VEAYLNASALRMVKSYRDRA"
FT   gene            complement(588569..589459)
FT                   /locus_tag="TBFG_10504"
FT                   /old_locus_tag="TBFG_00494"
FT   CDS_pept        complement(588569..589459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10504"
FT                   /old_locus_tag="TBFG_00494"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0495c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04847"
FT                   /protein_id="ABR04847.1"
FT                   /translation="MWRPAQGARWHVPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQ
FT                   EVELDFAREWVEFYDPDNPEHLIAADLTWLLSRWACVFGTPACQGTVAGRPNDGCCSHG
FT                   AFLSDDDDRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGACIF
FT                   LNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTTLT
FT                   EYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADELTELLGEKAYGELAAMCKRRS
FT                   QLGLIAVHPATRAAQ"
FT   gene            589491..590525
FT                   /locus_tag="TBFG_10505"
FT                   /old_locus_tag="TBFG_00495"
FT   CDS_pept        589491..590525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10505"
FT                   /old_locus_tag="TBFG_00495"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0496"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04848"
FT                   /protein_id="ABR04848.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDAHRGGHPTPMSSTKATLRLAEATDSS
FT                   GKITKRGADKLISTIDEFAKIAISSGCAELMAFATSAVRDAENSEDVLSRVRKETGVEL
FT                   QALRGEDESRLTFLAVRRWYGWSAGRILNLDIGGGSLEVSSGVDEEPEIALSLPLGAGR
FT                   LTREWLPDDPPGRRRVAMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLARLTGA
FT                   APSMAGPRVKRTLTANGLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMR
FT                   ALSIEAVEICPWALREGLILRKLDSEADGTALIESSSVHTSVRAVGGQPADRNAANRSR
FT                   GSKP"
FT   gene            590522..591454
FT                   /locus_tag="TBFG_10506"
FT                   /old_locus_tag="TBFG_00496"
FT   CDS_pept        590522..591454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10506"
FT                   /old_locus_tag="TBFG_00496"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0497"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04849"
FT                   /protein_id="ABR04849.1"
FT                   /translation="MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAI
FT                   TVAELTGEIPIIRDDHHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTR
FT                   TVYWSQPEPRWPKSPPQDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEH
FT                   YPDLWVDVLDTEVGEAEAETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALD
FT                   VVPTLWRGALVVLQSILAVAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVR
FT                   KTEDIASTLIAVAVGALITLGPLALLQSG"
FT   gene            591470..592312
FT                   /locus_tag="TBFG_10507"
FT                   /old_locus_tag="TBFG_00497"
FT   CDS_pept        591470..592312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10507"
FT                   /old_locus_tag="TBFG_00497"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0498"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04850"
FT                   /protein_id="ABR04850.1"
FT                   /translation="MRPAIKVGLSTASVYPLRAEAAFEYADRLGYDGVELMVWGESVSQ
FT                   DIDAVRKLSRRYRVPVLSVHAPCLLISQRVWGANPILKLDRSVRAAEQLGAQTVVVHPP
FT                   FRWQRRYAEGFSDQVAALEAASTVMVAVENMFPFRADRFFGAGQSRERMRKRGGGPGPA
FT                   ISAFAPSYDPLDGNHAHYTLDLSHTATAGTDSLDMARRMGPGLVHLHLCDGSGLPADEH
FT                   LVPGRGTQPTAEVCQMLAGSGFVGHVVLEVSTSSARSANERESMLAESLQFARTHLLR"
FT   gene            592328..593203
FT                   /locus_tag="TBFG_10508"
FT                   /old_locus_tag="TBFG_00498"
FT   CDS_pept        592328..593203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10508"
FT                   /old_locus_tag="TBFG_00498"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0499"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04851"
FT                   /protein_id="ABR04851.1"
FT                   /translation="MNALFTTAMALRPLDSDPGNPACRVFEGELNEHWTIGPKVHGGAM
FT                   VALCANAARTAYGAAGQQPMRQPVAVSASFLWAPDPGTMRLVTSIRKRGRRISVADVEL
FT                   TQGGRTAVHAVVTLGEPEHFLPGVDGSGGASGTAPLLSANPVVELMAPEPPEGVVPIGP
FT                   GHQLAGLVHLGEGCDVRPVLSTLRSATDGRPPVIQLWARPRGVAPDALFALLCGDLSAP
FT                   VTFAVDRTGWAPTVALTAYLRALPADGWLRVLCTCVEIGQDWFDEDHIVVDRLGRIVVQ
FT                   TRQLAMVPAQ"
FT   gene            593228..594115
FT                   /locus_tag="TBFG_10509"
FT                   /old_locus_tag="TBFG_00499"
FT   CDS_pept        593228..594115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10509"
FT                   /old_locus_tag="TBFG_00499"
FT                   /product="pyrroline-5-carboxylate reductase proC"
FT                   /note="Mapped to H37Rv Rv0500"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10509"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04852"
FT                   /protein_id="ABR04852.1"
FT                   /translation="MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRAN
FT                   YLAQTYSVLVTSAADAVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVV
FT                   AGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGG
FT                   VLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAML
FT                   LERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQ
FT                   AAKSRSEQLRITPE"
FT   gene            594256..594492
FT                   /locus_tag="TBFG_10510"
FT                   /old_locus_tag="TBFG_00500"
FT   CDS_pept        594256..594492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10510"
FT                   /old_locus_tag="TBFG_00500"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0500A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04853"
FT                   /protein_id="ABR04853.1"
FT                   /translation="MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLV
FT                   HNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG"
FT   gene            594536..594721
FT                   /locus_tag="TBFG_10511"
FT   CDS_pept        594536..594721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10511"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0500B"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04854"
FT                   /protein_id="ABR04854.1"
FT                   /translation="MLGRCRFGVPCDRPGRVSGSDSRIDGGVMGSVIKKRRKRMSKKKH
FT                   RKLLRRTRVQRRKLGK"
FT   gene            594799..595929
FT                   /locus_tag="TBFG_10512"
FT                   /old_locus_tag="TBFG_00501"
FT   CDS_pept        594799..595929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10512"
FT                   /old_locus_tag="TBFG_00501"
FT                   /product="UDP-glucose 4-epimerase galE2"
FT                   /note="Mapped to H37Rv Rv0501"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04855"
FT                   /protein_id="ABR04855.1"
FT                   /translation="MSSSNGRGGAGGVGGSSEHPQYPKVVLVTGACRFLGGYLTARLAQ
FT                   NPLINRVIAVDAIAPSKDMLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHAAAASYA
FT                   PRSGGSAALKELNVMGAMQLFAACQKAPSVRRVVLKSTSEVYGSSPHDPVMFTEDSSSR
FT                   RPFSQGFPKDSLDIEGYVRALGRRRPDIAVTILRLANMIGPAMDTTLSRYLAGPLVPTI
FT                   FGRDARLQLLHEQDALGALERAAMAGKAGTFNIGADGILMLSQAIRRAGRIPVPVPGFG
FT                   VWALDSLRRANHYTELNREQFAYLSYGRVMDTTRMRVELGYQPKWTTVEAFDDYFRGRG
FT                   LTPIIDPHRVRSWEGRAVGLAQRWGSRNPIPWSGLR"
FT   gene            595936..597012
FT                   /locus_tag="TBFG_10513"
FT                   /old_locus_tag="TBFG_00502"
FT   CDS_pept        595936..597012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10513"
FT                   /old_locus_tag="TBFG_00502"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0502"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04856"
FT                   /protein_id="ABR04856.1"
FT                   /translation="MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPN
FT                   DRASAEQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDE
FT                   FGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSV
FT                   AVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEG
FT                   YKGLGKRFEDRYRLQRFGRGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFG
FT                   LPYFPITPLFPLAGPVGLVPLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRET
FT                   IQQTLYRLLAGRRNIFFG"
FT   gene            complement(597016..597984)
FT                   /locus_tag="TBFG_10514"
FT                   /old_locus_tag="TBFG_00503"
FT   CDS_pept        complement(597016..597984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10514"
FT                   /old_locus_tag="TBFG_00503"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase 2
FT                   cmaA2"
FT                   /note="Mapped to H37Rv Rv0503c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04857"
FT                   /protein_id="ABR04857.1"
FT                   /translation="MPMQRWRRLHRSSGESRVRSMTSQGDTTSGTQLKPPVEAVRSHYD
FT                   KSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWG
FT                   STMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEFDEPVDRIVS
FT                   LGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRMLLHTITIPDKEEAQELGLTSPMS
FT                   LLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERYHRIGANYVPTLNAWADALQAH
FT                   KDEAIALKGQETYDIYMHYLRGCSDLFRDKYTDVCQFTLVK"
FT   gene            complement(597947..598447)
FT                   /locus_tag="TBFG_10515"
FT                   /old_locus_tag="TBFG_00504"
FT   CDS_pept        complement(597947..598447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10515"
FT                   /old_locus_tag="TBFG_00504"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0504c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04858"
FT                   /protein_id="ABR04858.1"
FT                   /translation="MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSE
FT                   PDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILAND
FT                   KLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAI
FT                   ASI"
FT   gene            complement(598609..599730)
FT                   /locus_tag="TBFG_10516"
FT                   /old_locus_tag="TBFG_00505"
FT   CDS_pept        complement(598609..599730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10516"
FT                   /old_locus_tag="TBFG_00505"
FT                   /product="phosphoserine phosphatase serB1"
FT                   /note="Mapped to H37Rv Rv0505c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04859"
FT                   /protein_id="ABR04859.1"
FT                   /translation="MGLTCWPRTAAGRVHDESRCGLANFDTALGLQINPRQPRAPPRIC
FT                   RIGLITAAASATGQAPRLGVMMVSSHLGSPDQAGHVDLASPADPPPPDASASHSPVDMP
FT                   APVAAAGSDRQPPIDLTAAAFFDVDNTLVQGSSAVHFGRGLAARHYFTYRDVLGFLYAQ
FT                   AKFQLLGKENSNDVAAGRRKALAFIEGRSVAELVALGEEIYDEIIADKIWDGTRELTQM
FT                   HLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVGEILHGTGKAH
FT                   AVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINPDARLRSLARERGWEIRDFR
FT                   IARKAARIGVPSALALGAAGGALAALASRRQSR"
FT   gene            599904..600347
FT                   /locus_tag="TBFG_10517"
FT                   /old_locus_tag="TBFG_00506"
FT   CDS_pept        599904..600347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10517"
FT                   /old_locus_tag="TBFG_00506"
FT                   /product="membrane protein mmpS2"
FT                   /note="Mapped to H37Rv Rv0506"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04860"
FT                   /protein_id="ABR04860.1"
FT                   /translation="MRMISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTV
FT                   MVKPDFDVPLFNPKRVTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAV
FT                   SVNLMAQSNADVISCRIIVNGAVKDERSETSPRALTSCQVSSG"
FT   gene            600344..603250
FT                   /locus_tag="TBFG_10518"
FT                   /old_locus_tag="TBFG_00507"
FT   CDS_pept        600344..603250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10518"
FT                   /old_locus_tag="TBFG_00507"
FT                   /product="transmembrane transport protein mmpL2"
FT                   /note="Mapped to H37Rv Rv0507"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04861"
FT                   /protein_id="ABR04861.1"
FT                   /translation="MSERHAALTSLPPILPRLIRRFAVVIVLLWLGFTAFVNLAVPQLE
FT                   VVGKAHSVSMSPSDAASIQAIKRVGQVFGEFDSDNAVTIVLEGDQPLGGDAHRFYSDLM
FT                   RKLSADTRHVAHIQDFWGDPLTAAGSQSADDRAAYVVVYLVGNNETEAYDSVHAVRHMV
FT                   DTTPPPHGVKAYVTGPAALNADQAEAGDKSIAKVTAITSMVIAAMLLVIYRSVITAVLV
FT                   LIMVGIDLGAIRGFIALLADHNIFSLSTFATNLLVLMAIAASTDYAIFMLGRYHESRYA
FT                   GEDRETAFYTMFHGTAHVILGSGLTIAGAMYCLSFARLPYFETLGAPIAIGMLVAVLAA
FT                   LTLGPAVLTVGSFFKLFDPKRRMNTRRWRRVGTAIVRWPGPVLAATCLVASIGLLALPS
FT                   YRTTYDLRKFMPASMPSNVGDAAAGRHFSRARLNPEVLLIETDHDMRNPVDMLVLDKVA
FT                   KNIYHSPGIEQVKAITRPLGTTIKHTSIPFIISMQGVNSSEQMEFMKDRIDDILVQVAA
FT                   MNTSIETMHRMYALMGEVIDNTVDMDHLTHDMSDITATLRDHLADFEDFFRPIRSYFYW
FT                   EKHCFDVPLCWSIRSIFDMFDSVDQLSEKLEYLVKDMDILITLLPQMRAQMPPMISAMT
FT                   TMRDMMLIWHGTLGAFYKQQERNNKDPGAMGRVFDAAQIDDSFYLPQSAFENPDFKRGL
FT                   KMFLSPDGKAARFVIALEGDPATPEGISRVEPIKREAREAIKGTPLQGAAIYLGGTAAT
FT                   FKDIREGARYDLLIAGVAAISLILIIMMIITRSVVAAVVIVGTVVLSMGASFGLSVLVW
FT                   QDILGIELYWMVLAMSVILLLAVGSDYNLLLISRLKEEIGAGLNTGIIRAMAGTGGVVT
FT                   AAGMVFAVTMSLFVFSDLRIIGQIGTTIGLGLLFDTLVVRSFMTPSIAALLGRWFWWPL
FT                   RVRPRPASQMLRPFAPRRLVRALLLPSGQHPSATGAHE"
FT   gene            603243..603536
FT                   /locus_tag="TBFG_10519"
FT                   /old_locus_tag="TBFG_00508"
FT   CDS_pept        603243..603536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10519"
FT                   /old_locus_tag="TBFG_00508"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0508"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04862"
FT                   /protein_id="ABR04862.1"
FT                   /translation="MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAAS
FT                   TGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP"
FT   gene            603586..604992
FT                   /locus_tag="TBFG_10520"
FT                   /old_locus_tag="TBFG_00509"
FT   CDS_pept        603586..604992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10520"
FT                   /old_locus_tag="TBFG_00509"
FT                   /product="glutamyl-tRNA reductase hemA"
FT                   /note="Mapped to H37Rv Rv0509"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04863"
FT                   /protein_id="ABR04863.1"
FT                   /translation="MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAM
FT                   VLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVA
FT                   SGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGA
FT                   SVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRL
FT                   ARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATR
FT                   PLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYL
FT                   VGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHA
FT                   PTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDM
FT                   QSSPKRSPSN"
FT   gene            605002..605931
FT                   /locus_tag="TBFG_10521"
FT                   /old_locus_tag="TBFG_00510"
FT   CDS_pept        605002..605931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10521"
FT                   /old_locus_tag="TBFG_00510"
FT                   /product="porphobilinogen deaminase hemC"
FT                   /note="Mapped to H37Rv Rv0510"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04864"
FT                   /protein_id="ABR04864.1"
FT                   /translation="MIRIGTRGSLLATTQAATVRDALIAGGHSAELVTISTEGDRSMAP
FT                   IASLGVGVFTTALREAMEAGLVDAAVHSYKDLPTAADPRFTVAAIPPRNDPRDAVVARD
FT                   GLTLGELPVGSLVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNKVSSGDLDAIVVAR
FT                   AGLARLGRLDDVTETLEPVQMLPAPAQGALAVECRAGDSRLVAVLAELDDADTRAAVTA
FT                   ERALLADLEAGCSAPVGAIAEVVESIDEDGRVFEELSLRGCVAALDGSDVIRASGIGSC
FT                   GRARELGLSVAAELFELGARELMWGVRH"
FT   gene            605964..607661
FT                   /locus_tag="TBFG_10522"
FT                   /old_locus_tag="TBFG_00511"
FT   CDS_pept        605964..607661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10522"
FT                   /old_locus_tag="TBFG_00511"
FT                   /product="uroporphyrin-III C-methyltransferase hemD"
FT                   /note="Mapped to H37Rv Rv0511"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04865"
FT                   /protein_id="ABR04865.1"
FT                   /translation="MTRGRKPRPGRIVFVGSGPGDPGLLTTRAAAVLANAALVFTDPDV
FT                   PEPVVALIGTDLPPVSGPAPAEPVAGNGDAAGGGSAQEHGRAASAVVSGGPDIRPALGD
FT                   PADVAKTLTAEARSGVDVVRLVAGDPLTVDAVISEVNAVARTHLHIEIVPGLAASSAVP
FT                   TYAGLPLGSSHTVADVRIDPENTDWDALAAAPGPLILQATASHLAESARSLIDHQLAES
FT                   TPCVVTAHGTTCQQRSVETTLQGLTDPAVLGATDPACSANGRDSQAGPLIVTIGKTVTS
FT                   RAKLNWWESRALYGWTVLVPRTKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMER
FT                   AVKGLVDGRFQWIVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGI
FT                   SPELVPSGEQSSLGLLDDFPPYDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVT
FT                   AYRTVRAAPPPATTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAE
FT                   TAAEFGLRVDVQPDTAAIGPLVDALAEHAARLRAEGALPPPRKKSRRR"
FT   gene            607747..608736
FT                   /locus_tag="TBFG_10523"
FT                   /old_locus_tag="TBFG_00512"
FT   CDS_pept        607747..608736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10523"
FT                   /old_locus_tag="TBFG_00512"
FT                   /product="delta-aminolevulinic acid dehydratase hemB"
FT                   /note="Mapped to H37Rv Rv0512"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04866"
FT                   /protein_id="ABR04866.1"
FT                   /translation="MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGID
FT                   EPRPITSMPGVVQHTRDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGIL
FT                   NVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAE
FT                   SGAHVVGPSGMMDGQVAAIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGD
FT                   RRTYQQEPGNAAEALREIELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSG
FT                   EYAMIRAAAANNWIDERAAVLESLTGIRRAGADIVLTYWAVDAAGWLT"
FT   gene            608749..609297
FT                   /locus_tag="TBFG_10524"
FT                   /old_locus_tag="TBFG_00513"
FT   CDS_pept        608749..609297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10524"
FT                   /old_locus_tag="TBFG_00513"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0513"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04867"
FT                   /protein_id="ABR04867.1"
FT                   /translation="MTPTGDTKPKLLFYEPGASWYWVLTGPLAAVSVLLLEISSGAGVG
FT                   LITPAIFLVMVSAFVALQVKAARIHTSVELTHDALRQGTETIRLAEIVKIYPEADGRET
FT                   SGEEPAKWQSARTLGELVGVPRGRVGIGLKLTGGRTAQAWARRHQQLRAALTPLVQERL
FT                   GPVDSDVADVNGDDAGPAR"
FT   gene            609294..609593
FT                   /locus_tag="TBFG_10525"
FT                   /old_locus_tag="TBFG_00514"
FT   CDS_pept        609294..609593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10525"
FT                   /old_locus_tag="TBFG_00514"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0514"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04868"
FT                   /protein_id="ABR04868.1"
FT                   /translation="MIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTL
FT                   SVVYHPQPLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH"
FT   gene            609740..611206
FT                   /locus_tag="TBFG_10526"
FT                   /old_locus_tag="TBFG_00515"
FT   CDS_pept        609740..611206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10526"
FT                   /old_locus_tag="TBFG_00515"
FT                   /product="13E12 repeat family protein"
FT                   /note="Mapped to H37Rv Rv0515"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04869"
FT                   /protein_id="ABR04869.1"
FT                   /translation="MPCSADHEGVGGVHRSDLLGDSGRKPGRCGAVGGVGGVVRLSVVA
FT                   LRGREEWVMDTMAAVAAEVAAALRISQGLAASRLRYARAMRERLPKTAEVFSAGDIGYL
FT                   MFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMTKARLAGQVDKIVARADADAVRRR
FT                   KEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDARLSALAGTVCEHDPRSREQRRADA
FT                   LGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLIAEAATINGTGSAPASQMNADGLI
FT                   TAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALADFVRCRDLTCRWPGCDEPATNCD
FT                   LDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRDQQLPDGTLILTSPSGHTYVSTPG
FT                   SALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPKRRRTRAQDRAYRIATERRQNHAA
FT                   RQRAQVLTQTAAATDTHGPPPDHNDDPPPF"
FT   gene            complement(611203..611679)
FT                   /locus_tag="TBFG_10527"
FT                   /old_locus_tag="TBFG_00516"
FT   CDS_pept        complement(611203..611679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10527"
FT                   /old_locus_tag="TBFG_00516"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0516c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04870"
FT                   /protein_id="ABR04870.1"
FT                   /translation="MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRG
FT                   EIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALV
FT                   ASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA"
FT   gene            611890..613200
FT                   /locus_tag="TBFG_10528"
FT                   /old_locus_tag="TBFG_00517"
FT   CDS_pept        611890..613200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10528"
FT                   /old_locus_tag="TBFG_00517"
FT                   /product="hypothetical membrane acyltransferase"
FT                   /note="Mapped to H37Rv Rv0517"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04871"
FT                   /protein_id="ABR04871.1"
FT                   /translation="MAGGMDQPPGQPRRRTRQQSSDGKNGVRAAEITGEIRALTGLRIV
FT                   AAVWVVLFHFRPMLGDASPGFRDALAPVLDCGAQGVDLFFILSGFVLTWNYLDRMGRSW
FT                   SVRANLHFLWLRLARVWPVYLVTLHLAAVWVIFTLHVGHVPSPEAGQLTAISYVRQILL
FT                   VQLWFQPYFDGSSWDGPAWSISAEWLAYLLFGLLILVIFRMKHATRARGLMWLAFAASL
FT                   PPVVLLLASGQFYTPWSWLPRIVTQFAAGALACAAVRRLRPTDRARRIAGYLSVLVGVA
FT                   IVGILYLLHAHPLAGVEDSGGVVDVLFVPLVISLAIGVGSLPALLSTRLMVFGGQISFC
FT                   LYMVHELVHTAWGWAVQQYELALQDQPWKWNVVGLLAIALGAAILLYHFVEEPGRRWMR
FT                   RMVDVKAASARSEPGEPVGSTRYQIDDALEGVSARAV"
FT   gene            613332..614027
FT                   /locus_tag="TBFG_10529"
FT                   /old_locus_tag="TBFG_00518"
FT   CDS_pept        613332..614027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10529"
FT                   /old_locus_tag="TBFG_00518"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0518"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04872"
FT                   /protein_id="ABR04872.1"
FT                   /translation="MSRPGTYVIGLTLLVGLVVGNPGCPRSYRPLTLDYRLNPVAVIGD
FT                   SYTTGTDEGGLGSKSWTARTWQMLAARGVRIAADVAAEGRAGYGVPGDHGNVFEDLTAR
FT                   AVQPDDALVVFFGSRNDQGMDPEDPEMLAEKVRDTFDLARHRAPSASLLVIAPPWPTAD
FT                   VPGPMLRIRDVLGAQARAAGAVFVDPIADHWFVDRPELIGADGVHPNDAGHEYLADKIA
FT                   PLISMELVG"
FT   gene            complement(614316..615218)
FT                   /locus_tag="TBFG_10530"
FT                   /old_locus_tag="TBFG_00519"
FT   CDS_pept        complement(614316..615218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10530"
FT                   /old_locus_tag="TBFG_00519"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0519c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04873"
FT                   /protein_id="ABR04873.1"
FT                   /translation="MLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFG
FT                   ALVDPLEPQAAPAPFEPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQLRPV
FT                   IALHGKDGNAGMMLDLGVEQGLARLVKEGKPAFAVVGVDGGNTYWHRRSSGGDSGAMVL
FT                   DELLPMLTSMGMDTSRVGFLGWSMGGYGALLLGARLGPARTAGICAISPALFTSFTGST
FT                   PGAFDSYDDYVQHSVLGLPALNSIPLRVDCGTSDRFYFATRQFVNQLHQPPAGSFSPGG
FT                   HDASYWREQLPGELAWMAS"
FT   gene            615399..615749
FT                   /locus_tag="TBFG_10531"
FT                   /old_locus_tag="TBFG_00520"
FT   CDS_pept        615399..615749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10531"
FT                   /old_locus_tag="TBFG_00520"
FT                   /product="hypothetical methyltransferase"
FT                   /note="Mapped to H37Rv Rv0520"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04874"
FT                   /protein_id="ABR04874.1"
FT                   /translation="MGGCSITCLNISEVPNETNRKKNRQAGLDRSIRVIHGSFDDIPEP
FT                   DSGYDVVWSQDAILHAPDRRKVLEEAFRVLRPGGELIFTDPMQADDVPDGVLQPVYDRL
FT                   NLRDLGSMRFYA"
FT   gene            615742..616047
FT                   /locus_tag="TBFG_10532"
FT                   /old_locus_tag="TBFG_00521"
FT   CDS_pept        615742..616047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10532"
FT                   /old_locus_tag="TBFG_00521"
FT                   /product="hypothetical methyltransferase"
FT                   /note="Mapped to H37Rv Rv0521"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04875"
FT                   /protein_id="ABR04875.1"
FT                   /translation="MREAAQALGFEVLDQRDLVRNLRTHYSRVFEELEARRLELEGKSS
FT                   QEYLDKMRVGLKNWVEAADNGHSRVGHPTFPRTRLTPICQLPTAAIDSTAGRRRYR"
FT   gene            616182..617486
FT                   /locus_tag="TBFG_10533"
FT                   /old_locus_tag="TBFG_00522"
FT   CDS_pept        616182..617486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10533"
FT                   /old_locus_tag="TBFG_00522"
FT                   /product="gaba permease gabP (4-amino butyrate transport
FT                   carrier)"
FT                   /note="Mapped to H37Rv Rv0522"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10533"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04876"
FT                   /protein_id="ABR04876.1"
FT                   /translation="MIAIGGVIGAGLFVGSGVVIRATGPAAFLTYALCGALIVLVMRML
FT                   GEMAAANPSTGAFADYAAKALGGWAGFSVGWLYWYFWVIVVGFEAVAGGKVLTYWIDAP
FT                   LWLASLCLMMMMTATNLVSVSSFGEFEFWFAGVKVATIVGFLVLGTAFAFGLLPGHGMD
FT                   FSNLSAHGGFFPDGVGAVFAAIVVAIFSMTGTEVVTIAAAEAPDPQRAVQRAMSTVVAR
FT                   IVIFFVGSVFLLTVILPWNSLELGASPYVAALRHMGIGGADQIMNAVVLTAVLSCLNSG
FT                   LYTASRMLFVLAARQEAPAQLVKVNRRGVPTFAIMGSSVVGFLCVIMAWVSPATVFVFL
FT                   LNSSGAVILFVYLLIALSQIVLRRQTSGQNLGVRMWLFPGLSIVTVTGIVAVLARMAFD
FT                   YAARSQLWLSLLSWAVVVGCYLVTTLVRRPLNRPW"
FT   gene            complement(617470..617865)
FT                   /locus_tag="TBFG_10534"
FT                   /old_locus_tag="TBFG_00523"
FT   CDS_pept        complement(617470..617865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10534"
FT                   /old_locus_tag="TBFG_00523"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0523c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04877"
FT                   /protein_id="ABR04877.1"
FT                   /translation="MQLPQWLARFNRYVTNPIQRLWAGWLPAFAILEHVGRRSGKPYRT
FT                   PLNVFSADVDGRAGVAILLTYGPNRDWLKNITAAGGGRMRRYGKTFGVANPRRLTKAEA
FT                   APYVSSRWRPVFARLPFDEAVLLTKAD"
FT   gene            617979..619367
FT                   /locus_tag="TBFG_10535"
FT                   /old_locus_tag="TBFG_00524"
FT   CDS_pept        617979..619367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10535"
FT                   /old_locus_tag="TBFG_00524"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase hemL"
FT                   /note="Mapped to H37Rv Rv0524"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04878"
FT                   /protein_id="ABR04878.1"
FT                   /translation="MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGG
FT                   TPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTP
FT                   AETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDAL
FT                   LADAGSGVATLGLCDDPQRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQT
FT                   FARFGEQIAAVITEASPGNMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVSRSG
FT                   WYGIDPVPADLFAFGKVMSGGMPAAAFGGRAEVMQRLAPLGPVYQAGTLSGNPVAVAAG
FT                   LATLRAADDAVYTALDANADRLAGLLSEALTDAVVPHQISRAGNMLSVFFGETPVTDFA
FT                   SARASQTWRYPAFFHAMLDAGVYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQ
FT                   ERPA"
FT   gene            619367..619975
FT                   /locus_tag="TBFG_10536"
FT                   /old_locus_tag="TBFG_00525"
FT   CDS_pept        619367..619975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10536"
FT                   /old_locus_tag="TBFG_00525"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0525"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04879"
FT                   /protein_id="ABR04879.1"
FT                   /translation="MPEETQVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAAAVADA
FT                   LADRDIVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDGAWRD
FT                   PRVWWQLRNPFTPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVSHQLPVWTLRLYLT
FT                   GKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPAAL"
FT   gene            619990..620640
FT                   /locus_tag="TBFG_10537"
FT                   /old_locus_tag="TBFG_00526"
FT   CDS_pept        619990..620640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10537"
FT                   /old_locus_tag="TBFG_00526"
FT                   /product="thioredoxin"
FT                   /note="Mapped to H37Rv Rv0526"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04880"
FT                   /protein_id="ABR04880.1"
FT                   /translation="MQSRATRRSGALTMRRLVIAAAVSALLLTGCSGRDAVAQGGTFEF
FT                   VSPGGKTDIFYDPPASRGRPGPLSGPELADPARSVSLDDFPGQVVVVNVWGQWCGPCRA
FT                   EVSQLQRVYDATRGAGVSFLGIDVRDNNRQAPQDFINDRHVTYPSIYDPAMRTLIAFGG
FT                   KYPTSVIPSTLVLDRQHRVAAVFLRELLAADLQPVVERVAEEEPSGRAPVGAQ"
FT   gene            620637..621416
FT                   /locus_tag="TBFG_10538"
FT                   /old_locus_tag="TBFG_00527"
FT   CDS_pept        620637..621416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10538"
FT                   /old_locus_tag="TBFG_00527"
FT                   /product="cytochrome C-type biogenesis protein ccdA"
FT                   /note="Mapped to H37Rv Rv0527"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04881"
FT                   /protein_id="ABR04881.1"
FT                   /translation="MTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDEQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTTLITNQLL
FT                   LQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPVLGAVFALGWTPCLGPTL
FT                   TGVITVASATEGASVARGIVLVIAYCLGLGIPFVLLAFGSAWAVAGLGWLRRHTRAIQI
FT                   FGGALLIAVGAALVTGVWNDVVSWLRDAFVSDVRLPI"
FT   gene            621449..623038
FT                   /locus_tag="TBFG_10539"
FT                   /old_locus_tag="TBFG_00528"
FT   CDS_pept        621449..623038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10539"
FT                   /old_locus_tag="TBFG_00528"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0528"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04882"
FT                   /protein_id="ABR04882.1"
FT                   /translation="MWRSLTSMGTALVLLFLLALAAIPGALLPQRGLNAAKVDDYLAAH
FT                   PLIGPWLDELQAFDVFSSFWFTAIYVLLFVSLVGCLAPRTIEHARSLRATPVAAPRNLA
FT                   RLPKHAHARLAGEPAALAATITGRLRGWRSITRQQGDSVEVSAEKGYLREFGNLVFHFA
FT                   LLGLLVAVAVGKLFGYEGNVIVIADGGPGFCSASPAAFDSFRAGNTVDGTSLHPICVRV
FT                   NNFQAHYLPSGQATSFAADIDYQADPATADLIANSWRPYRLQVNHPLRVGGDRVYLQGH
FT                   GYAPTFTVTFPDGQTRTSTVQWRPDNPQTLLSAGVVRIDPPAGSYPNPDERRKHQIAIQ
FT                   GLLAPTEQLDGTLLSSRFPALNAPAVAIDIYRGDTGLDSGRPQSLFTLDHRLIEQGRLV
FT                   KEKRVNLRAGQQVRIDQGPAAGTVVRFDGAVPFVNLQVSHDPGQSWVLVFAITMMAGLL
FT                   VSLLVRRRRVWARITPTTAGTVNVELGGLTRTDNSGWGAEFERLTGRLLAGFEARSPDM
FT                   AEAAAGTGRDVD"
FT   gene            623035..624009
FT                   /locus_tag="TBFG_10540"
FT                   /old_locus_tag="TBFG_00529"
FT   CDS_pept        623035..624009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10540"
FT                   /old_locus_tag="TBFG_00529"
FT                   /product="cytochrome C-type biogenesis protein ccsA"
FT                   /note="Mapped to H37Rv Rv0529"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04883"
FT                   /protein_id="ABR04883.1"
FT                   /translation="MNTLHVNVGLARYSDWAFTSAVVALVVALLLLAFEFAQVRGRGLA
FT                   PLAVPAGSVATDSATPGIVADQRHRPFDERVGRGGLAVAYLGIGLLLACVVLRGLATQR
FT                   VPWGNMYEFINLTCLSGLIAGAVVLRRARYRPLWVFLLVPVLILLTVSGRWLYANAAPV
FT                   MPALQSYWLPIHVSVVSLGSGVFLVAGVASILFLVRTSRLGEPTGEGALAGMVRRLPDA
FT                   QTLDGIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFVAWVVYAAYLHA
FT                   RSTAGWRDRKAAWINVAGFVAMVFNLFFVNLVTVGLHSYAGVG"
FT   gene            624051..625268
FT                   /locus_tag="TBFG_10541"
FT                   /old_locus_tag="TBFG_00530"
FT   CDS_pept        624051..625268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10541"
FT                   /old_locus_tag="TBFG_00530"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0530"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10541"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04884"
FT                   /protein_id="ABR04884.1"
FT                   /translation="MLVTEHPRTGVGAPDSGNGGTDHPTVQLPPVPSVGAPPAAAGGET
FT                   PTRSVAGFRTQRLDPTAYGAYYSGPDEGPASPAERPPYRLEPVPHTPYPELATTTLLRP
FT                   VKPPPSEGWRRLLYLLSGRLINAGEGPRAAHLNDLVAQVNRPLRGCYRIAVLSLKGGVG
FT                   KTTITATLGATFADLRGDRVVAVDANPDRGTLSQKVPLETPATVRHLLRDADGIERYSD
FT                   VRGYTSKGPSGLEVLASDSDPASSDAFSADDYTRTLDILERFYGLVLTDCGTGLLHSAM
FT                   SAVLPRSDVLVVVSSGSIDGARSAAATLDWLQAHGHDDQVRNSIAVVNAVRPRAGKVDV
FT                   GKVVEHFSRRCRAVRVVPFDPHLEEGAEIALDRLRRETREALTELAAVVAAGFPGDPRR
FT                   CKPSFT"
FT   gene            625473..625790
FT                   /locus_tag="TBFG_10542"
FT                   /old_locus_tag="TBFG_00532"
FT   CDS_pept        625473..625790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10542"
FT                   /old_locus_tag="TBFG_00532"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0531"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04885"
FT                   /protein_id="ABR04885.1"
FT                   /translation="MSEAPNDKTTRGVVDILVYATARLLLVVAVSAAIFGVARLIGLTE
FT                   FPVVVATLFGLIIAMPLGIWVFSPLRRRATAALAVAGERRRAERERLRARLRGESLPEE
FT                   Q"
FT   gene            625937..627805
FT                   /locus_tag="TBFG_10543"
FT                   /old_locus_tag="TBFG_00533"
FT   CDS_pept        625937..627805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10543"
FT                   /old_locus_tag="TBFG_00533"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0532"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04886"
FT                   /protein_id="ABR04886.1"
FT                   /translation="MSNLLVTPELVAAAAADLAGIGSAIGAANAAAGAPTMALLAAGAD
FT                   EVSAAVAAVFSSYAQQYQALSAAAAAFHDQFVRALAAGAGAYAGAEAANVEQQLLNAIN
FT                   APTLALLGRPLIGNGADGAAGTGQAGGAGGLLYGNGGNGGSGAAGQAGGAGGAAGLIGH
FT                   GGTGGVGGTGAAGGAGGTGGWLFGNGGAGGTGGAVTGVSTTGGPGGHGGDAGLYGFGGA
FT                   GGAGGFGQSGAAGGAGGAGGWLYGDGGDGGAGGNGGNESGTGVSGVGGVGGAGGAGGLL
FT                   FGNGGDGGVGGDGGDGSSTQDSGGDGGAGGAGGAGGWLLGNGGAGGAGGAASIKVATGG
FT                   LGGDGGDAGLFGFGGDGGWGGRGVDARFGAAGGAAGAGGAGGWLYGDGGAGGVGGVGGA
FT                   VFSLSSGDGGAGGAGGGGGWLFGNGGDGGAGGGGGGRFGSGSGAGGDGAVGGAGGAGAW
FT                   FGNGGAGGVGGGGGRGTTAIGGDGGAGGAGGAGGWLYGDGGAGGAGGGGGRGGTGNDGG
FT                   DGGDGGRGGDAQLLGNGGDGGAGGAGGPAGLALPPGPARPAGAAVPAVRCSAAPARPAR
FT                   TADPWLAPIFARSTLRHSHHLGGIAQTGAVADQQGQIAGLGRAGRQ"
FT   gene            complement(627701..628708)
FT                   /locus_tag="TBFG_10544"
FT                   /old_locus_tag="TBFG_00534"
FT   CDS_pept        complement(627701..628708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10544"
FT                   /old_locus_tag="TBFG_00534"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III
FT                   fabH"
FT                   /note="Mapped to H37Rv Rv0533c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10544"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04887"
FT                   /protein_id="ABR04887.1"
FT                   /translation="MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYT
FT                   RTGIKTRRFAADDESAASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMV
FT                   AASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGN
FT                   CFIFADGAAAVVVGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLE
FT                   GPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVA
FT                   NDIEHTGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPKG"
FT   gene            complement(628790..629668)
FT                   /locus_tag="TBFG_10545"
FT                   /old_locus_tag="TBFG_00535"
FT   CDS_pept        complement(628790..629668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10545"
FT                   /old_locus_tag="TBFG_00535"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase
FT                   menA"
FT                   /note="Mapped to H37Rv Rv0534c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10545"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04888"
FT                   /protein_id="ABR04888.1"
FT                   /translation="MASFAQWVSGARPRTLPNAIAPVVAGTGAAAWLHAAVWWKALLAL
FT                   AVAVALVIGVNYANDYSDGIRGTDDDRVGPVRLVGSRLATPRSVLTAAMTSLALGALAG
FT                   LVLALLSAPWLIAVGAICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQA
FT                   LRVDWVGLAQAVATGALSCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLLA
FT                   VAGVLTFVLMLATPWCVVGLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALA
FT                   VAGALAFGQLS"
FT   gene            629685..630479
FT                   /locus_tag="TBFG_10546"
FT                   /old_locus_tag="TBFG_00536"
FT   CDS_pept        629685..630479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10546"
FT                   /old_locus_tag="TBFG_00536"
FT                   /product="5-methylthioadenosine phosphorylase pnp"
FT                   /note="Mapped to H37Rv Rv0535"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04889"
FT                   /protein_id="ABR04889.1"
FT                   /translation="MHNNGRMLGVIGGSGFYTFFGSDTRTVNSDTPYGQPSAPITIGTI
FT                   GVHDVAFLPRHGAHHQYSAHAVPYRANMWALRALGVRRVFGPCAVGSLDPELEPGAVVV
FT                   PDQLVDRTSGRADTYFDFGGVHAAFADPYCPTLRAAVTGLPGVVDGGTMVVIQGPRFST
FT                   RAESQWFAAAGCNLVNMTGYPEAVLARELELCYAAIALVTDVDAGVAAGDGVKAADVFA
FT                   AFGENIELLKRLVRAAIDRVADERTCTHCQHHAGVPLPFELP"
FT   gene            630476..631516
FT                   /locus_tag="TBFG_10547"
FT                   /old_locus_tag="TBFG_00537"
FT   CDS_pept        630476..631516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10547"
FT                   /old_locus_tag="TBFG_00537"
FT                   /product="UDP-glucose 4-epimerase galE3"
FT                   /note="Mapped to H37Rv Rv0536"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04890"
FT                   /protein_id="ABR04890.1"
FT                   /translation="MRVLLTGAAGFIGSRVDAALRAAGHDVVGVDALLPAAHGPNPVLP
FT                   PGCQRVDVRDASALAPLLAGVDLVCHQAAMVGAGVNAADAPAYGGHNDFATTVLLAQMF
FT                   AAGVRRLVLASSMVVYGQGRYDCPQHGPVDPLPRRRADLDNGVFEHRCPGCGEPVIWQL
FT                   VDEDAPLRPRSLYAASKTAQEHYALAWSEASGGSVVALRYHNVYGPGMPRDTPYSGVAA
FT                   IFRSAVEKGKPPKVFEDGGQMRDFVHVDDVAAANLAAVHLGEADRDGFTAVNVCSGRPI
FT                   SILQVATAICDARGGSMSPAITGHYRSGDVRHIVADPARAARVLGFRAAVDPGEGLREF
FT                   AFAPLR"
FT   gene            complement(631526..632959)
FT                   /locus_tag="TBFG_10548"
FT                   /old_locus_tag="TBFG_00538"
FT   CDS_pept        complement(631526..632959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10548"
FT                   /old_locus_tag="TBFG_00538"
FT                   /product="hypothetical integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0537c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04891"
FT                   /protein_id="ABR04891.1"
FT                   /translation="MGLSSDDTRRREVVRDLAAGALLIGALFFPWNLYFGFRIPDSSKT
FT                   VFGLLLAVTSLSLASLAVTFAGRRSQLRLGLNVPYLLLVLAFVVFDAIQTIRLGGTVHV
FT                   PGGVGPGGWLGITGALLSAQPALTGATTDEGSHSRWLRATQFLGYASMLGAALSTGFNL
FT                   SWRVRYALEPAAGASGFGKQNLAVIDTAVVYGVVALAAVLVASRWLLRPTAAEALSTVA
FT                   LGGSTLIAGSIVWSLPIGREIDAFHGIAQNTSTAGVGYEGYLVWAAAAAMCAPLTLFRS
FT                   PNAPPIDKTVWRAASRNGLLLIAVWCLGSVAMRLTDLVVAVLLNYPFSRYDSMALAAFD
FT                   LATAVLAIWLRFNMATEALPARLISSLCGLLCTFTVSRVIVGVVLAPRFQASSGGSAHP
FT                   VYGNDLAQQITSTFDVVLCGLALSILAAAIVIGRLRQLPQPPHTPALSRPAGSPRIFRS
FT                   AGSTHPVRPKIYRPPDHSS"
FT   gene            633268..634914
FT                   /locus_tag="TBFG_10549"
FT                   /old_locus_tag="TBFG_00539"
FT   CDS_pept        633268..634914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10549"
FT                   /old_locus_tag="TBFG_00539"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0538"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04892"
FT                   /protein_id="ABR04892.1"
FT                   /translation="MDVALGVAVTDRVARLALVDSAAPGTVIDQFVLDVAEHPVEVLTE
FT                   TVVGTDRSLAGENHRLVATRLCWPDQAKADELQHALQDSGVHDVAVISEAQAATALVGA
FT                   AHAGSAVLLVGDETATLSVVGDPDAPPTMVAVAPVAGADATSTVDTLMARLGDQALAPG
FT                   DVFLVGRSAEHTTVLADQLRAASTMRVQTPDDPTFALARGAAMAAGAATMAHPALVADA
FT                   TTSLPPAEAGQSGSEGEQLAYSQASDYELLPVDEYEEHDEYGAAADRSAPLSRRSLLIG
FT                   NAVVAFAVIGFASLAVAVAVTIRPTAASKPVEGHQNAQPGKFMPLLPTQQQAPVPPPPP
FT                   DDPTAGFQGGTIPAVQNVVPRPGTSPGVGGTPASPAPEAPAVPGVVPAPVPIPVPIIIP
FT                   PFPGWQPGMPTIPTAPPTTPVTTSATTPPTTPPTTPVTTPPTTPPTTPVTTPPTTPPTT
FT                   PVTTPPTTVAPTTVAPTTVAPTTVAPTTVAPATATPTTVAPQPTQQPTQQPTQQMPTQQ
FT                   QTVAPQTVAPAPQPPSGGRNGSGGGDLFGGF"
FT   gene            634971..635603
FT                   /locus_tag="TBFG_10550"
FT                   /old_locus_tag="TBFG_00540"
FT   CDS_pept        634971..635603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10550"
FT                   /old_locus_tag="TBFG_00540"
FT                   /product="hypothetical dolichyl-phosphate sugar synthase"
FT                   /note="Mapped to H37Rv Rv0539"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04893"
FT                   /protein_id="ABR04893.1"
FT                   /translation="MLPCLNEEESLPAVLAAIPAGYRALVVDNNSTDDTATVAARHGAQ
FT                   VVVEPRPGYGSAVHAGVLAATTPIVAVIDADGSMDAGDLPKLVAELDKGADLVTGRRRP
FT                   VAGLHWPWVARVGTVVMSWRLRTRHRLPVHDIAPMRVARREALLDLGVVDRRSGYPLEL
FT                   LVRAAAAGWRVVELDVSYGPRTGGKSKVSGSLRGSIIAILDFWKVIS"
FT   gene            635600..636262
FT                   /locus_tag="TBFG_10551"
FT                   /old_locus_tag="TBFG_00541"
FT   CDS_pept        635600..636262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10551"
FT                   /old_locus_tag="TBFG_00541"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0540"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04894"
FT                   /protein_id="ABR04894.1"
FT                   /translation="MSCLPVSVLVVAKAPEPGRVKTRLAAAIGDKVAADIAAAALLDTL
FT                   DAVAAAPVTARAVALTGDLDSAADSAEIRRRLKSFTVFRQRGDAFADRLANAHVDAADG
FT                   YPVLQIGMDTPQVTAELLADCARLLLQIPAVLGLAFDGGWWVLGIRTPTAAECLRAVPM
FT                   SQPDTGELTLKALRDNGIDVTLVQRLGDFDIVDDIALVRDCCAPGSRFAQATRAAGL"
FT   gene            complement(636283..637632)
FT                   /locus_tag="TBFG_10552"
FT                   /old_locus_tag="TBFG_00542"
FT   CDS_pept        complement(636283..637632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10552"
FT                   /old_locus_tag="TBFG_00542"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0541c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04895"
FT                   /protein_id="ABR04895.1"
FT                   /translation="MRIGRREGLAVAIGFVLVGAAFVLPRLNLGIKPRSDIGLERFATR
FT                   AGAAPIFGYWDAHVGWGTAPAVLTAVAVVAWGPVVAHRLPWRVLTLSTWATAAAWAFSL
FT                   AMIDGWQRGFAGRLTTRDEYLWQVPGIADIPATLRTFTSRILDFQPNSWVTHVSGHPPG
FT                   ALLTFVWLDRIGLRGGGWAGLVCLLVGSSAAAAVLIAVRVLASEQMARRTAPFVAVAPT
FT                   AIWIAVSADGYFAGVAAWGIALLAVAVHGATRFPALVAAGAGLLLGWGVFLNYGLVLIV
FT                   LPGMAVLAAADWRPVLRALGPAVLAALVVAVSFAVAGFSWFDGYTLVQQRYWQGIAKDR
FT                   PFGYWSWANLACVVCAIGLGSVAGLSRVFDRAAISRRSGCHLLLLAVLAAIALADLSML
FT                   SKAETERIWLPFTIWLTAAPALLPPRSHRLWLAVNAAGALLLNSIIFTNW"
FT   gene            complement(637644..638732)
FT                   /locus_tag="TBFG_10553"
FT                   /old_locus_tag="TBFG_00543"
FT   CDS_pept        complement(637644..638732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10553"
FT                   /old_locus_tag="TBFG_00543"
FT                   /product="O-succinylbenzoic acid-CoA ligase menE"
FT                   /note="Mapped to H37Rv Rv0542c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04896"
FT                   /protein_id="ABR04896.1"
FT                   /translation="MLGGSDPALVAVPTQHESLLGALRVGEQIDDDVALVVTTSGTTGP
FT                   PKGAMLTAAALTASASAAHDRLGGPGSWLLAVPPYHIAGLAVLVRSVIAGSVPVELNVS
FT                   AGFDVTELPNAIKRLGSGRRYTSLVAAQLAKALTDPAATAALAELDAVLIGGGPAPRPI
FT                   LDAAAAAGITVVRTYGMSETSGGCVYDGVPLDGVRLRVLAGGRIAIGGATLAKGYRNPV
FT                   SPDPFAEPGWFHTDDLGALESGDSGVLTVLGRADEAISTGGFTVLPQPVEAALGTHPAV
FT                   RDCAVFGLADDRLGQRVVAAIVVGDGCPPPTLEALRAHVARTLDVTAAPRELHVVNVLP
FT                   RRGIGKVDRAALVRRFAGEADQ"
FT   gene            complement(638801..639103)
FT                   /locus_tag="TBFG_10554"
FT                   /old_locus_tag="TBFG_00544"
FT   CDS_pept        complement(638801..639103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10554"
FT                   /old_locus_tag="TBFG_00544"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0543c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04897"
FT                   /protein_id="ABR04897.1"
FT                   /translation="MNRFLTSIVAWLRAGYPEGIPPTDSFAVLALLCRRLSHDEVKAVA
FT                   NELMRLGDFDQIDIGVVITHFTDELPSPEDVERVRARLAAQGWPLDDVRDREEHA"
FT   gene            complement(639163..639441)
FT                   /locus_tag="TBFG_10555"
FT                   /old_locus_tag="TBFG_00545"
FT   CDS_pept        complement(639163..639441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10555"
FT                   /old_locus_tag="TBFG_00545"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0544c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04898"
FT                   /protein_id="ABR04898.1"
FT                   /translation="MSAWFNYTATLKILIFSLLAGALLPGLFAVGVRLQAAGDGADATA
FT                   RRRPLLVAVSWAIFALVLAVVIIGVLYIARDFIAHHTGWAFLGATPK"
FT   gene            complement(639438..640691)
FT                   /locus_tag="TBFG_10556"
FT                   /old_locus_tag="TBFG_00546"
FT   CDS_pept        complement(639438..640691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10556"
FT                   /old_locus_tag="TBFG_00546"
FT                   /product="low affinity inorganic phosphate transporter
FT                   integral membrane protein pitA"
FT                   /note="Mapped to H37Rv Rv0545c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04899"
FT                   /protein_id="ABR04899.1"
FT                   /translation="MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVA
FT                   VALSAVLNLIGAFLSTAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSS
FT                   SSHALIGGIVGATIAAVGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRG
FT                   VAEKRTERGFRRGQIGSASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVI
FT                   VSCAVAMAAGTYLGGWRIIRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQ
FT                   VATGSVLGSGVGKPGAEVRWGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAIL
FT                   GFALLWLTATAIWLRSRRAPIDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPT
FT                   PPPNHRAPQFGVTTRNAP"
FT   gene            complement(640811..641197)
FT                   /locus_tag="TBFG_10557"
FT                   /old_locus_tag="TBFG_00547"
FT   CDS_pept        complement(640811..641197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10557"
FT                   /old_locus_tag="TBFG_00547"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0546c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10557"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04900"
FT                   /protein_id="ABR04900.1"
FT                   /translation="MEILASRMLLRPADYQRSLSFYRDQIGLAIAREYGAGTVFFAGQS
FT                   LLELAGYGEPDHSRGPFPGALWLQVRDLEATQTELVSRGVSIAREPRREPWGLHEMHVT
FT                   DPDGITLIFVEVPEGHPLRTDTRA"
FT   gene            complement(641260..642144)
FT                   /locus_tag="TBFG_10558"
FT                   /old_locus_tag="TBFG_00548"
FT   CDS_pept        complement(641260..642144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10558"
FT                   /old_locus_tag="TBFG_00548"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0547c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04901"
FT                   /protein_id="ABR04901.1"
FT                   /translation="MSKRPLRWLTEQITLAGMRPPISPQLLINRPAMQPVDLTGKRILL
FT                   TGASSGIGAAATKQFGLHRAVVVAVARRKDLLDAVADRITGDGGTAMSLPCDLSDMEAI
FT                   DALVEDVEKRIGGIDILINNAGRSIRRPLAESLERWHDVERTMVLNYYAPLRLIRGLAP
FT                   GMLERGDGHIINVATWGVLSEASPLFSVYNASKAALSAVSRIIETEWGSQGVHSTTLYY
FT                   PLVATPMIAPTKAYDGLPALTAAEAAEWMVTAARTRPVRIAPRVAVAVNALDSIGPRWV
FT                   NALMQRRNEQLNP"
FT   gene            complement(642240..643184)
FT                   /locus_tag="TBFG_10559"
FT                   /old_locus_tag="TBFG_00549"
FT   CDS_pept        complement(642240..643184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10559"
FT                   /old_locus_tag="TBFG_00549"
FT                   /product="naphthoate synthase menB"
FT                   /note="Mapped to H37Rv Rv0548c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04902"
FT                   /protein_id="ABR04902.1"
FT                   /translation="MVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDD
FT                   ATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSG
FT                   GDQRIRGRSGYQYASGDTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGH
FT                   SLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAE
FT                   QMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGE
FT                   ATRLAYMTDEAVEGRDAFLQKRPPDWSPFPRYF"
FT   gene            complement(643456..643869)
FT                   /locus_tag="TBFG_10560"
FT                   /old_locus_tag="TBFG_00550"
FT   CDS_pept        complement(643456..643869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10560"
FT                   /old_locus_tag="TBFG_00550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0549c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04903"
FT                   /protein_id="ABR04903.1"
FT                   /translation="MRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAP
FT                   AHFDAEVLSALGRMQRAGALTVAYVDAALEELRQVPVTRHGLSSLLAGAWSRRDTLRLT
FT                   DALYVELAETAGLVLLTTDERLARAWPSAHAIG"
FT   gene            complement(644324..646039)
FT                   /locus_tag="TBFG_10561"
FT                   /old_locus_tag="TBFG_00552"
FT   CDS_pept        complement(644324..646039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10561"
FT                   /old_locus_tag="TBFG_00552"
FT                   /product="fatty-acid-CoA ligase fadD8"
FT                   /note="Mapped to H37Rv Rv0551c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04904"
FT                   /protein_id="ABR04904.1"
FT                   /translation="MSTAGDDAVGVPPACGGRSDAVGVPQLARESGAMRDQDCSGELLR
FT                   SPTHNGHLLVGALKRHQNKPVLFLGDTRLTGGQLADRISQYIQAFEALGAGTGVAVGLL
FT                   SLNRPEVLMIIGAGQARGYRRTALHPLGSLADHAYVLNDAGISSLIIDPNPMFVERALA
FT                   LLEQVDSLQQILTIGPVPDALKHVAVDLSAEAAKYQPQPLVAADLPPDQVIGLTYTGGT
FT                   TGKPKGVIGTAQSIATMTSIQLAEWEWPANPRFLMCTPLSHAGAAFFTPTVIKGGEMIV
FT                   LAKFDPAEVLRIIEEQRITATMLVPSMLYALLDHPDSHTRDLSSLETVYYGASAINPVR
FT                   LAEAIRRFGPIFAQYYGQSEAPMVITYLAKGDHDEKRLTSCGRPTLFARVALLDEHGKP
FT                   VKQGEVGEICVSGPLLAGGYWNLPDETSRTFKDGWLHTGDLAREDSDGFYYIVDRVKDM
FT                   IVTGGFNVFPREVEDVVAEHPAVAQVCVVGAPDEKWGEAVTAVVVLRSNAARDEPAIEA
FT                   MTAEIQAAVKQRKGSVQAPKRVVVVDSLPLTGLGKPDKKAVRARFWEGAGRAVG"
FT   gene            646108..647721
FT                   /locus_tag="TBFG_10562"
FT                   /old_locus_tag="TBFG_00553"
FT   CDS_pept        646108..647721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10562"
FT                   /old_locus_tag="TBFG_00553"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0552"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04905"
FT                   /protein_id="ABR04905.1"
FT                   /translation="MEPMADADLVMTGTVLTVDDARPTAEAIAVADGRVIAVGDRSEVA
FT                   GLVGANTRVIDLGAGCVMPGFVEAHGHPLLEAVVLSDRFVDIRPVTMRDADDVVAAIRG
FT                   EVARRGPAGAYLVGWDPLLQSGLGEPTLTWLDSLAPNGPLVIIHNSGHKAYFNSHAAWL
FT                   NGLTRDTADPKGAKYGRDGNGELDGTAEEIGAILPLLAGVADPSNFGAMLRAECARLNR
FT                   AGLTTCSEMAFDPGYRPMVEAVRAELTVRLCTYEISNARMCTDATPGQGDDMLRQVGIK
FT                   IWVDGSPWVGNIDLTFPYLDTPATRAIGVPPGSRGCANYTREQLAEIVGAYFPRGWQIA
FT                   CHVHGDGGVDTILDVYEEALRRNPRDDHRLRLEHVGAIRPDQLRRAAELGVTCSIFVDQ
FT                   IHYWGDVIVDDLFGAQRGSRWMPAGSAVAAGMRISLHNDPPVTPEEPLRNISVAATRVA
FT                   PSGRVLAPEERLTVEQAIRAQTIDAAWQLFAEDAIGSLQVGKYADMVVLSADPRTVPPE
FT                   QIADLAVRATFLAGRQVYRR"
FT   gene            647718..648698
FT                   /locus_tag="TBFG_10563"
FT                   /old_locus_tag="TBFG_00554"
FT   CDS_pept        647718..648698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10563"
FT                   /old_locus_tag="TBFG_00554"
FT                   /product="muconate cycloisomerase menC"
FT                   /note="Mapped to H37Rv Rv0553"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10563"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04906"
FT                   /protein_id="ABR04906.1"
FT                   /translation="MIPVLPPLEALLDRLYVVALPMRVRFRGITTREVALIEGPAGWGE
FT                   FGAFVEYQSAQACAWLASAIETAYCAPPPVRRDRVPINATVPAVAAAQVGEVLARFPGA
FT                   RTAKVKVAEPGQSLADDIERVNAVRELVPMVRVDANGGWGVAEAVAAAAALTADGPLEY
FT                   LEQPCATVAELAELRRRVDVPIAADESIRKAEDPLAVVRAQAADIAVLKVAPLGGISAL
FT                   LDIAARIAVPVVVSSALDSAVGIAAGLTAAAALPELDHACGLGTGGLFEEDVAEPAAPV
FT                   DGFLAVARTTPDPARLQALGAPPQRRQWWIDRVKACYSLLVPSFG"
FT   gene            648695..649483
FT                   /locus_tag="TBFG_10564"
FT                   /old_locus_tag="TBFG_00555"
FT   CDS_pept        648695..649483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10564"
FT                   /old_locus_tag="TBFG_00555"
FT                   /product="peroxidase bpoC (non-haem peroxidase)"
FT                   /note="Mapped to H37Rv Rv0554"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04907"
FT                   /protein_id="ABR04907.1"
FT                   /translation="MINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCIT
FT                   FDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELV
FT                   SSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVG
FT                   DWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREV
FT                   ADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVKA"
FT   gene            649526..651190
FT                   /locus_tag="TBFG_10565"
FT                   /old_locus_tag="TBFG_00556"
FT   CDS_pept        649526..651190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10565"
FT                   /old_locus_tag="TBFG_00556"
FT                   /product="bifunctional menaquinone biosynthesis protein
FT                   menD: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate
FT                   synthase + 2-oxoglutarate decarboxylase"
FT                   /note="Mapped to H37Rv Rv0555"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04908"
FT                   /db_xref="GOA:A1QNY1"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1QNY1"
FT                   /protein_id="ABR04908.1"
FT                   /translation="MNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALQDADRSG
FT                   RIRLHVRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLS
FT                   ANRPYELLGTGANQTMEQLGYFGTQVRASISLGLAEDAPERTSALNATWRSATCRVLAA
FT                   ATGARTANAGPVHFDIPLREPLVPDPEPLGAVTPPGRPAGKPWTYTPPVTFDQPLDIDL
FT                   SVDTVVISGHGAGVHPNLAALPTVAEPTAPRSGDNPLHPLALPLLRPQQVIMLGRPTLH
FT                   RPVSVLLADAEVPVFALTTGPRWPDVSGNSQATGTRAVTTGAPRPAWLDRCAAMNRHAI
FT                   AAVREQLAAHPLTTGLHVAAAVSHALRPGDQLVLGASNPVRDVALAGLDTRGIRVRSNR
FT                   GVAGIDGTVSTAIGAALAYEGAHERTGSPDSPPRTIALIGDLTFVHDSSGLLIGPTEPI
FT                   PRSLTIVVSNDNGGGIFELLEQGDPRFSDVSSRIFGTPHDVDVGALCRAYHVESRQIEV
FT                   DELGPTLDQPGAGMRVLEVKADRSSLRQLHAAIKAAL"
FT   gene            651187..651702
FT                   /locus_tag="TBFG_10566"
FT                   /old_locus_tag="TBFG_00557"
FT   CDS_pept        651187..651702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10566"
FT                   /old_locus_tag="TBFG_00557"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0556"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04909"
FT                   /protein_id="ABR04909.1"
FT                   /translation="MISPKPLLHILIHGRSDELPDTRGRIVLRWLRIAVLIVTGLVTLQ
FT                   SVLLVAGAWRNDIAIQRNMGVAQAEVLSAGPRRSTIEFVTPDRITYRPQLGVLYPSELS
FT                   TGMRIYVEYNKRDPNLVRVQHRNAGLAIIPAGSIAVVAWLIAAAALVVLAVLDKRLERR
FT                   ENSASATG"
FT   gene            651764..652900
FT                   /locus_tag="TBFG_10567"
FT                   /old_locus_tag="TBFG_00558"
FT   CDS_pept        651764..652900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10567"
FT                   /old_locus_tag="TBFG_00558"
FT                   /product="mannosyltransferase pimB"
FT                   /note="Mapped to H37Rv Rv0557"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04910"
FT                   /protein_id="ABR04910.1"
FT                   /translation="MCGVRVAIVAESFLPQVNGVSNSVVKVLEHLRRTGHEALVIAPDT
FT                   PPGEDRAERLHDGVRVHRVPSRMFPKVTTLPLGVPTFRMLRALRGFDPDVVHLASPALL
FT                   GYGGLHAARRLGVPTVAVYQTDVPGFASSYGIPMTARAAWAWFRHLHRLADRTLAPSTA
FT                   TMESLIAQGIPRVHRWARGVDVQRFAPSARNEVLRRRWSPDGKPIVGFVGRLAPEKHVD
FT                   RLTGLAASGAVRLVIVGDGIDRARLQSAMPTAVFTGARYGKELAEAYASMDVFVHSGEH
FT                   ETFCQVVQEALASGLPVIAPDAGGPRDLITPHRTGLLLPVGEFEHRLPDAVAHLVHERQ
FT                   RYALAARRSVLGRSWPVVCDELLGHYEAVRGRRTTQAA"
FT   gene            652917..653621
FT                   /locus_tag="TBFG_10568"
FT                   /old_locus_tag="TBFG_00559"
FT   CDS_pept        652917..653621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10568"
FT                   /old_locus_tag="TBFG_00559"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase menH"
FT                   /note="Mapped to H37Rv Rv0558"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04911"
FT                   /protein_id="ABR04911.1"
FT                   /translation="MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRS
FT                   ALRIGPGQKVLDLAAGTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRL
FT                   PFGDDVFDAVTISFGLRNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEY
FT                   LMRALPRVARAVSSNPEAYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVAL
FT                   HAGYKPGKQTPQ"
FT   gene            complement(653635..653973)
FT                   /locus_tag="TBFG_10569"
FT                   /old_locus_tag="TBFG_00560"
FT   CDS_pept        complement(653635..653973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10569"
FT                   /old_locus_tag="TBFG_00560"
FT                   /product="conserved secreted protein"
FT                   /note="Mapped to H37Rv Rv0559c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04912"
FT                   /protein_id="ABR04912.1"
FT                   /translation="MKGTKLAVVVGMTVAAVSLAAPAQADDYDAPFNNTIHRFGIYGPQ
FT                   DYNAWLAKISCERLSRGVDGDAYKSATFLQRNLPRGTTQGQAFQFLGAAIDHYCPEHVG
FT                   VLQRAGTR"
FT   gene            complement(654007..654732)
FT                   /locus_tag="TBFG_10570"
FT                   /old_locus_tag="TBFG_00561"
FT   CDS_pept        complement(654007..654732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10570"
FT                   /old_locus_tag="TBFG_00561"
FT                   /product="hypothetical benzoquinone methyltransferase"
FT                   /note="Mapped to H37Rv Rv0560c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04913"
FT                   /protein_id="ABR04913.1"
FT                   /translation="MSTVLTYIRAVDIYEHMTESLDLEFESAYRGESVAFGEGVRPPWS
FT                   IGEPQPELAALIVQGKFRGDVLDVGCGEAAISLALAERGHTTVGLDLSPAAVELARHEA
FT                   AKRGLANASFEVADASSFTGYDGRFDTIVDSTLFHSMPVESREGYLQSIVRAAAPGASY
FT                   FVLVFDRAAIPEGPINAVTEDELRAAVSKYWIIDEIKPARLYARFPAGFAGMPALLDIR
FT                   EEPNGLQSIGGWLLSAHLG"
FT   gene            complement(654757..655983)
FT                   /locus_tag="TBFG_10571"
FT                   /old_locus_tag="TBFG_00562"
FT   CDS_pept        complement(654757..655983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10571"
FT                   /old_locus_tag="TBFG_00562"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0561c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10571"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04914"
FT                   /protein_id="ABR04914.1"
FT                   /translation="MSVDDSADVVVVGAGPAGSAAAAWAARAGRDVLVIDTATFPRDKP
FT                   CGDGLTPRAVAELHQLGLGKWLADHIRHRGLRMSGFGGEVEVDWPGPSFPSYGSAVARL
FT                   ELDDRIRKVAEDTGARMLLGAKAVAVHHDSSRRVVSLTLADGTEVGCRQLIVADGARSP
FT                   LGRKLGRRWHRETVYGVAVRGYLSTAYSDDPWLTSHLELRSPDGAVLPGYGWIFPLGNG
FT                   EVNIGVGALSTSRRPADLALRPLISYYTDLRRDEWGFTGQPRAVSSALLPMGGAVSGVA
FT                   GSNWMLIGDAAACVNPLNGEGIDYGLETGRLAAELLDSRDLARLWPSLLADRYGRGFSV
FT                   ARRLALLLTFPRFLPTTGPITMRSTALMNIAVRVMSNLVTDDDRDWVARVWRGGGQLSR
FT                   LVDRRPPFS"
FT   gene            655999..657006
FT                   /locus_tag="TBFG_10572"
FT                   /old_locus_tag="TBFG_00563"
FT   CDS_pept        655999..657006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10572"
FT                   /old_locus_tag="TBFG_00563"
FT                   /product="polyprenyl-diphosphate synthase grcC1"
FT                   /note="Mapped to H37Rv Rv0562"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10572"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04915"
FT                   /protein_id="ABR04915.1"
FT                   /translation="MRTPATVVAGVDLGDAVFAAAVRAGVARVEQLMDTELRQADEVMS
FT                   DSLLHLFNAGGKRFRPLFTVLSAQIGPQPDAAAVTVAGAVIEMIHLATLYHDDVMDEAQ
FT                   VRRGAPSANAQWGNNVAILAGDYLLATASRLVARLGPEAVRIIADTFAQLVTGQMRETR
FT                   GTSENVDSIEQYLKVVQEKTGSLIGAAGRLGGMFSGATDEQVERLSRLGGVVGTAFQIA
FT                   DDIIDIDSESDESGKLPGTDVREGVHTLPMLYALRESGPDCARLRALLNGPVDDDAEVR
FT                   EALTLLRASPGMARAKDVLAQYAAQARHELALLPDVPGRRALAALVDYTVSRHG"
FT   gene            657107..657967
FT                   /locus_tag="TBFG_10573"
FT                   /old_locus_tag="TBFG_00564"
FT   CDS_pept        657107..657967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10573"
FT                   /old_locus_tag="TBFG_00564"
FT                   /product="protease transmembrane protein heat shock protein
FT                   htpX"
FT                   /note="Mapped to H37Rv Rv0563"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04916"
FT                   /protein_id="ABR04916.1"
FT                   /translation="MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGM
FT                   NVYVYFNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFA
FT                   TGRNPRNAAVCCTTGILRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALAN
FT                   MAMWAGMFGGNRDNANPFALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLA
FT                   LASALRKISGGVQAAPLPPEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLE
FT                   AMARG"
FT   gene            complement(658152..659207)
FT                   /locus_tag="TBFG_10574"
FT                   /old_locus_tag="TBFG_00565"
FT   CDS_pept        complement(658152..659207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10574"
FT                   /old_locus_tag="TBFG_00565"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   gpdA1"
FT                   /note="Mapped to H37Rv Rv0564c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10574"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04917"
FT                   /protein_id="ABR04917.1"
FT                   /translation="MSGCRNTLNAMAANKREPKVVVLGGGSWGTTVASICARRGPTLQW
FT                   VRSAVTAQDINDNHRNSRYLGNDVVLSDTLRATTDFTEAANCADVVVMGVPSHGFRGVL
FT                   VELSKELRPWVPVVSLVKGLEQGTNMRMSQIIEEVLPGHPAGILAGPNIAREVAEGYAA
FT                   AAVLAMPDQHLATRLSAMFRTRRFRVYTTDDVVGVETAGALKNVFAIAVGMGYSLGIGE
FT                   NTRALVIARALREMTKLGVAMGGKSETFPGLAGLGDLIVTCTSQRSRNRHVGEQLGAGK
FT                   PIDEIIASMSQVAEGVKAAGVVMEFANEFGLNMPIAREVDAVINHGSTVEQAYRGLIAE
FT                   VPGHEVHGSGF"
FT   gene            complement(659238..660698)
FT                   /locus_tag="TBFG_10575"
FT                   /old_locus_tag="TBFG_00566"
FT   CDS_pept        complement(659238..660698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10575"
FT                   /old_locus_tag="TBFG_00566"
FT                   /product="hypothetical monooxygenase"
FT                   /note="Mapped to H37Rv Rv0565c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10575"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04918"
FT                   /protein_id="ABR04918.1"
FT                   /translation="MSVTPNAGCVDVVIVGAGISGLGAAYRIIERNPQLTYTILERRAR
FT                   IGGTWDLFRYPGVRSDSSIFTLSFPYEPWTREEGIADGAHIREYLTDMAHKYGIDRHIE
FT                   FNSYVRAADWDSSTDTWTVTFEQNGVHKHYRSRFVFFGSGYYNYDEGYTPDFGGIEKFG
FT                   GAVVHPQHWPEDLDYTGKKIVVIGSGATAVTLIPSLTDRAEKVTMLQRSPTYLISASKY
FT                   STFAAVVRKALPPKTSHLIVRMYNALLEAVFWFLSRKTPVFVKWLLRRTAIKNLPEGYD
FT                   IETHFTPRYNPWDQRLCLIPDADLYNAITSGRAEVVTDHIDHFDATGIALKSGGHLDAD
FT                   IIVTATGLQLQALGGAAISLDGVEIDPRDRFVYKAHMLEDVPNLFWCVGYTNASWTLRA
FT                   DMTARATAKLLAHMAAHGHTRAAPHLGDEPMDEKPSWDIQAGYVKRAPYALPKSGTKRP
FT                   WNVRQNYLADAIDYRFDRIEEAMVFGAA"
FT   gene            complement(660776..661267)
FT                   /locus_tag="TBFG_10576"
FT                   /old_locus_tag="TBFG_00567"
FT   CDS_pept        complement(660776..661267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10576"
FT                   /old_locus_tag="TBFG_00567"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0566c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10576"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04919"
FT                   /protein_id="ABR04919.1"
FT                   /translation="MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKG
FT                   DEAVELTSSTEERVKAAVDVFKEKLIRRDISLKAFEAGEPQASGKTYKVTGALKQGISS
FT                   ENAKKITKLIRDAGPKNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR
FT                   "
FT   gene            661337..661420
FT                   /locus_tag="TBFG_14005"
FT   tRNA            661337..661420
FT                   /locus_tag="TBFG_14005"
FT                   /product="tRNA-Tyr"
FT   gene            661549..662568
FT                   /locus_tag="TBFG_10577"
FT                   /old_locus_tag="TBFG_00568"
FT   CDS_pept        661549..662568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10577"
FT                   /old_locus_tag="TBFG_00568"
FT                   /product="hypothetical methyltransferase"
FT                   /note="Mapped to H37Rv Rv0567"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10577"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04920"
FT                   /protein_id="ABR04920.1"
FT                   /translation="MELSPDRIMAIGGGYGPSKVLLTAVGLGLFTELGDEAMTAEAIAD
FT                   RLGLLKRPAIDFLDALVSLDLLARDGDGPGSHYRNTPETAHFLDEARPTYAGGLLKIWN
FT                   ERNYRFWADLTEALKTGKAQSEVKQTGRPFFEALYADPRRLEAFMAAMDAASRRNIELL
FT                   AKRFPFERYRRLCDVGCADGLLSRIVAAAHPHLQCVSFDLPAVTEIARRKLTAEGLGER
FT                   VQACAGDFLADPLPAADVITMGQILHDWNLDRKQQLVAKAYEALSKEGAFIVIETLIDD
FT                   ARRENTTGLMMSLNMLIEFGDAFDYSAADFRGWCGEAGFRSFEVIPLAGGSSAAVAYK"
FT   gene            662678..664096
FT                   /locus_tag="TBFG_10578"
FT                   /old_locus_tag="TBFG_00569"
FT   CDS_pept        662678..664096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10578"
FT                   /old_locus_tag="TBFG_00569"
FT                   /product="cytochrome P450 135B1 cyp135B1"
FT                   /note="Mapped to H37Rv Rv0568"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10578"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04921"
FT                   /protein_id="ABR04921.1"
FT                   /translation="MSGTSSMGLPPGPRLSGSVQAVLMLRHGLRFLTACQRRYGSVFTL
FT                   HVAGFGHMVYLSDPAAIKTVFAGNPSVFHAGEANSMLAGLLGDSSLLLIDDDVHRDRRR
FT                   LMSPPFHRDAVARQAGPIAEIAAANIAGWPMAKAFAVAPKMSEITLEVILRTVIGASDP
FT                   VRLAALRKVMPRLLNVGPWATLALANPSLLNNRLWSRLRRRIEEADALLYAEIADRRAD
FT                   PDLAARTDTLAMLVRAADEDGRTMTERELRDQLITLLVAGHDTTATGLSWALERLTRHP
FT                   VTLAKAVQAADASAAGDPAGDEYLDAVAKETLRIRPVVYDVGRVLTEAVEVAGYRLPAG
FT                   VMVVPAIGLVHASAQLYPDPERFDPDRMVGATLSPTTWLPFGGGNRRCLGATFAMVEMR
FT                   VVLREILRRVELSTTTTSGERPKLKHVIMVPHRGARIRVRATRDVSATSQATAQGAGCP
FT                   AARGGGPSRAVGSQ"
FT   gene            664231..664497
FT                   /locus_tag="TBFG_10579"
FT                   /old_locus_tag="TBFG_00570"
FT   CDS_pept        664231..664497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10579"
FT                   /old_locus_tag="TBFG_00570"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0569"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10579"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04922"
FT                   /protein_id="ABR04922.1"
FT                   /translation="MKAKVGDWLVIKGATIDQPDHRGLIIEVRSSDGSPPYVVRWLETD
FT                   HVATVIPGPDAVVVTAEEQNAADERAQHRFGAVQSAILHARGT"
FT   gene            664523..666601
FT                   /locus_tag="TBFG_10580"
FT                   /old_locus_tag="TBFG_00571"
FT   CDS_pept        664523..666601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10580"
FT                   /old_locus_tag="TBFG_00571"
FT                   /product="ribonucleoside-diphosphate reductase large
FT                   subunit nrdZ"
FT                   /note="Mapped to H37Rv Rv0570"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10580"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04923"
FT                   /protein_id="ABR04923.1"
FT                   /translation="MGVSWPAKVRRRDGTLVPFDIARIEAAVTRAAREVACDDPDMPGT
FT                   VAKAVADALGRGIAPVEDIQDCVEARLGEAGLDDVARVYIIYRQRRAELRTAKALLGVR
FT                   DELKLSLAAVTVLRERYLLHDEQGRPAESTGELMDRSARCVAAAEDQYEPGSSRRWAER
FT                   FATLLRNLEFLPNSPTLMNSGTDLGLLAGCFVLPIEDSLQSIFATLGQAAELQRAGGGT
FT                   GYAFSHLRPAGDRVASTGGTASGPVSFLRLYDSAAGVVSMGGRRRGACMAVLDVSHPDI
FT                   CDFVTAKAESPSELPHFNLSVGVTDAFLRAVERNGLHRLVNPRTGKIVARMPAAELFDA
FT                   ICKAAHAGGDPGLVFLDTINRANPVPGRGRIEATNPCGEVPLLPYESCNLGSINLARML
FT                   ADGRVDWDRLEEVAGVAVRFLDDVIDVSRYPFPELGEAARATRKIGLGVMGLAELLAAL
FT                   GIPYDSEEAVRLATRLMRRIQQAAHTASRRLAEERGAFPAFTDSRFARSGPRRNAQVTS
FT                   VAPTGTISLIAGTTAGIEPMFAIAFTRAIVGRHLLEVNPCFDRLARDRGFYRDELIAEI
FT                   AQRGGVRGYPRLPAEVRAAFPTAAEIAPQWHLRMQAAVQRHVEAAVSKTVNLPATATVD
FT                   DVRAIYVAAWKAKVKGITVYRYGSREGQVLSYAAPKPLLAQADTEFSGGCAGRSCEF"
FT   gene            complement(666715..668046)
FT                   /locus_tag="TBFG_10581"
FT                   /old_locus_tag="TBFG_00572"
FT   CDS_pept        complement(666715..668046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10581"
FT                   /old_locus_tag="TBFG_00572"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0571c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10581"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04924"
FT                   /protein_id="ABR04924.1"
FT                   /translation="MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKS
FT                   LQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIE
FT                   LQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPD
FT                   DIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDA
FT                   AADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVFAHGSGSSRHSIRNRYVAEVLTGA
FT                   GFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAG
FT                   AALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVI
FT                   PGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG"
FT   gene            complement(668270..668611)
FT                   /locus_tag="TBFG_10582"
FT                   /old_locus_tag="TBFG_00573"
FT   CDS_pept        complement(668270..668611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10582"
FT                   /old_locus_tag="TBFG_00573"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0572c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10582"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04925"
FT                   /protein_id="ABR04925.1"
FT                   /translation="MGEHAIKRHMRQRKPTKHPLAQKRGARILVLTDDPRRSVLIVPGC
FT                   HLDSMRREKNAYYFQDGNALVGMVVSGGTVEYDADDRTYVVQLTDGRHTTESSFEHSSP
FT                   SRSPQSDDL"
FT   gene            complement(669079..670470)
FT                   /locus_tag="TBFG_10583"
FT                   /old_locus_tag="TBFG_00574"
FT   CDS_pept        complement(669079..670470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10583"
FT                   /old_locus_tag="TBFG_00574"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0573c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04926"
FT                   /protein_id="ABR04926.1"
FT                   /translation="MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGR
FT                   SYIMAAGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTV
FT                   IFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAH
FT                   GTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLY
FT                   PATMLLVDTYDTLRGVDHVIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLE
FT                   QVEIFASSGLDENRIAALLAARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTK
FT                   FSSGKVIYPGRKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLD
FT                   GARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGA
FT                   KAKRP"
FT   gene            complement(670480..671622)
FT                   /locus_tag="TBFG_10584"
FT                   /old_locus_tag="TBFG_00575"
FT   CDS_pept        complement(670480..671622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10584"
FT                   /old_locus_tag="TBFG_00575"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0574c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04927"
FT                   /protein_id="ABR04927.1"
FT                   /translation="MAGNPDVVTVLLGGDVMLGRGVDQILPHPGKPQLRERYMRDATGY
FT                   VRLAERVNGRIPLPVDWRWPWGEALAVLENTATDVCLINLETTITADGEFADRKPVCYR
FT                   MHPDNVPALTALRPHVCALANNHILDFGYQGLTDTVAALAGAGIQSVGAGADLLAARRS
FT                   ALVTVGHERRVIVGSVAAESSGVPESWAARRDRPGVWLIRDPAQRDVADDVAAQVLADK
FT                   RPGDIAIVSMHWGSNWGYATAPGDVAFAHRLIDAGIDMVHGHSSHHPRPIEIYRGKPIL
FT                   YGCGDVVDDYEGIGGHESFRSELRLLYLTVTDPASGNLISLQMLPLRVSRMRLQRASQT
FT                   DTEWLRNTIERISRRFGIRVVTRPDNLLEVVPAANLTSKE"
FT   gene            complement(671807..672973)
FT                   /locus_tag="TBFG_10585"
FT                   /old_locus_tag="TBFG_00576"
FT   CDS_pept        complement(671807..672973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10585"
FT                   /old_locus_tag="TBFG_00576"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="Mapped to H37Rv Rv0575c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10585"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04928"
FT                   /protein_id="ABR04928.1"
FT                   /translation="MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFW
FT                   GVGYQVAKRMGITDQIAAAGYHMEHVRSVGPTGKVKADLGVDVFRRMVGDDFTSLPRGD
FT                   LAAAIYTTIEDQVETIFDDSIATIDEHRDGVRLTFERTAPRDFDLVIGADGLHSNVRRL
FT                   VFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNTVDRQLARFALRGDRTMFLFVFR
FT                   AEHDNPGVAPKDELRDQFGDVGWESRDILAALDDVEDLYFDVVSQIRMDRWSRGRVLLI
FT                   GDAAGCISLLGGEGTGLAITEAYVLAGELARAGGDHRRAFDAYEKRLRPFIEGKQASAA
FT                   KFIWFFATRTRFGLWFRNVAMRTMNFGPLATLFAGSVRDDFELPDYTW"
FT   gene            673067..674380
FT                   /locus_tag="TBFG_10586"
FT                   /old_locus_tag="TBFG_00577"
FT   CDS_pept        673067..674380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10586"
FT                   /old_locus_tag="TBFG_00577"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   arsR-family"
FT                   /note="Mapped to H37Rv Rv0576"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10586"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04929"
FT                   /protein_id="ABR04929.1"
FT                   /translation="MPDMLEVAAEPTRRRLLQLLAPGERTVTQLASQFTVTRSAISQHL
FT                   GMLAEAGLVTARKQGRERYYRLDERGVLRLRALMESFWSDELDRLVADAAHYPPSQGDC
FT                   AMPFEKAVVVPLDPTSTFALITQPDRLRRWMAVAARIELRTGGAYRWTVTPGHSAAGTV
FT                   IDVDPGKRVVFTWGWEDHGDPPPGGSTVTITLTPVDGGTEVRLVHDGLTAQQAARHAKG
FT                   WNHFLDRLVVAGQRGDAGPDEWAAAPDPLDELSCAEATLAVLQHVLRGIGASDLTRQTP
FT                   CTEYDVSQLADHLLRSLAIIGAAAGAQLAPRDVDAPLETQVADAAQAVMEAWRRRGLAG
FT                   TVELNSNQVPATVPVGILCLEFLVHAWDFAIATGSQVIASEPVSEYVLAVAGKVITPAT
FT                   RNSAGFAAPAAVGSFAPVLDRLIAFTGRQPTAGHVSAT"
FT   gene            674394..675179
FT                   /locus_tag="TBFG_10587"
FT                   /old_locus_tag="TBFG_00578"
FT   CDS_pept        674394..675179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10587"
FT                   /old_locus_tag="TBFG_00578"
FT                   /product="conserved hypothetical protein TB27.3"
FT                   /note="Mapped to H37Rv Rv0577"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10587"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04930"
FT                   /protein_id="ABR04930.1"
FT                   /translation="MPKRSEYRQGTPNWVDLQTTDQSAAKKFYTSLFGWGYDDNPVPGG
FT                   GGVYSMATLNGEAVAAIAPMPPGAPEGMPPIWNTYIAVDDVDAVVDKVVPGGGQVMMPA
FT                   FDIGDAGRMSFITDPTGAAVGLWQANRHIGATLVNETGTLIWNELLTDKPDLALAFYEA
FT                   VVGLTHSSMEIAAGQNYRVLKAGDAEVGGCMEPPMPGVPNHWHVYFAVDDADATAAKAA
FT                   AAGGQVIAEPADIPSVGRFAVLSDPQGAIFSVLKPAPQQ"
FT   gene            complement(675224..679144)
FT                   /locus_tag="TBFG_10588"
FT                   /old_locus_tag="TBFG_00579"
FT   CDS_pept        complement(675224..679144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10588"
FT                   /old_locus_tag="TBFG_00579"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0578c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10588"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04932"
FT                   /protein_id="ABR04932.1"
FT                   /translation="MSFVIATPEMLTTAATDLAKIGSTITAANTAAAAVAKVLPASADE
FT                   VSVAVAALFGTHAQEYQTVSAQVATFHDRFVQTLSAAASSYVAAEAVNVEQSLLAAVNA
FT                   PTQALFGRPLIGNGADGSPGTGQAGGPGGILYGNGGNGGSGAPGQRGGAGGAAGLIGNG
FT                   GNGGAGGVGTTGGAGGHGGAGGWLYGNGGAGGFGGAGAVGGNGGAGGTAGLFGVGGAGG
FT                   AGGNGIAGVTGTSASTPGGSGTAGGAGGIGGNGGAGGAGGVLMGNGGNGGAGGEGGPGG
FT                   AGGAGASGAHATNLGADGQAGGNGGNGGAGGTGGVGGPGGGHGLLGLGGSHGAGGAGGS
FT                   GGDGGAPGDGGNGATGTWGHNLGAGGTGGNGGNPGAGGAGGAGGASVGGSAHGANGAPG
FT                   TTSTSGGNGGDGGKGADAISSGQTGANGGRGGDGGQVGNGGAGGAGGRGGAGGLGFGSE
FT                   APGRPGGAGGTGGAGGNGGTQAGDGGTGGAGGAGGDGGSGGAGSIGFNASAPGAAGSPG
FT                   GNGGNGGPGGAGGEGGAGGLALAASGQNGSQGAGGDGGAGGNGGTPGNGGHGAAGALGV
FT                   NGGVGGAGGHGGDPGVGGAGGQGGSGSTPGANGAPGNTPTSGGNGGNGGRGADATGFGQ
FT                   TGASGGRGGDGGLVGNGGAGGAGGNGSKGLPGLGRLGNPGLDGGTGGNGGAGGSGGAWA
FT                   GNGGTGGAGGTGGVGGTGGSGSDGVNGSSAGADGHPGGTGGVGGTGGKGGDGGDGGAAP
FT                   NGVAGSQGPGGAGGDGGTGGVGGNGGRGIDGADGATAGARGQDGGAGGAGGKGGRGGTG
FT                   GPGGAGPAGTTGSQGAGGNGGSGGTGGDPGDGGNGANGSVFTNNGIGGNGGNGGNAGPS
FT                   GAGGSGGAGSTFGATGSSSSIHVNGGNGGNGGNGDHALSGNGAAGGNGGNGGNGSLRGS
FT                   GGAGGHGGNGGNASRGMGGDGGTGGAGGNAGQIGNGGAGGNGGDGGTGSDGNPGAITGS
FT                   GGRGGDGGVGGQGGSVAGDGADGGRGGAGGTGGTGLRGTTGATGATGTFDAGADGHGGN
FT                   GGTGGVGGTGGAGGGGGNGGAGGKALSPTGNNGSQGAGGDGGAGGAGGTGGTGGDGGRG
FT                   AHGTLFSSLAGTGGTGGNGGTGGTGGTGGAGGAGGTGSTLGATGATGAAGRAGNGGVGG
FT                   SGGLGSAFGPGGTGGMGGAGGTSTVSAGGDGGRGGFGGDGLDASSGGNGGDGGHGGDGF
FT                   RTAGAGGRGGDGGKGADPGGLFPIPGAGGKGGTGGTGGTAHLGPLAIIGQSGQPGQFGS
FT                   PGADGRGGAGGAGGGGGAGGSF"
FT   gene            679059..679538
FT                   /locus_tag="TBFG_10589"
FT                   /old_locus_tag="TBFG_00580"
FT   CDS_pept        679059..679538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10589"
FT                   /old_locus_tag="TBFG_00580"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0577"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04931"
FT                   /protein_id="ABR04931.1"
FT                   /translation="MAAVIVEPIFAKSVAAVVSISGVAITNDISLPRSGQPGVARRGKE
FT                   LCGYPGDLPCGANLRDPNSNDPLLTLSSKGQNPKLYANELSTVHPRFPSTRANGQTSTV
FT                   LAPRRYCRSSSRSRPGARTPLPSRDPAGEDKEWSAMWMSGHTPSSTSSWSCRRAV"
FT   gene            679466..680224
FT                   /locus_tag="TBFG_10590"
FT                   /old_locus_tag="TBFG_00581"
FT   CDS_pept        679466..680224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10590"
FT                   /old_locus_tag="TBFG_00581"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0579"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04933"
FT                   /protein_id="ABR04933.1"
FT                   /translation="MVGYVDVRAYAELNEFVELQARGLTVRRPFRSHQTVKDVLEAMGI
FT                   PHTEVDLILVNGDPADFSYRPVAGDRIAAYPMFEALDIGSTARLRPAPLRNPRFVVDVN
FT                   LGQLARLLRLLGFDTRWSSAADDPTLADISLGEQRILLTRDRGLLKRRAITHGLFVHSQ
FT                   HPEEQALEVLRRLDLNGRLAPLSRCLRCNGELAAVSKDEVIGQLEPLTRRYYESFSRCF
FT                   GCGRIYWPGSHHARLVRLVERLRDQLTTST"
FT   gene            complement(680353..680931)
FT                   /locus_tag="TBFG_10591"
FT                   /old_locus_tag="TBFG_00582"
FT   CDS_pept        complement(680353..680931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10591"
FT                   /old_locus_tag="TBFG_00582"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0580c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10591"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04934"
FT                   /protein_id="ABR04934.1"
FT                   /translation="MVLPVAPYILLRHQLVGVAANPDRIYGEGMTDQSYAVDIAHPPAA
FT                   LLRLVNPILRSLLHTPLAGPLRTQLMVVSFTGRKTGRHFSIPLSAHVIDNDLYALTEAG
FT                   WKHNFSDGAAAQVVYDGKTTAMRGELIRDRAVVSELFLRAAQAYGVKRGQRMLGLSFRD
FT                   RRIPTLEEFAEAVDRLKLVAIRLTPADNS"
FT   gene            680938..681153
FT                   /locus_tag="TBFG_10592"
FT                   /old_locus_tag="TBFG_00583"
FT   CDS_pept        680938..681153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10592"
FT                   /old_locus_tag="TBFG_00583"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0581"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10592"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04935"
FT                   /protein_id="ABR04935.1"
FT                   /translation="MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPP
FT                   PRGGLYAGSEPIARRVDELLAGFGER"
FT   gene            681150..681557
FT                   /locus_tag="TBFG_10593"
FT                   /old_locus_tag="TBFG_00584"
FT   CDS_pept        681150..681557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10593"
FT                   /old_locus_tag="TBFG_00584"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0582"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10593"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04936"
FT                   /protein_id="ABR04936.1"
FT                   /translation="MIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDY
FT                   LVATRVGVDAELAVLRELAGGAWELANCGAAEIEQAARIVTKYQDQRIGIADAANVVLA
FT                   DRYRTRTILTLDRRHFSALRPIGGGRFTVIP"
FT   gene            complement(681617..682303)
FT                   /locus_tag="TBFG_10594"
FT                   /old_locus_tag="TBFG_00585"
FT   CDS_pept        complement(681617..682303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10594"
FT                   /old_locus_tag="TBFG_00585"
FT                   /product="lipoprotein lpqN"
FT                   /note="Mapped to H37Rv Rv0583c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10594"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04937"
FT                   /protein_id="ABR04937.1"
FT                   /translation="MKHFTAAVATVALSLALAGCSFNIKTDSAPTTSPTTTSPTTSTTT
FT                   TSATTSAQAAGPNYTIADYIRDNHIQETPVHHGDPGSPTIDLPVPDDWRLLPESSRAPY
FT                   GGIVYTQPADPNDPPTIVAILSKLTGDIDPAKVLQFAPGELKNLPGFQGSGDGSAATLG
FT                   GFSAWQLGGSYSKNGKLRTVAQKTVVIPSQGAVFVLQLNADALDDETMTLMDAANVIDE
FT                   QTTITP"
FT   gene            682457..685090
FT                   /locus_tag="TBFG_10595"
FT                   /old_locus_tag="TBFG_00586"
FT   CDS_pept        682457..685090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10595"
FT                   /old_locus_tag="TBFG_00586"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0584"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10595"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04938"
FT                   /protein_id="ABR04938.1"
FT                   /translation="MRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHV
FT                   NTLIGTGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYDNPHSTGFSMTHASV
FT                   GCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFPGTGVIAELTATTR
FT                   TGVGRFRYPRNGWPALFHVRSGASLAGNYAATLQIEDNTTITGSATSGGFCGKKNLYTV
FT                   YFAMKFSQPFSSYGTWDGYAVYPGSHSMNSSYSGGYVGFPAGSVLEVRTALSYVSVDGA
FT                   RANLDAEGGASFDDIRAATSSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFND
FT                   VDGRYIGFDGVIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQ
FT                   SGAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAATQGGVGLDG
FT                   FLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDFAISRFADSLGDTATAAV
FT                   FQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPGFVAYPSGFGQDGYDEGNAEQYLWWVP
FT                   HNVAGLVTALGGRTAVVKRLDRFTKKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKT
FT                   QRTVDRVRGLFGPTPGGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAV
FT                   IALPTGKSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLAGTP
FT                   NKVWGTAASAAPPSFGAGSSAVTVNIARPIIGIVPGATGTVTVDAQRMIDGVDDYTVTP
FT                   TSYVVGIAAEPLSGQFDDDGAVSASVAITVARSVPSGYYPIYVTTSAGDSARTLIVLVV
FT                   VAEAVE"
FT   gene            complement(685113..687500)
FT                   /locus_tag="TBFG_10596"
FT                   /old_locus_tag="TBFG_00587"
FT   CDS_pept        complement(685113..687500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10596"
FT                   /old_locus_tag="TBFG_00587"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0585c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10596"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04939"
FT                   /protein_id="ABR04939.1"
FT                   /translation="MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLIT
FT                   RPQWVALEKSISEIVGVLSPSQSDLVYLGYGLAILALPFVILIGLIVSRQWKLLGAYAA
FT                   AGLMAVLPLSISSSRIAAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPWLPA
FT                   RWRHWWWALLLAFVPIHLVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAI
FT                   RALAKRGFAVSGLAVVRPAGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQL
FT                   WLKLTLRGTETAPLQASMRRAVEHRALMAIAFGDLGMANTTVIAVSPLDRGWTLYAHRP
FT                   ARGIGISECTKTTPTAHVWEALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGA
FT                   TDAQLQSDLAQLLVTTSALYDAEAAVTAAIDTFGKQAILAASRRLTKSAVPKRIRESIT
FT                   DPNAVIASTRAEVMRQTGADQIKAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFF
FT                   SQLRTANWWWALLGLAVSALTYVGAAAALWACADGLVGFWKLSIMQVANTFAATTTPAG
FT                   VGGLALSTRFLQKGGLTAVRATAAVALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPN
FT                   ATVLYLIAGVALGIVGTFLFVPKLRRWLATAVRPKLREVTNDLIALAREPKRLALIVLG
FT                   CAGTTLGAALALWASIEAFGGGTTFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGL
FT                   AAFGVPAALGVPSVLLYRLLTCWLPVFAGWQVMHWLTRHEMI"
FT   gene            687638..688360
FT                   /locus_tag="TBFG_10597"
FT                   /old_locus_tag="TBFG_00588"
FT   CDS_pept        687638..688360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10597"
FT                   /old_locus_tag="TBFG_00588"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0586"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10597"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04940"
FT                   /protein_id="ABR04940.1"
FT                   /translation="MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLG
FT                   VSRPAVREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISVVRSI
FT                   LEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRHTLDFWDHVVDSAG
FT                   SIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYRKLADAICSGDPTGAKKAAQDLL
FT                   ELANTSLMAVLVSQASRQ"
FT   gene            688357..689154
FT                   /locus_tag="TBFG_10598"
FT                   /old_locus_tag="TBFG_00589"
FT   CDS_pept        688357..689154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10598"
FT                   /old_locus_tag="TBFG_00589"
FT                   /product="hypothetical integral membrane protein yrbE2A"
FT                   /note="Mapped to H37Rv Rv0587"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10598"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04941"
FT                   /protein_id="ABR04941.1"
FT                   /translation="MTTHAVIITYLRDQTQPAVDAIGGFYRTCVLTGKALVRRPFHWRE
FT                   AIEQGWFITSVSLLPTLAVSIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQLGPL
FT                   TTVLVIAGAGATAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVVAATIVAALLNGA
FT                   VITIGLVGGFVFSVFIQHVSAGAYVGTLTLVTGLPEVIISVVKSATFGLIAGLVGCYRG
FT                   LTTKGGPKGVGTAVNETLVLCVIALFATNVVLTTIGVRFGTGH"
FT   gene            689156..690043
FT                   /locus_tag="TBFG_10599"
FT                   /old_locus_tag="TBFG_00590"
FT   CDS_pept        689156..690043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10599"
FT                   /old_locus_tag="TBFG_00590"
FT                   /product="hypothetical integral membrane protein yrbE2B"
FT                   /note="Mapped to H37Rv Rv0588"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10599"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04942"
FT                   /protein_id="ABR04942.1"
FT                   /translation="MVESSTASAAAVLRARYPRTAASLDRYGGGTARRLERTGTFARFT
FT                   RISVVQIGWALRRYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAIQGFA
FT                   SLGNIGVEAFTGFFAALANTRVAAPIVSGVALAATVGAGATAQLGAMRISEEIDALEVM
FT                   GIKSISFLVSTRILGGLVVIMPLYALALDMAFTSGQVVTTVFYGQSNGTYEHYFRTFLR
FT                   PEDVGWSVVEVVIIAVVVMITHCYYGYTASGGPVGVGQAVGRSMRFSLVSVVVVVLLAE
FT                   LALYGVDPNFNLTV"
FT   gene            690049..691263
FT                   /locus_tag="TBFG_10600"
FT                   /old_locus_tag="TBFG_00591"
FT   CDS_pept        690049..691263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10600"
FT                   /old_locus_tag="TBFG_00591"
FT                   /product="MCE-family protein mce2A"
FT                   /note="Mapped to H37Rv Rv0589"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10600"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04943"
FT                   /protein_id="ABR04943.1"
FT                   /translation="MPTLVTRKNRRAWLYVEGVVLLLVGALVLVLVYKQFRGEFTPKTE
FT                   LTMVASRAGLVMEAGSKVTYNGVEIGRVGSISEIERDGRPAAKLVLDVNPRYISLIPVN
FT                   VVADIEAATLFGNKYVALSAPKIPQQQRISSHDVIDVGSVTTEFNTLFETITSIAEKVD
FT                   PIELNATLSAVAQALDGLGGKFGESIVNGNQILAQLNPRLPQLGYDVRRLADLGEVYVD
FT                   ASPDLWSFLQNALTTARTLTSQQRDLDAALLAATGAGNTGEDVFARGGPYLARAAADLV
FT                   PTATLLDTYSPELFCMIRNFHDAAPKVADAVGGNGYSLAAAGTILGAPNPYVYPDNLPR
FT                   VNAHGGPGGRPGCWQTITRELWPAPYLVMDTGASLAPYNHVELGQPMFTEYVWGRQYGE
FT                   NTINP"
FT   gene            691260..692087
FT                   /locus_tag="TBFG_10601"
FT                   /old_locus_tag="TBFG_00592"
FT   CDS_pept        691260..692087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10601"
FT                   /old_locus_tag="TBFG_00592"
FT                   /product="MCE-family protein mce2B"
FT                   /note="Mapped to H37Rv Rv0590"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10601"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04944"
FT                   /protein_id="ABR04944.1"
FT                   /translation="MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTH
FT                   VSGLRAGQFVRAAGVEVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYLNLIG
FT                   DRYLELGRGHSGQRLAPGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSII
FT                   TVFQGQGATINDILDQTASLTATLADRDHAIGEVVNNLNTVLATTVKHQTEFDRTVDKL
FT                   EVLITGLKNRADPLAAAAAHISSAAGTLADLLGRIVHCCTAASGTSRASSSRS"
FT   gene            692036..692290
FT                   /locus_tag="TBFG_10602"
FT                   /old_locus_tag="TBFG_00593"
FT   CDS_pept        692036..692290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10602"
FT                   /old_locus_tag="TBFG_00593"
FT                   /product="MCE-family related protein"
FT                   /note="Mapped to H37Rv Rv0590A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10602"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04945"
FT                   /protein_id="ABR04945.1"
FT                   /translation="MLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYG
FT                   DFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ"
FT   gene            692287..693732
FT                   /locus_tag="TBFG_10603"
FT                   /old_locus_tag="TBFG_00594"
FT   CDS_pept        692287..693732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10603"
FT                   /old_locus_tag="TBFG_00594"
FT                   /product="MCE-family protein mce2C"
FT                   /note="Mapped to H37Rv Rv0591"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10603"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04946"
FT                   /protein_id="ABR04946.1"
FT                   /translation="MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQ
FT                   FADTGGINTGDKVEIAGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTDTILG
FT                   RKNLEIEPRGSEPLKPNGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSE
FT                   TFDQTAPHLSAALEGVKAFSDTVGRRGEQIEQLLANANRIARVLGDRSEQVNGLLVNAK
FT                   TLLAAFKQRSQALRILLTNVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELA
FT                   DVAVLLGRYTAALTEAVGSGPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAG
FT                   LPEFRWPDPNGTRFPNGAPPAAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDTPL
FT                   PCAGATVGPFGGPDFPAPLDVQPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPP
FT                   NAPPGARTQPLEPFPDGTGGSNQ"
FT   gene            693729..695255
FT                   /locus_tag="TBFG_10604"
FT                   /old_locus_tag="TBFG_00595"
FT   CDS_pept        693729..695255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10604"
FT                   /old_locus_tag="TBFG_00595"
FT                   /product="MCE-family protein mce2D"
FT                   /note="Mapped to H37Rv Rv0592"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10604"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04947"
FT                   /protein_id="ABR04947.1"
FT                   /translation="MSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLT
FT                   TTTVVAYFSEALALYPGDKVQIMGVRVGSIDKIEPAGDKMRVTLHYSNKYQVPATATAS
FT                   ILNPSLVASRTIQLSPPYTGGPVLQDGAVIPIERTQVPVEWDQLRDSINGILRQLGPTE
FT                   RQPKGPFGDLIESAADNLAGKGRQLNETLNSLSQALTALNEGRGDFVAITRSLALFVSA
FT                   LYQNDQQFVALNENLAEFTDWFTKSDHDLADTVERIDDVLGTVRKFVSDNRSVLAADVN
FT                   NLADATTTLVQPEPRDGLETALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLI
FT                   CSAIQAGSRLGYQESAELCAQYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERL
FT                   RPPPGYKDTTVPGIFSRDTPFSHGNHEPGWVVAPGMQGMQVQPFTANMLTPESLAELLG
FT                   GPDIAPPPPGTNLPGPPNAYDESNPLPPPWYPQPASLPAAGATGQPGPGQ"
FT   gene            695252..696460
FT                   /locus_tag="TBFG_10605"
FT                   /old_locus_tag="TBFG_00596"
FT   CDS_pept        695252..696460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10605"
FT                   /old_locus_tag="TBFG_00596"
FT                   /product="MCE-family lipoprotein lprL (MCE-family
FT                   lipoprotein mce2e)"
FT                   /note="Mapped to H37Rv Rv0593"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10605"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04948"
FT                   /protein_id="ABR04948.1"
FT                   /translation="MRCGVSAGSANGKPNRWTLRCGVSAGHRGSVFLLAVLLAPVVLTS
FT                   CTWRGIANVPLPVGRGMGPDRMTIYVQMPDTLALNTNSRVRVADVWVGTVRDISLRNWI
FT                   ATLTLELEPTVRLPANATAKIGQTSLLGTQHVELAAPPIPSPQPLKSGDTIGLKNSSAY
FT                   PTVERTLASVALILTGGGIVNLDVIQTEILNILDGHAGQIREFLERLATFTAELNNQRG
FT                   DLTRAIDSTNQLLTIIANRNDTLDRVLTDVPPLIEHFADTGQLFADATESLGRFSEVAN
FT                   RALAATRPNLHQTLQSLQRPLRQLERASPYVVGALKLGLTAPFNIDEVPNVIRGDYVNV
FT                   SATFDVTLSALDNALLSGTGISGMLRALEQAWGRDPDTMIPDVRYTPNPNDAPGGPLVE
FT                   RAE"
FT   gene            696465..698015
FT                   /locus_tag="TBFG_10606"
FT                   /old_locus_tag="TBFG_00597"
FT   CDS_pept        696465..698015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10606"
FT                   /old_locus_tag="TBFG_00597"
FT                   /product="MCE-family protein mce2F"
FT                   /note="Mapped to H37Rv Rv0594"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10606"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04949"
FT                   /protein_id="ABR04949.1"
FT                   /translation="MLTRAIKTQLVLLTVLAVIAVVVLGWYFLRIPSLVGIGRYTLYAE
FT                   LPRSGGLYRTANVTYRGITIGKVTGVEPTERGARATMSIDNGYQIPTDASANVHSVSAV
FT                   GEQFVDLVSTRTSGPYLRHGQTITTTTVPSQIGPALDAANRGLAVLPKDRVASVLHEAS
FT                   EAVGGLGSSLNRLIEATQAIAHDVRGSLEDIDDIIERSAPIIDSQVNSGNEIARWAANL
FT                   NTLAAQTAQTDPAVRSILANAAPTADQVNATFSDVRESLPQTLANLEVVIDMLKRYHNG
FT                   VEQALVFLPQSGAIAQSVTTEFPGQAGLGVGGLALNQPPPCLTGFLPASEWRSPADTST
FT                   APLPKGTYCRIPMDASNVVRGARNNPCVDVPGKRAATPRECRSNEAYVPGGTNPWYGDP
FT                   NQMLSCPAPAARCDQPVKPGQVIPAPSVNNGINPLPADQLPGTPPPVNDPLQRPGSGTV
FT                   QCNGQQPNPCVYTPSTFPTTIYDVQSGKVVAPDGVVYSVEASTHAGADGWKVMLAPTG"
FT   gene            complement(698067..698459)
FT                   /locus_tag="TBFG_10607"
FT                   /old_locus_tag="TBFG_00598"
FT   CDS_pept        complement(698067..698459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10607"
FT                   /old_locus_tag="TBFG_00598"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0595c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10607"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04950"
FT                   /protein_id="ABR04950.1"
FT                   /translation="MNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGV
FT                   LQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAWALLVSKLRAAKLRVPINDSWIAAT
FT                   AVAHGIAILTQDNDYAAMPDVEVITI"
FT   gene            complement(698456..698713)
FT                   /locus_tag="TBFG_10608"
FT                   /old_locus_tag="TBFG_00599"
FT   CDS_pept        complement(698456..698713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10608"
FT                   /old_locus_tag="TBFG_00599"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0596c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10608"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04951"
FT                   /protein_id="ABR04951.1"
FT                   /translation="MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRR
FT                   RQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW"
FT   gene            complement(698896..700131)
FT                   /locus_tag="TBFG_10609"
FT                   /old_locus_tag="TBFG_00600"
FT   CDS_pept        complement(698896..700131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10609"
FT                   /old_locus_tag="TBFG_00600"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0597c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10609"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04952"
FT                   /protein_id="ABR04952.1"
FT                   /translation="MGVVERAIAPSVLAALADTPVVVVNGARQVGKTTLVARLDYPGSS
FT                   EVVSLDDVANRDAARDDPRAFVSRPVDTLVIDEAQLEPGLFRAIKAEVDRDRRPGRFLL
FT                   TGSARLLSAPDMADALVGRVEIIELWPFSQGERAGIADGFVDALFTAPRELIHGSDMRR
FT                   ADLVDRIATGGFPDIVARSPSRRRAWFDNYLTTATQSVIREISPIERLAEMPRVLRLCA
FT                   ARTGAELNVSALANDLSIPARTTAGYLALLEAAFLIHRVPAWSTNLSRKVIRRPKLVVS
FT                   DSGLACHLLGVTGATLDRPGRPLGPLLETFVANEIRKQLTWSTERPSLWHFRDRGGAEV
FT                   DLVLEHPDGRVCGIEVKATSTPRAEDLRGLRYLAERLDDRFQFGVLLTAAPEATPFGPT
FT                   LAALPVSTLWAG"
FT   gene            complement(700382..700795)
FT                   /locus_tag="TBFG_10610"
FT                   /old_locus_tag="TBFG_00601"
FT   CDS_pept        complement(700382..700795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10610"
FT                   /old_locus_tag="TBFG_00601"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0598c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10610"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04953"
FT                   /protein_id="ABR04953.1"
FT                   /translation="MKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAET
FT                   YSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSRTTEHLPRVLAQFEITGGAVYDALV
FT                   ALAAAEHRAELATRDARAKDTYEKIGVHVVVAA"
FT   gene            complement(700792..701028)
FT                   /locus_tag="TBFG_10611"
FT                   /old_locus_tag="TBFG_00602"
FT   CDS_pept        complement(700792..701028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10611"
FT                   /old_locus_tag="TBFG_00602"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0599c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10611"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04954"
FT                   /protein_id="ABR04954.1"
FT                   /translation="MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGR
FT                   TARLEEENGVLVATGETTIDDEVVFGLIDSGRK"
FT   gene            complement(701132..702265)
FT                   /locus_tag="TBFG_10612"
FT                   /old_locus_tag="TBFG_00603"
FT                   /old_locus_tag="TBFG_00604"
FT   CDS_pept        complement(701132..702265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10612"
FT                   /old_locus_tag="TBFG_00603"
FT                   /old_locus_tag="TBFG_00604"
FT                   /product="two component sensor kinase"
FT                   /note="Mapped to H37Rv Rv0599c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10612"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04955"
FT                   /protein_id="ABR04955.1"
FT                   /translation="MAHPMATHPRLQRRHGARSGSSRCRHRRPVPRRRSRSRPRWRAAR
FT                   AHRRHHRRSGPGIGDHPADRARHRRGGRLPAQPRRAAARRPDPRGGANTDHHAAPRHRR
FT                   AAAGTSHRRRDRLASNDSQHHAHPTATGPRPRTTVRRRRQPRITHPVGTADHRTRTALR
FT                   RPRPADQLSAALRSALEETRRLSGLADQLLTLARADRPESHPSAKAVPITPLLHESVAR
FT                   FAATGADITTRAEPDLFVSIDPDHLRRILTAVLDNAITHGDGEIAVTAHARDGAVDIGV
FT                   RDHGPGFADHFLPVAFDRFTRADTARGGRGSGLGLAIVAALTTTHGGHANATNHPDGGA
FT                   ELRITLPTPRPPFHEELPRITSSDTKDPNREHDTSDQ"
FT   gene            complement(702266..703027)
FT                   /locus_tag="TBFG_10613"
FT                   /old_locus_tag="TBFG_00605"
FT   CDS_pept        complement(702266..703027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10613"
FT                   /old_locus_tag="TBFG_00605"
FT                   /product="two component system DNA binding transcriptional
FT                   regulatory protein tcrA"
FT                   /note="Mapped to H37Rv Rv0602c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10613"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04956"
FT                   /protein_id="ABR04956.1"
FT                   /translation="MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEE
FT                   GHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARG
FT                   AVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRV
FT                   WRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDK
FT                   IDRPFGVTSLETIRGAGYRLRKDGGRHALPR"
FT   gene            703084..703395
FT                   /locus_tag="TBFG_10614"
FT                   /old_locus_tag="TBFG_00606"
FT   CDS_pept        703084..703395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10614"
FT                   /old_locus_tag="TBFG_00606"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0603"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10614"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04957"
FT                   /protein_id="ABR04957.1"
FT                   /translation="MNRIVQFGVSAVAAAAIGIGAGSGIAAAFDGEDEVTGPDADRARA
FT                   AAVQAVPGGTAGEVETETGEGAAAYGVLVTRPDGTRVEVHLDRDFRVLDTEPADGDGG"
FT   gene            703467..704417
FT                   /locus_tag="TBFG_10615"
FT                   /old_locus_tag="TBFG_00607"
FT   CDS_pept        703467..704417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10615"
FT                   /old_locus_tag="TBFG_00607"
FT                   /product="lipoprotein lpqO"
FT                   /note="Mapped to H37Rv Rv0604"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10615"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04958"
FT                   /protein_id="ABR04958.1"
FT                   /translation="MIRRRGARMAALLAAAALALTACAGSDDKGEPDDGGDRGASLATT
FT                   SDADWKPVADILGRTGKLNDGSVYKIGFARSDLSVQTKGVTVAPALSLGSWVAFARTPD
FT                   GQTMLMGDLVVTEDELASVTDAVQAGGLQQTALHKHLLEQSPPIWWTHIAGHGDAADLA
FT                   RAVRSALDATDTPPPASATSGQTSLDLDTAAIDEALGRSGTIAGGVYKFFIARRDPVTM
FT                   SGMLIPPSMGLATALNFQPTGNGRAAINGDFVMTAAEVQDVVQALRGGGIDIVAIHNHG
FT                   FDEQPRLFYMHFWAENDAVALARTLRAAVDATAAR"
FT   gene            704634..705242
FT                   /locus_tag="TBFG_10616"
FT                   /old_locus_tag="TBFG_00608"
FT   CDS_pept        704634..705242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10616"
FT                   /old_locus_tag="TBFG_00608"
FT                   /product="hypothetical resolvase"
FT                   /note="Mapped to H37Rv Rv0605"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10616"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04959"
FT                   /protein_id="ABR04959.1"
FT                   /translation="MACCRNRGMNLAAWAERNGVARVTAYRWFHAGLLPVPARKVGRLI
FT                   LVDELASEAGAQPKTAVYARVSSADQKSDLDRQVARVTSWATAEQIPVDKVVTEVGSVL
FT                   NGHRRKFPAVLRDLSVTRIVVEHRDRFCRFGSEYVHAALAAQGRELVVVDSAEVDDDLV
FT                   WDMTEILTSMCARLYGKRAAQNRAKRAVAAAAVDDHEAA"
FT   gene            705244..705987
FT                   /locus_tag="TBFG_10617"
FT                   /old_locus_tag="TBFG_00609"
FT   CDS_pept        705244..705987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10617"
FT                   /old_locus_tag="TBFG_00609"
FT                   /product="transposase"
FT                   /note="Mapped to H37Rv Rv0606"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10617"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04960"
FT                   /protein_id="ABR04960.1"
FT                   /translation="MPRLEIPNGWCVQAFRFTLDPTAEQAHALARHFGARRKAYNWTVA
FT                   QLKADIQAWRATGAQTAKPSLRVLRKRWNTVKDEVCVNAETGTVWWPECSKEAYADGIA
FT                   GAVDAYWNWQQRRAGKRDGKRMGFPRFKKKGRDADRVSFTTGAMRVEPDRRHLTLPVIG
FT                   CVRTHENTRRIERLIAKDRARVLAITVRRNGTRLDASVRVLVQRPQQPNVELPESRIGV
FT                   DVGVRRLATVATADGACCPVLVPDG"
FT   gene            705957..706427
FT                   /locus_tag="TBFG_10618"
FT                   /old_locus_tag="TBFG_00610"
FT   CDS_pept        705957..706427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10618"
FT                   /old_locus_tag="TBFG_00610"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0607"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10618"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04961"
FT                   /protein_id="ABR04961.1"
FT                   /translation="MLPGPGARRLTLGIIPEGGAHIDVPRKTVGAWQTADTMGIFQALP
FT                   DVWGGWRTECWEDRFEEQLIRCNGALRLPELDLAAGMDSAREWLRDRIFQRFSDSPAGQ
FT                   ILKLSELLADVGPGLVVSDDAVTNGGARPNNEEWARFVAACDLVRGAHAESA"
FT   gene            706472..706717
FT                   /locus_tag="TBFG_10619"
FT                   /old_locus_tag="TBFG_00611"
FT   CDS_pept        706472..706717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10619"
FT                   /old_locus_tag="TBFG_00611"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0608"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10619"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04962"
FT                   /protein_id="ABR04962.1"
FT                   /translation="MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDL
FT                   AARLLAIGHKTASRMSPEAKRLDHDALLYDERGLPA"
FT   gene            706714..707115
FT                   /locus_tag="TBFG_10620"
FT                   /old_locus_tag="TBFG_00612"
FT   CDS_pept        706714..707115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10620"
FT                   /old_locus_tag="TBFG_00612"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0609"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10620"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04963"
FT                   /protein_id="ABR04963.1"
FT                   /translation="MIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVL
FT                   DSQRDPVISRALDELIEEAEFVVEPVTERQARLARAAYADFGRGSGHPAGLNFGDCLSY
FT                   ALAIDRREPLLWKGNDFGHTGVQRALDRR"
FT   gene            complement(707980..709137)
FT                   /locus_tag="TBFG_10621"
FT                   /old_locus_tag="TBFG_00613"
FT   CDS_pept        complement(707980..709137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10621"
FT                   /old_locus_tag="TBFG_00613"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0610c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10621"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04964"
FT                   /protein_id="ABR04964.1"
FT                   /translation="MDDELRGLLARYARGELSADDARRAILRYPKWRVAEIDGELETVA
FT                   LDDGTPMLIAESSASDGREYSGLELVRDIAPLVGGLSFDPDEPWGSAFRPGALPELQNW
FT                   ARTVELEDAVAKPGPGQRDLLYEGPWWVAVSPGTGRPAVHRADGLDVITIMTAPDAAAT
FT                   FRRTERHRGLDVVRLGPALWGDLAKRSDFDGVRLNPLRPLAQLWPPHVPAMLVAGCDPR
FT                   PNAEPLPARTVAEIHLWLDQHGARQEKRELSNRATPVGEVTVARAWWNYDRREIAFTRV
FT                   APASDTEGLGSVPSRILCAGKLRQSIQSKLAGLPRLTWRADAWHRQRAALAVGWALELE
FT                   KLVCGERVPFAALRTPEGAHLWHLEPQAFTARAIRKLRDRAASFR"
FT   gene            complement(709189..709572)
FT                   /locus_tag="TBFG_10622"
FT                   /old_locus_tag="TBFG_00614"
FT   CDS_pept        complement(709189..709572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10622"
FT                   /old_locus_tag="TBFG_00614"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0611c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10622"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04966"
FT                   /protein_id="ABR04966.1"
FT                   /translation="MPDRPQHPTASRQSSMVSWNHGAAGWLHCVQCGSATNPTACLDWL
FT                   PPIHARSGPMYAEHDVVVLTRDVPDKSLIAGDVGAVVGRYAAGGYEVDFTAANGCTVAV
FT                   VTLAGDDIRPRRRREIPHVREVA"
FT   gene            709552..710157
FT                   /locus_tag="TBFG_10623"
FT                   /old_locus_tag="TBFG_00615"
FT   CDS_pept        709552..710157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10623"
FT                   /old_locus_tag="TBFG_00615"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0612"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10623"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04965"
FT                   /protein_id="ABR04965.1"
FT                   /translation="MLGPIRQPRLTVRPGRLPGMIAGVAAKRMNREQFFRAASGLDEDR
FT                   LRKALWNLYWRGTANMRERIEAELASAGRARPARKIKPPADPDIVGWEVDEFVSLARSG
FT                   AYLGGDRRVSPRERSRWRFTFKRLAAEAQDALRAEDAEPAASALEQLIDLAREADGYDY
FT                   FRSDDPVAAAGFVVSDVAAAGHPHFREFAAEIGAAIPP"
FT   gene            complement(710176..712743)
FT                   /locus_tag="TBFG_10624"
FT                   /old_locus_tag="TBFG_00616"
FT   CDS_pept        complement(710176..712743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10624"
FT                   /old_locus_tag="TBFG_00616"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0613c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10624"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04967"
FT                   /protein_id="ABR04967.1"
FT                   /translation="MAEAFDATQAVARILAEHGPLSEDDIARRLLDSGVADPDAVLRAL
FT                   RLETEWPARQLVDDRWVWLPTLLAGRVFTHRLGADEAVHDMLGVTPDLDPIITLCEHEE
FT                   YGRLADGSAARIVLAGYDEELLERRGIPDEAIDPGGALLLEPGTLATLGAAAGDLVGVR
FT                   LTAAGLVLERIGTAGADTSVGARLAELVDPDEPAFFPAAVWTACVDDPAAFTEPVAPLR
FT                   EILDQHGLTHEDDWLAPGGFNFDAWRFENRCELLAFRHDLDPNDAVALYTLIKLHETMS
FT                   LLLEATDPDELPRDVLATAAETATETGSDSLVDLLGDIGAALADPLLAELLVAETVGTD
FT                   SGGAAALGLLTEMLEPKVPRAARVAVRWLRAVALDRIGDVEAAERELLAAESMDTEWPL
FT                   PLLDLARIASDRGDAERGLALLRRAGTEPDHPLVRLLERHRAQPRRDLGRNEACWCGSG
FT                   RKYKKCHLGREALPLAERVDWLYAKASQHALSGDWTGLLAEVSYERFRYADSDDEDALA
FT                   AALADPLVLDAVLFEGGAFAEFLEVRGSLLPDDERLLAEQWLLVERSVFEVEHVQPGEG
FT                   VIVRDVRTGDTHEVHERAASRQLRAGQLICARPVPAGDTMVFFGGIEPVALHERAVLIE
FT                   LLDDEPDPVTLVAQLSRRFAPPTLVNTEGDSLAICEASVRVDDPAGIQGALDGVYDRVD
FT                   GEEPPRWIEHVTNDGMLRVRATLVLDGDTLRVETNSEPRMDRVLATLTRLDPAMTVLDD
FT                   DRRPLRNTREAAALAEQMPVTGAGAPDPDSPELAAALEEFIRDYETSWLDQPIPALDGH
FT                   TPRQAADDPTRRADLIKLLDTFPAGAGARGGMDADRLRTALGL"
FT   gene            712827..713576
FT                   /locus_tag="TBFG_10625"
FT                   /old_locus_tag="TBFG_00617"
FT   CDS_pept        712827..713576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10625"
FT                   /old_locus_tag="TBFG_00617"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0614"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10625"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04968"
FT                   /protein_id="ABR04968.1"
FT                   /translation="MTAPTRWTLADGRELLFFSLPGPRTSGTAAERVARHAQAQTFAGD
FT                   IRQRAIQLVVSEQEVASKITAATAGIATTTFPETPSIDDTIIGNDNRDTGVRLVDVKQD
FT                   GGTSPPPPFAPWDTPDGTPPPGTGLSPTLQQMILGGDPANLTGQGLADNVQRFVQSLPA
FT                   NDPNTAWLRGQVADLQAHVADIEYARTHCSTNDWIDRTAQFASGAIVFSIGVLTAETGA
FT                   GVVAAAAGGVGAATAGVSLLQCLVGSK"
FT   gene            713576..713815
FT                   /locus_tag="TBFG_10626"
FT                   /old_locus_tag="TBFG_00618"
FT   CDS_pept        713576..713815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10626"
FT                   /old_locus_tag="TBFG_00618"
FT                   /product="hypothetical integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0615"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10626"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04969"
FT                   /protein_id="ABR04969.1"
FT                   /translation="MDVLAAGIAAGALTLAAWGAWRPHYRAASYLVAGAVELALIGLLV
FT                   VTGQTLMAISVAFLVALGGPLVVVNHRRAERSRG"
FT   gene            complement(713812..714078)
FT                   /locus_tag="TBFG_10627"
FT   CDS_pept        complement(713812..714078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10627"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0616c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10627"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04970"
FT                   /protein_id="ABR04970.1"
FT                   /translation="MRIPGNRQCLLVQVLRQVDGSAHRLILTSLHRDARADAHRYSNGT
FT                   DHAGRAADEPAETAHEPCWVAARGLASQASRAMSATYRPSSFI"
FT   gene            714234..714635
FT                   /locus_tag="TBFG_10628"
FT                   /old_locus_tag="TBFG_00620"
FT   CDS_pept        714234..714635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10628"
FT                   /old_locus_tag="TBFG_00620"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0617"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10628"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04971"
FT                   /protein_id="ABR04971.1"
FT                   /translation="MTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSL
FT                   VRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALSFAGVEVAGVVGHRQVTDAYLAQLA
FT                   RSHDGQLATLDSGLAHLHGDVAVLIPTTT"
FT   gene            714764..715459
FT                   /locus_tag="TBFG_10629"
FT                   /old_locus_tag="TBFG_00621"
FT   CDS_pept        714764..715459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10629"
FT                   /old_locus_tag="TBFG_00621"
FT                   /product="galactose-1-phosphate uridylyltransferase galTa"
FT                   /note="Mapped to H37Rv Rv0618"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10629"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04972"
FT                   /protein_id="ABR04972.1"
FT                   /translation="MSATPPPGGLDASVFIANERGRQLDEALPVGFCVVTAPTRWTLAD
FT                   GRDLLFFSLPGHVPAPVSDRRPLPERDPAPSRLRFDRATGQWVIVAAQRQDRTYKPPAA
FT                   RCPLCPGPTGLSSEVPAPDYDVVVFENRFPSLAGAGIAPIGAPDGDGFVSAPGHGRCEV
FT                   ICFSADHTGSFAGLDPAHARLVVHAWRHRTAELTALPGVAQVFCFENRGEEIGVTLPTR
FT                   TARFTPIRI"
FT   gene            715477..715947
FT                   /locus_tag="TBFG_10630"
FT                   /old_locus_tag="TBFG_00622"
FT   CDS_pept        715477..715947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10630"
FT                   /old_locus_tag="TBFG_00622"
FT                   /product="galactose-1-phosphate uridylyltransferase galTb"
FT                   /note="Mapped to H37Rv Rv0619"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10630"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04973"
FT                   /protein_id="ABR04973.1"
FT                   /translation="MLRQARRHRKRHGDNLFASLLAREVADGSRIVVRGELFTAFVPFA
FT                   ARWPVEVHIYPNRLVRNLTELNDGELDEFARIYLDVLQRFDRMYSSPLPYMSALHQFSE
FT                   VQRDGYFHVELMSIRRSATKLKYLAAAESAMDAFIADVIPESVATRLRELGP"
FT   gene            715944..717035
FT                   /locus_tag="TBFG_10631"
FT                   /old_locus_tag="TBFG_00623"
FT   CDS_pept        715944..717035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10631"
FT                   /old_locus_tag="TBFG_00623"
FT                   /product="galactokinase galK"
FT                   /note="Mapped to H37Rv Rv0620"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10631"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04974"
FT                   /protein_id="ABR04974.1"
FT                   /translation="MTVSYGAPGRVNLIGEHTDHNLGFALPIALPRRTVVTFTPEHTGA
FT                   ITARSDRADGSARIPLDTTPGQVTGWAAYAAGAIWALRGAGHPVPGGAMSITSDVEIGS
FT                   GLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFGAPK
FT                   TALLIDFRDITVRPVAFDPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVS
FT                   SLRAVQDRGLAALGAIADPIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHE
FT                   SMREDFAITTERIDLIAESAVRAGALGARMTGGGFGGAVIALVPADRARDVADTVRRAA
FT                   VTAGYDEPAVSRTYAAPGAAECR"
FT   gene            717421..718494
FT                   /locus_tag="TBFG_10632"
FT                   /old_locus_tag="TBFG_00624"
FT   CDS_pept        717421..718494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10632"
FT                   /old_locus_tag="TBFG_00624"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0621"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10632"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04975"
FT                   /protein_id="ABR04975.1"
FT                   /translation="MQPMAGDRGADPGPANVTPGADDHAQHASPTVLCPQGHVNAWDYR
FT                   FCERCGSPIGVVPWPSEESGTRQTAPARSFVPLVVLAATLLVVAVVVTAVGYAVTRPAR
FT                   NDREEPSSARGAATTGVPFAQAEAASCPDDPVLEAESIDLTSDGLAVSAAFMSACAGGD
FT                   VESNSALEVTVADGRRDVAAGSFDFSADPLRIEPGVPARRTLVFPPGMYWRTPDMLSGA
FT                   PALAATRKGRSDRSAARGGSARTTMVAAASAAPAYGSINAVAGAVLVELRDSDFPYVRV
FT                   GIANRWVPQVSSKRVGLVAAGKTWTSADILRDHLALRQRFGGARLVWSGHWTTFSGPDF
FT                   WVTVVGPAQPTAAEANR"
FT   gene            718598..719545
FT                   /locus_tag="TBFG_10633"
FT                   /old_locus_tag="TBFG_00625"
FT   CDS_pept        718598..719545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10633"
FT                   /old_locus_tag="TBFG_00625"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0622"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10633"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04976"
FT                   /protein_id="ABR04976.1"
FT                   /translation="MSFCVYCGAELADPTRCGACGAYKIGSTWHRTTTPTVGAATTATG
FT                   WRPDPTGRHEGRYFVAGQPTDLVREGDAEAVDPLGQQQLDQSGAVGVSPSAVSGWVRSG
FT                   HRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRESIDDKYLAALRRSGLTGEFNSDANAI
FT                   ARGKQVCRQLQDGGEQQGMPVDQVAVQYYCPQFSDGFHILETITVTGSFTLKDESPNVY
FT                   APAITVSGSGCSGSAGYADIDRGTQVTVKNGQGDILATAFLQAGQGGRFLCTFPFSFEI
FT                   TEGEDRYVVSVSRRGEMSYSFADLKANGLSLVLG"
FT   gene            719638..719892
FT                   /locus_tag="TBFG_10634"
FT                   /old_locus_tag="TBFG_00626"
FT   CDS_pept        719638..719892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10634"
FT                   /old_locus_tag="TBFG_00626"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0623"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10634"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04977"
FT                   /protein_id="ABR04977.1"
FT                   /translation="MALSIKHPEADRLARALAARTGETLTEAVVTALRERLARETGRAR
FT                   VVPLRDELAAIRHRCAALPVVDNRSAEAILGYDERGLPA"
FT   gene            719892..720287
FT                   /locus_tag="TBFG_10635"
FT                   /old_locus_tag="TBFG_00627"
FT   CDS_pept        719892..720287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10635"
FT                   /old_locus_tag="TBFG_00627"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0624"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10635"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04978"
FT                   /protein_id="ABR04978.1"
FT                   /translation="MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVI
FT                   EARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKGRHRAGLNYGDCFSYG
FT                   LAKISGQPLLFKGEDFQHTDIATVALP"
FT   gene            complement(720381..721121)
FT                   /locus_tag="TBFG_10636"
FT                   /old_locus_tag="TBFG_00628"
FT   CDS_pept        complement(720381..721121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10636"
FT                   /old_locus_tag="TBFG_00628"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0625c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10636"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04979"
FT                   /protein_id="ABR04979.1"
FT                   /translation="MSTHNDSAPTSRRRHIVRLVVFAGFLVGMFYLVAATDVIDVAAVR
FT                   GAVSATGPAAPLTYVVVSAVLGALFVPGPILAASSGLLFGPLVGVFVTLGATVGTAVVA
FT                   SLVGRRAGRASARALLGGERADRTDALIERCGLWAVVGQRFVPGISDAFASYAFGTFGV
FT                   PLWQMAVGAFIGSAPRAFAYTALGAAIGDRSPLLASCAIAVWCVTAIIGAFAARHGYRQ
FT                   WRAHARGDGADGGVEDPDREVGAR"
FT   gene            721253..721513
FT                   /locus_tag="TBFG_10637"
FT                   /old_locus_tag="TBFG_00629"
FT   CDS_pept        721253..721513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10637"
FT                   /old_locus_tag="TBFG_00629"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0626"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10637"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04980"
FT                   /protein_id="ABR04980.1"
FT                   /translation="MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRR
FT                   RRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR"
FT   gene            721510..721917
FT                   /locus_tag="TBFG_10638"
FT                   /old_locus_tag="TBFG_00630"
FT   CDS_pept        721510..721917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10638"
FT                   /old_locus_tag="TBFG_00630"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0627"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10638"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04981"
FT                   /protein_id="ABR04981.1"
FT                   /translation="MSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRV
FT                   GVLAAATTDIRAQRLATLESVADMETLPVDDDAARMWARLRIHLAESGRRVRINDLWIA
FT                   AVAASRALPVITQDDDFAALDGAASVEIIRV"
FT   gene            complement(721989..723140)
FT                   /locus_tag="TBFG_10639"
FT                   /old_locus_tag="TBFG_00631"
FT   CDS_pept        complement(721989..723140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10639"
FT                   /old_locus_tag="TBFG_00631"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0628c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10639"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04982"
FT                   /protein_id="ABR04982.1"
FT                   /translation="MRIGVGVSTAPDVRRAAAEAAAHAREELAGGTPALAVLLGSRSHT
FT                   DQAVDLLAAVQASVEPAALIGCVAQGIVAGRHELENEPAVAVWLASGPPAETFHLDFVR
FT                   TGSGALITGYRFDRTAHDLHLLLPDPYSFPSNLLIEHLNTDLPGTTVVGGVVSGGRRRG
FT                   DTRLFRDRDVLTSGLVGVRLPGAHSVSVVSQGCRPIGEPYIVTGADGAVITELGGRPPL
FT                   HRLREIVLGMAPDEQELVSRGLQIGIVVDEHLAVPGQGDFLIRGLLGADPTTGAIGIGE
FT                   VVEVGATVQFQVRDAAAADKDLRLAVERAAAELPGPPVGGLLFTCNGRGRRMFGVTDHD
FT                   ASTIEDLLGGIPLAGFFAAGEIGPVAGHNALHGFTASMALFVD"
FT   gene            complement(723233..724960)
FT                   /locus_tag="TBFG_10640"
FT                   /old_locus_tag="TBFG_00632"
FT   CDS_pept        complement(723233..724960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10640"
FT                   /old_locus_tag="TBFG_00632"
FT                   /product="exonuclease V alpha subunit recD"
FT                   /note="Mapped to H37Rv Rv0629c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10640"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04983"
FT                   /protein_id="ABR04983.1"
FT                   /translation="MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDE
FT                   RVALAVAVAVRALRAGSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLH
FT                   LYDDRLLYLDRYWREEEQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQ
FT                   GVTVLTGGPGTGKTTTVARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREM
FT                   AKLDATDRARLGDLHAVTLHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMAR
FT                   LAEAVRPGARLILVGDADQLASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGT
FT                   LAEAIRAGDGDAVLGLLRSGEERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVA
FT                   LATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLR
FT                   VYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVL
FT                   MPQEDSRLLTRELLYTAVTRAKRKVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG"
FT   gene            complement(724957..728241)
FT                   /locus_tag="TBFG_10641"
FT                   /old_locus_tag="TBFG_00633"
FT   CDS_pept        complement(724957..728241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10641"
FT                   /old_locus_tag="TBFG_00633"
FT                   /product="exonuclease V beta subunit recB"
FT                   /note="Mapped to H37Rv Rv0630c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10641"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04984"
FT                   /protein_id="ABR04984.1"
FT                   /translation="MDRFELLGPLPREGTTTVLEASAGTGKTFALAGLVTRYLAETAAT
FT                   LDEMLLITFNRAASRELRERVRGQIVEAVGALQGDAPPSGELVEHLLRGSDAERAQKRS
FT                   RLRDALANFDAATIATTHEFCGSVLKSLGVAGDNAADVELKESLTDLVTEIVDDRYLAN
FT                   FGRQETDPELTYAEALALALAVVDDPCAQLRPPDPEPGSKAAVRLRFAAEVLEELERRK
FT                   GRLRAQGFNDLLIRLATALEAADSPARDRMRERWRIVLVDEFQDTDPMQWRVLERAFSR
FT                   HSALILIGDPKQAIYGFRGGDIHTYLKAAGTADARYTLGVNWRSDRALVESLQTVLRDA
FT                   TLGHADIVVRGTDAHHAGHRLASAPRPAPFRLRVVKRHTLGYDGTAHVPIEALRRHIPD
FT                   DLAADVAALLASGATFAGRPVVAADIAVIVEHHKDARACRNALAEAGIPAIYTGDTDVF
FT                   ASQAAKDWLCLLEAFDAPQRSGLVRAAACTMFFGETAESLAAEGDALTDRVAGTLREWA
FT                   DHARHRGVAAVFQAAQLAGMGRRVLSQRGGERDLTDLAHIAQLLHEAAHRERLGLPGLR
FT                   DWLRRQAKAGAGPPEHNRRLDSDAAAVQIMTVFVAKGLQFPIVYLPFAFNRNVRSDDIL
FT                   LYHDDGTRCLYIGGKDGGAQRRTVEGLNRVEAAHDNLRLTYVALTRAQSQVVAWWAPTF
FT                   DEVNGGLSRLLRGRRPGQSQVPDRCTPRVTDEQAWAVFAQWEAAGGPSVEESVIGARSS
FT                   LEKPVPVPGFEVRHFHRRIDTTWRRTSYSDLVRGSEAVTVTSEPAAGGRADEVEIAVVA
FT                   APGSGADLTSPLAALPSGASFGSLVHAVLETADPAAPDLAAELEAQVRRHAPWWTVDVD
FT                   HAQLAPELARALLPMHDTPLGPAAAALTLRQIGVRDRLRELDFEMPLAGGDLRGRSPDV
FT                   SLADVGELLASHLPGDDPLSPYADRLGSAGLGDQPLRGYLAGSIDVVLRLPGQRYLVVD
FT                   YKTNHLGDTAADYGFERLTEAMLHSDYPLQALLYVVVLHRFLRWRQRDYAPARHLGGVL
FT                   YLFVRGMCGAATPVTAGHPAGVFTWNPPTALVVALSDLLDRGRLQS"
FT   gene            complement(728241..731534)
FT                   /locus_tag="TBFG_10642"
FT                   /old_locus_tag="TBFG_00634"
FT   CDS_pept        complement(728241..731534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10642"
FT                   /old_locus_tag="TBFG_00634"
FT                   /product="exonuclease V gamma subunit recC"
FT                   /note="Mapped to H37Rv Rv0631c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10642"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04985"
FT                   /protein_id="ABR04985.1"
FT                   /translation="MALHLHRAERTDLLADGLGALLADPQPDPFAQELVLVAARGVERW
FT                   LSQRLSLVLGCGPGRADGVCAGIAFRNPQSLIAEITGTLDDDPWSPEALAWPLLAVIDA
FT                   SLDEPWCRTLASHLGHFATTDAEAELRRGRRYSVARRLAGLFASYARQRPGLLAAWLDG
FT                   DLGELPGDLAWQPPLWRALVTTVGADPPHVRHDKTIARLRDGPADLPARLSLFGHTRLA
FT                   CTDVQLLDALAVHHDLHLWLPHPSDELWRALAGFQGADGLLPRRQDTSRRAAQHPLLET
FT                   LGRDVRELQRALPAARATDEFLGATTKPDTLLGWLQADIAGNAPRPAGRSLSDADRSVQ
FT                   VHACHGPARQIDVLREVLLGLLEDDPTLQPRDIVVMCPDIDTYAPLIVAGFGLGEVAGD
FT                   CHPAHRLRVRLADRALTQTNPLLSVAAELLTIAETRATASQLLNLAQAAPVRAKFGFAD
FT                   DDLDTITTWVRESNIRWGFDPTHRRRYGLDTVVHNTWRFGLDRILTGVAMSEDSQAWLD
FT                   TALPLDDVGSNRVELAGMLAEFVERLHHVVGGLSGARPLVAWLDALATGIDLLTACNDG
FT                   WQRAQVQREFADVLARAGSRAAPLLRLPDVRALLDAQLAGRPTRANFRTGTLTVCTMVP
FT                   MRSVPHRVVCLVGLDDGVFPRLSHPDGDDVLAREPMTGERDIRSEDRQLLLDAIGAATQ
FT                   TLVITYTGADERTGQPRPPAVPLAELLDALDQTTSAPVRERILVTHPLQPFDRKNVTPG
FT                   ALLGAKPFTFDPAALAAAQAAAGKRCPPTAFISGRLPAPPAADVTLADLLDFFKDPVKG
FT                   FFRALDYTLPWDVDTVEDSIPVQVDALAEWTVGERMLRDMLRGLHPDDAAHSEWRRGTL
FT                   PPGRLGVRRAKEIRNRARDLAAAALAHRDGHGQAHDVDVDLGDGRRLSGTVTPVFGGRT
FT                   VSVTYSKLAPKHVLPAWIGLVTLAAQEPGREWSALCIGRSKTRNHIARRLFVPPPDPVA
FT                   VLRELVLLYDAGRREPLPLPLKTSCAWAQARRDGQDPYPPARECWQTNRFRPGDDDAPA
FT                   HVRAWGPRAPFEVLLGKPRAGEEVAGEETRLGALAARLWLPLLAAEGSV"
FT   gene            complement(731811..732506)
FT                   /locus_tag="TBFG_10643"
FT                   /old_locus_tag="TBFG_00635"
FT   CDS_pept        complement(731811..732506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10643"
FT                   /old_locus_tag="TBFG_00635"
FT                   /product="enoyl-CoA hydratase echA3"
FT                   /note="Mapped to H37Rv Rv0632c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10643"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04986"
FT                   /protein_id="ABR04986.1"
FT                   /translation="MSDPVSYTRKDSIAVISMDDGKVNALGPAMQQALNAAIDNADRDD
FT                   VGALVITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMACTGHA
FT                   IAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLTRSAYQQATGLAKT
FT                   FFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQHAHAATKLRSRADALTAIRAGI
FT                   DGIAAEFGL"
FT   gene            complement(732555..733394)
FT                   /locus_tag="TBFG_10644"
FT                   /old_locus_tag="TBFG_00636"
FT   CDS_pept        complement(732555..733394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10644"
FT                   /old_locus_tag="TBFG_00636"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0633c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10644"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04987"
FT                   /protein_id="ABR04987.1"
FT                   /translation="MVDSMGWVLSSWHEVTGVDSGTWLAWAAWAALGLGVVALVVTKRQ
FT                   IQRNRRLAAEQTRPYVAMFMEPHVADWHVIELVVRNFGRTAAYDVRFSFPNPPTVAQYE
FT                   NAANGYADVVELRLPQELPMLAPGQEWRMVWDSALDRAEIGRGIESRFPGTVTYYDRPE
FT                   QPRRWRFWRRGRRPLETKVVLDWDALPPVARIELMTTHDLAKREKQKLELLRSLLTYFH
FT                   YASKETRPDVFRSEIDRINRAAAETQDRWRARQVEVPTEVSQRSEGQGPQPTRIPAG"
FT   gene            complement(733548..734261)
FT                   /locus_tag="TBFG_10645"
FT                   /old_locus_tag="TBFG_00637"
FT   CDS_pept        complement(733548..734261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10645"
FT                   /old_locus_tag="TBFG_00637"
FT                   /product="hypothetical glyoxalase II"
FT                   /note="Mapped to H37Rv Rv0634c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10645"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04988"
FT                   /protein_id="ABR04988.1"
FT                   /translation="MSKDRLYFRQLLSGRDFAVGDMFATQMRNFAYLIGDRTTGDCVVV
FT                   DPAYAAGDLLDALESDDMQLSGVLVTHHHPDHVGGSMMGFQLPGLAELLERASVPVHVN
FT                   THEALWVSRVTGIPVGDLITHEHGDKVSVGDIDIELLHTPGHTPGSQCFLLDGRLVAGD
FT                   TLFLEGCGRTDFPGGDSDEMYRSLRQLAELPGDPTVFPGHWYSAEPSASLSEVKRSNYV
FT                   YRPASLDQWRMLMGG"
FT   gene            734341..734592
FT                   /locus_tag="TBFG_10646"
FT                   /old_locus_tag="TBFG_00638"
FT   CDS_pept        734341..734592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10646"
FT                   /old_locus_tag="TBFG_00638"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0634A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10646"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04989"
FT                   /protein_id="ABR04989.1"
FT                   /translation="MGSDCGCGGYLWSMLKRVEIEVDDDLIQKVIRRYRVKGAREAVNL
FT                   ALRTLLGEADTAEHGHDDEYDEFSDPNAWVPRRSRDTG"
FT   gene            734722..734794
FT                   /locus_tag="TBFG_14006"
FT   tRNA            734722..734794
FT                   /locus_tag="TBFG_14006"
FT                   /product="tRNA-Thr"
FT   gene            734831..734907
FT                   /locus_tag="TBFG_14007"
FT   tRNA            734831..734907
FT                   /locus_tag="TBFG_14007"
FT                   /product="tRNA-Met"
FT   gene            734940..735107
FT                   /locus_tag="TBFG_10647"
FT                   /old_locus_tag="TBFG_00639"
FT   CDS_pept        734940..735107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10647"
FT                   /old_locus_tag="TBFG_00639"
FT                   /product="50S ribosomal protein L33 rpmG2"
FT                   /note="Mapped to H37Rv Rv0634B"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10647"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04990"
FT                   /protein_id="ABR04990.1"
FT                   /translation="MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNC
FT                   GKHQAHRETR"
FT   gene            735158..735634
FT                   /locus_tag="TBFG_10648"
FT                   /old_locus_tag="TBFG_00640"
FT   CDS_pept        735158..735634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10648"
FT                   /old_locus_tag="TBFG_00640"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0635"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10648"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04991"
FT                   /protein_id="ABR04991.1"
FT                   /translation="MALSADIVGMHYRYPDHYEVEREKIREYAVAVQNDDAWYFEEDGA
FT                   AELGYKGLLAPLTFICVFGYKAQAAFFKHANIATAEAQIVQVDQVLKFEKPIVAGDKLY
FT                   CDVYVDSVREAHGTQIIVTKNIVTNEEGDLVQETYTTLAGRAGEDGEGFSDGAA"
FT   gene            735621..736049
FT                   /locus_tag="TBFG_10649"
FT                   /old_locus_tag="TBFG_00641"
FT   CDS_pept        735621..736049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10649"
FT                   /old_locus_tag="TBFG_00641"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0636"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10649"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04992"
FT                   /protein_id="ABR04992.1"
FT                   /translation="MALREFSSVKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDE
FT                   IAKVVGLDTAIAHGMLTMGIGGGYVTSWVGDPGAVTEYNVRFTAVVPVPNDGKGAELVF
FT                   NGRVKSVDPESKSVTIALTATTGGKKIFGRAIASAKLA"
FT   gene            736053..736553
FT                   /locus_tag="TBFG_10650"
FT                   /old_locus_tag="TBFG_00642"
FT   CDS_pept        736053..736553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10650"
FT                   /old_locus_tag="TBFG_00642"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0637"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10650"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04993"
FT                   /protein_id="ABR04993.1"
FT                   /translation="MALKTDIRGMIWRYPDYFIVGREQCREFARAVKCDHPAFFSEEAA
FT                   ADLGYDALVAPLTFVTILAKYVQLDFFRHVDVGMETMQIVQVDQRFVFHKPVLAGDKLW
FT                   ARMDIHSVDERFGADIVVTRNLCTNDDGELVMEAYTTLMGQQGDGSARLKWDKESGQVI
FT                   RTA"
FT   gene            736752..736824
FT                   /locus_tag="TBFG_14008"
FT   tRNA            736752..736824
FT                   /locus_tag="TBFG_14008"
FT                   /product="tRNA-Trp"
FT   gene            736965..737450
FT                   /locus_tag="TBFG_10651"
FT                   /old_locus_tag="TBFG_00643"
FT   CDS_pept        736965..737450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10651"
FT                   /old_locus_tag="TBFG_00643"
FT                   /product="preprotein translocase secE1 subunit"
FT                   /note="Mapped to H37Rv Rv0638"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10651"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04994"
FT                   /protein_id="ABR04994.1"
FT                   /translation="MSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKR
FT                   SRSRAAGADADVDVEEPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAF
FT                   VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG"
FT   gene            737482..738198
FT                   /locus_tag="TBFG_10652"
FT                   /old_locus_tag="TBFG_00644"
FT   CDS_pept        737482..738198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10652"
FT                   /old_locus_tag="TBFG_00644"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="Mapped to H37Rv Rv0639"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10652"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04995"
FT                   /protein_id="ABR04995.1"
FT                   /translation="MTTFDGDTSAGEAVDLTEANAFQDAAAPAEEVDPAAALKAELRSK
FT                   PGDWYVVHSYAGYENKVKANLETRVQNLDVGDYIFQVEVPTEEVTEIKNGQRKQVNRKV
FT                   LPGYILVRMDLTDDSWAAVRNTPGVTGFVGATSRPSALALDDVVKFLLPRGSTRKAAKG
FT                   AASTAAAAEAGGLERPVVEVDYEVGESVTVMDGPFATLPATISEVNAEQQKLKVLVSIF
FT                   GRETPVELTFGQVSKI"
FT   gene            738250..738678
FT                   /locus_tag="TBFG_10653"
FT                   /old_locus_tag="TBFG_00645"
FT   CDS_pept        738250..738678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10653"
FT                   /old_locus_tag="TBFG_00645"
FT                   /product="50S ribosomal protein L11 rplK"
FT                   /note="Mapped to H37Rv Rv0640"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10653"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04996"
FT                   /protein_id="ABR04996.1"
FT                   /translation="MAPKKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYN
FT                   AATENQRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVAKVTW
FT                   DQVREIAETKKTDLNANDVDAAAKIIAGTARSMGITVE"
FT   gene            738745..739452
FT                   /locus_tag="TBFG_10654"
FT                   /old_locus_tag="TBFG_00646"
FT   CDS_pept        738745..739452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10654"
FT                   /old_locus_tag="TBFG_00646"
FT                   /product="50S ribosomal protein L1 rplA"
FT                   /note="Mapped to H37Rv Rv0641"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10654"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04997"
FT                   /protein_id="ABR04997.1"
FT                   /translation="MSKTSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVA
FT                   IRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERI
FT                   QGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINF
FT                   RVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGI
FT                   PVDPSITRNFAGE"
FT   gene            complement(739526..740422)
FT                   /locus_tag="TBFG_10655"
FT                   /old_locus_tag="TBFG_00647"
FT   CDS_pept        complement(739526..740422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10655"
FT                   /old_locus_tag="TBFG_00647"
FT                   /product="methoxy mycolic acid synthase 4 mmaA4"
FT                   /note="Mapped to H37Rv Rv0642c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10655"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04998"
FT                   /protein_id="ABR04998.1"
FT                   /translation="MAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFE
FT                   PPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKN
FT                   QHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNI
FT                   MPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGE
FT                   KAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTD
FT                   EMLDCSLVTYLKPGAAA"
FT   gene            complement(740496..741389)
FT                   /locus_tag="TBFG_10656"
FT                   /old_locus_tag="TBFG_00648"
FT   CDS_pept        complement(740496..741389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10656"
FT                   /old_locus_tag="TBFG_00648"
FT                   /product="methoxy mycolic acid synthase 3 mmaA3"
FT                   /note="Mapped to H37Rv Rv0643c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10656"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04999"
FT                   /protein_id="ABR04999.1"
FT                   /translation="MGGHMSDNSTGTTKSRSNVDDVQAHYDLSDAFFALFQDPTRTYSC
FT                   AYFERDDMTLHEAQVAKLDLTLGKLGLEPGMTLLDVGCGWGSVMKRAVERYDVNVVGLT
FT                   LSKNQHAYCQQVLDKVDTNRSHRVLLSDWANFSEPVDRIVTIEAIEHFGFERYDDFFKF
FT                   AYNAMPADGVMLLHSITGLHVKQVIERGIPLTMEMAKFIRFIVTDIFPGGRLPTIETIE
FT                   EHVTKAGFTITDIQSLQPHFARTLDLWAEALQAHKDEAIEIQSAEVYERYMKYLTGCAK
FT                   AFRMGYIDCNQFTLAK"
FT   gene            complement(741525..742436)
FT                   /locus_tag="TBFG_10657"
FT                   /old_locus_tag="TBFG_00649"
FT   CDS_pept        complement(741525..742436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10657"
FT                   /old_locus_tag="TBFG_00649"
FT                   /product="methoxy mycolic acid synthase 2 mmaA2"
FT                   /note="Mapped to H37Rv Rv0644c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10657"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05000"
FT                   /protein_id="ABR05000.1"
FT                   /translation="MQAPKGHLGSGKALHLMVNDLTPHFEDVQAHYDLSDDFFRLFLDP
FT                   TQTYSCAHFEREDMTLEEAQIAKIDLALGKLGLQPGMTLLDIGCGWGATMRRAIAQYDV
FT                   NVVGLTLSKNQAAHVQKSFDEMDTPRDRRVLLAGWEQFNEPVDRIVSIGAFEHFGHDRH
FT                   ADFFARAHKILPPDGVLLLHTITGLTRQQMVDHGLPLTLWLARFLKFIATEIFPGGQPP
FT                   TIEMVEEQSAKTGFTLTRRQSLQPHYARTLDLWAEALQEHKSEAIAIQSEEVYERYMKY
FT                   LTGCAKLFRVGYIDVNQFTLAK"
FT   gene            complement(742555..743445)
FT                   /locus_tag="TBFG_10658"
FT                   /old_locus_tag="TBFG_00650"
FT   CDS_pept        complement(742555..743445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10658"
FT                   /old_locus_tag="TBFG_00650"
FT                   /product="methoxy mycolic acid synthase 1 mmaA1"
FT                   /note="Mapped to H37Rv Rv0645c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10658"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05001"
FT                   /protein_id="ABR05001.1"
FT                   /translation="MYGWRGRLSPMAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCA
FT                   YFERDDMTLEEAQLAKVDLALDKLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTL
FT                   SRNHYERSKDRLAAIGTQRRAEARLQGWEEFEENVDRIVSFEAFDAFKKERYLTFFERS
FT                   YDILPDDGRMLLHSLFTYDRRWLHEQGIALTMSDLRFLKFLRESIFPGGELPSEPDIVD
FT                   NAQAAGFTIEHVQLLQQHYARTLDAWAANLQAARERAIAVQSEEVYNNFMHYLTGCAER
FT                   FRRGLINVAQFTMTK"
FT   gene            complement(743462..744367)
FT                   /locus_tag="TBFG_10659"
FT                   /old_locus_tag="TBFG_00651"
FT   CDS_pept        complement(743462..744367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10659"
FT                   /old_locus_tag="TBFG_00651"
FT                   /product="lipase/esterase lipG"
FT                   /note="Mapped to H37Rv Rv0646c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10659"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05002"
FT                   /protein_id="ABR05002.1"
FT                   /translation="MDIRSGTAVSGDVKLYYEDMGDLDHPPVLLIMGLGAQMLLWRTDF
FT                   CARLVAKGLRVIRYDNRDVGLSTKTERHRPGQPLATRLVRSWLGLPSQAAYTLEDMAAD
FT                   AAALLDHLDVKHAHVVGASMGGMIAQIFAARFAQRTKTLAVIFSSNNHRFLPPPAPRAL
FT                   LALLTGPPPDSPRDVIVDNAVRVSKIIGSPAYPIPEDQVRAEAAESYDRNFHPWGIAQQ
FT                   FSAILGSGSLLRYDRRIVAPTVVIHGRADKLMRPFGGRAVARAINGARLVLIDGMGHDL
FT                   PRQLWDRVIGELTRNFSEAG"
FT   gene            complement(744379..745845)
FT                   /locus_tag="TBFG_10660"
FT                   /old_locus_tag="TBFG_00652"
FT   CDS_pept        complement(744379..745845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10660"
FT                   /old_locus_tag="TBFG_00652"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0647c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10660"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05003"
FT                   /protein_id="ABR05003.1"
FT                   /translation="MRAEIGPDFRPHYTFGDAYPASERAHVNWELSAPVWHTAQMGSTT
FT                   HREVAKLDRVPLPVEAARVAATGWQVTRTAVRFIGRLPRKGPWQQKVIKELPQTFADLG
FT                   PTYVKFGQIIASSPGAFGESLSREFRGLLDRVPPAKTDEVHKLFVEELGDEPARLFASF
FT                   EEEPFASASIAQVHYATLRSGEEVVVKIQRPGIRRRVAADLQILKRFAQTVELAKLGRR
FT                   LSAQDVVADFADNLAEELDFRLEAQSMEAWVSHLHASPLGKNIRVPQVHWDFTTERVLT
FT                   MERVHGIRIDNAAAIRKAGFDGVELVKALLFSVFEGGLRHGLFHGDLHAGNLYVDEAGR
FT                   IVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMGAVGTMKPETQAAKDL
FT                   ERFATPLTMQSLGDMSYADIGRQLSALADAYDVKLPRELVLIGKQFLYVERYMKLLAPR
FT                   WQMMSDPQLTGYFANFMVEVSREHQSDIEV"
FT   gene            745931..750127
FT                   /locus_tag="TBFG_10661"
FT                   /old_locus_tag="TBFG_00653"
FT   CDS_pept        745931..750127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10661"
FT                   /old_locus_tag="TBFG_00653"
FT                   /product="alpha-mannosidase"
FT                   /note="Mapped to H37Rv Rv0648"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10661"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05004"
FT                   /protein_id="ABR05004.1"
FT                   /translation="MRVVSAESTELFVGPSDAPLQLVRVAVTGCTEPAPIRIHGDGLAG
FT                   EAAARPGDDVIEVAVAVESPVVGERRTARVHTPDGPSLAFEFTVAEPGWTMFMISHFHY
FT                   DPVWWNTQGAYTSQWREDPPGRARQANGFELVRAHLEMARREPEYKFVLAEVDYLKPYW
FT                   DTHPQDRADLRRFLADGRIEVMGGTYNEPNTNLTSPETTIRNLVHGIGFQRDVLGAEPA
FT                   TAWQLDVFGHDPQFPGLAADAGLTSSSWARGPHHQWGPAQGGVDRMQFCSEFEWIAPSG
FT                   RGLLTHYMPAHYSAGWSMDSSTSLADAEAATYALFDQLKKVALTRNVLLPVGTDYTPPN
FT                   KWVTAIHRDWGARYTWPRFVCALPKEFFAAVRAELAKRGWVPSPQTRDMNPIYTGKDVS
FT                   YIDTKQANRAAENAVLEAERFAVFAALLTGAEYPQAALAKAWVQLAYGAHHDAITGSES
FT                   DQVYLDLLTGWRDAWELGRAARDNSLRLLSGAVAASHDRVVVWNPLTQRRTDIVTARVD
FT                   PPLQAGVRVFDPDGAEVAALVEHDGRSVTWLACDVPSLGWRVYRLVPADEAPGWELVPG
FT                   TDIANEHYRLAVDPERGGALSSLVQDGRQLIAAGRVANELALYEEYPSHPTQGEGPWHL
FT                   LPTGPVVCSSACPAQVQAYRGPLGQRLVVRGRIGTLLRYTQTLTLWDGVDRVDCRTSID
FT                   EFTGEDRLLRLRWPCPVPGAMPISEVGDAVVGRGFALLHEGPESVDTAQHPWTLDNPAY
FT                   GWFGLSSAVRVRAGDGVRAVSVAEVVSPTETVSGPMARDLMVALVRAGVTATCSGADKP
FT                   RYGHLDVDSNLPDARIALGGPDRNTFTKAVLAEAAPAYTAELQRQLAKTGTARVWVPAA
FT                   NPLARAWLPGADLRAPCALPVLVIDGRDEKHLRAAVASLADDLADAEIVVHQRAAPQME
FT                   PFEDRTVALLNRGVPSFAVDSEGTLHTALMRSCTGWPSGVWIDQPRRTAPDGSNFQLQH
FT                   WTHHFDYALVCGGGDWRRAGIPARSAQFSHPLLAVAPRRPQGELPAVGSLLHVEPADSV
FT                   QLGALKAAGNPLAAGSARPVQPAAVALRLVQTTGADTPVTIGCELGKVGALRPADLLET
FT                   PLAMARARKSSIDLHGYQVATVLARLDVAADMANVLAADDVALAPHAETAQPQYARYWL
FT                   HNRGPAPLGGLPAVAHLHPRRVRGQPGDDVVLRLTAASDCTDSVLGGVVDVVCPLGWPA
FT                   TPARLPFTLGAGAHLQADIALSIPAGAPPGPYPVRAQLRVVDTAVPAAWRQVVEDVCVV
FT                   TVGADSDLEELVYLVDGPADIELAAGDRARLAVTIGSRAHAELALDAHSISPWGTWEWI
FT                   GPPALGAVLPARGMAKLAFDVTPPAWLEPGQWWALVRVGCAGQLVYSPAVKVSVT"
FT   gene            750124..750798
FT                   /locus_tag="TBFG_10662"
FT                   /old_locus_tag="TBFG_00654"
FT   CDS_pept        750124..750798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10662"
FT                   /old_locus_tag="TBFG_00654"
FT                   /product="malonyl CoA-acyl carrier protein transacylase
FT                   fabD2"
FT                   /note="Mapped to H37Rv Rv0649"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10662"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05005"
FT                   /protein_id="ABR05005.1"
FT                   /translation="MSGRSRLPGSSSRRDAARIVAERVVATVAGVAVAVDEVDAAEARL
FT                   RDGPRAAALPASGTSEGRQLRRWLTQLIVTERVVAAEAAARGLTAAGAPAEADLLPDAT
FT                   ARLEIGSVAAAVLADPLARALFAAVTARVAVTDDAVADYHARNPLRFAAPCPGQHGWRA
FT                   PAAAAPPLDQVRRAITEHLLGAARRRAFRVWLDARRNALVVLAPGYEHPGDPRQPDNTR
FT                   RH"
FT   gene            750798..751706
FT                   /locus_tag="TBFG_10663"
FT                   /old_locus_tag="TBFG_00655"
FT   CDS_pept        750798..751706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10663"
FT                   /old_locus_tag="TBFG_00655"
FT                   /product="hypothetical sugar kinase"
FT                   /note="Mapped to H37Rv Rv0650"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10663"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05006"
FT                   /protein_id="ABR05006.1"
FT                   /translation="MLTLCLDIGGTKIAAGLADPAGTLVHTAQRPTPAYGGAEQVWAAV
FT                   AEMIADALGVAGGAVGGVGIASAGPIDLHSGRVSPINIGSWGGFPLRDRVAAAVPGVPV
FT                   RLGGDGVCMALGEHWLGAGRGARFLLGLVVSTGVGGGLVLDGAPCLGRTGNAGHVGHVV
FT                   VDPDGSPCPCGGRGCVETIASGPSLARWARANGWSAPPGAGAKELAEAAGAGDPVALRA
FT                   FRRGAAALAAMIASVGAVCDLDLAVIGGGVAKSGRLLFEPLRAALADHARLDFLAGLRV
FT                   VPAELGGAAGLVGAARLAAIA"
FT   gene            752037..752573
FT                   /locus_tag="TBFG_10664"
FT                   /old_locus_tag="TBFG_00656"
FT   CDS_pept        752037..752573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10664"
FT                   /old_locus_tag="TBFG_00656"
FT                   /product="50S ribosomal protein L10 rplJ"
FT                   /note="Mapped to H37Rv Rv0651"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10664"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05007"
FT                   /protein_id="ABR05007.1"
FT                   /translation="MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTG
FT                   SATYAVAKNTLIKRAASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALV
FT                   IKGGYMDGHPLTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAA
FT                   ALQEKKACPGPDSAE"
FT   gene            752610..753002
FT                   /locus_tag="TBFG_10665"
FT                   /old_locus_tag="TBFG_00657"
FT   CDS_pept        752610..753002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10665"
FT                   /old_locus_tag="TBFG_00657"
FT                   /product="50S ribosomal protein l7/l12 rplL"
FT                   /note="Mapped to H37Rv Rv0652"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10665"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05008"
FT                   /protein_id="ABR05008.1"
FT                   /translation="MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAA
FT                   GAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPL
FT                   LEKVAKEAADEAKAKLEAAGATVTVK"
FT   gene            complement(752995..753690)
FT                   /locus_tag="TBFG_10666"
FT                   /old_locus_tag="TBFG_00658"
FT   CDS_pept        complement(752995..753690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10666"
FT                   /old_locus_tag="TBFG_00658"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0653c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10666"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05009"
FT                   /protein_id="ABR05009.1"
FT                   /translation="MTSQTGVRDELLHAGVRLLDDHGPDALQTRKVAAAAGTSTMAVYT
FT                   HFGGMRGLIAAIAEEGLRQFDVALTVPQTADPVADLLAIGTAYRRYAIERPHMYRLMFG
FT                   STSAHGINVPARDVLTLKVAEIEHQHPSFAHVVRAVHRCLLAGRFATALGADDDTAIVA
FT                   TAAQFWSQIHGFVMLELAGFYGDRGAAVEPVLAAMTVNLLVALGDSPERAQCSLRAEQT
FT                   QKNTLGRAT"
FT   gene            753761..755266
FT                   /locus_tag="TBFG_10667"
FT                   /old_locus_tag="TBFG_00659"
FT   CDS_pept        753761..755266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10667"
FT                   /old_locus_tag="TBFG_00659"
FT                   /product="hypothetical dioxygenase"
FT                   /note="Mapped to H37Rv Rv0654"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10667"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05010"
FT                   /protein_id="ABR05010.1"
FT                   /translation="MTTAQAAESQNPYLEGFLAPVSTEVTATDLPVTGRIPEHLDGRYL
FT                   RNGPNPVAEVDPATYHWFTGDAMVHGVALRDGKARWYRNRWVRTPAVCAALGEPISARP
FT                   HPRTGIIEGGPNTNVLTHAGRTLALVEAGVVNYELTDELDTVGPCDFDGTLHGGYTAHP
FT                   QRDPHTGELHAVSYSFARGHRVQYSVIGTDGHARRTVDIEVAGSPMMHSFSLTDNYVVI
FT                   YDLPVTFDPMQVVPASVPRWLQRPARLVIQSVLGRVRIPDPIAALGNRMQGHSDRLPYA
FT                   WNPSYPARVGVMPREGGNEDVRWFDIEPCYVYHPLNAYSECRNGAEVLVLDVVRYSRMF
FT                   DRDRRGPGGDSRPSLDRWTINLATGAVTAECRDDRAQEFPRINETLVGGPHRFAYTVGI
FT                   EGGFLVGAGAALSTPLYKQDCVTGSSTVASLDPDLLIGEMVFVPNPSARAEDDGILMGY
FT                   GWHRGRDEGQLLLLDAQTLESIATVHLPQRVPMGFHGNWAPTT"
FT   gene            755278..756357
FT                   /locus_tag="TBFG_10668"
FT                   /old_locus_tag="TBFG_00660"
FT   CDS_pept        755278..756357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10668"
FT                   /old_locus_tag="TBFG_00660"
FT                   /product="ribonucleotide transport ATP-binding protein ABC
FT                   transporter mkl"
FT                   /note="Mapped to H37Rv Rv0655"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10668"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05011"
FT                   /protein_id="ABR05011.1"
FT                   /translation="MRYSDSYHTTGRWQPRASTEGFPMGVSIEVNGLTKSFGSSRIWED
FT                   VTLTIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIIIDGTDIIECSAKELYEIRT
FT                   LFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLALVGLGGDEKKFPGE
FT                   ISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTH
FT                   NINIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGMSEGKDEAT
FT                   MAEEQALLDAGHHAGGVEEIEGVPPQISATPGMPERKAVARRQARVREMLHTLPKKAQA
FT                   AILDDLEGTHKYAVHEIGQ"
FT   gene            complement(756745..757128)
FT                   /locus_tag="TBFG_10669"
FT                   /old_locus_tag="TBFG_00661"
FT   CDS_pept        complement(756745..757128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10669"
FT                   /old_locus_tag="TBFG_00661"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0656c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10669"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05012"
FT                   /protein_id="ABR05012.1"
FT                   /translation="MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQM
FT                   SRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVGALSVVDLLICDTAAARGLVVLHDD
FT                   ADYELAERHLPDIRVRRVVSADD"
FT   gene            complement(757223..757378)
FT                   /locus_tag="TBFG_10670"
FT   CDS_pept        complement(757223..757378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10670"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0657c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10670"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05013"
FT                   /protein_id="ABR05013.1"
FT                   /translation="MSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEA
FT                   LARSRE"
FT   gene            complement(757454..758170)
FT                   /locus_tag="TBFG_10671"
FT                   /old_locus_tag="TBFG_00662"
FT   CDS_pept        complement(757454..758170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10671"
FT                   /old_locus_tag="TBFG_00662"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0658c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10671"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05014"
FT                   /protein_id="ABR05014.1"
FT                   /translation="MEAGRADTVAPSHRWGLGAFLVVELVFLVASTSLAVVLTGHGPVS
FT                   AGVLALALAAPTVVAAGLAILITRLRGNGPRTDLRLRWSWRGLRLGLMFGFGGMLVTIP
FT                   ASLVYTAIVGPEANSAVVRIFGGVRASWPWALVVFLVVVFVAPLCEEIIYRGLLWGAVD
FT                   RRWGRWAALVVTTVVFALAHLEFARAPLLVVVAIPIALARFYSGGLLASIVTHQVTNLL
FT                   PGIVLLLGLTGAISLP"
FT   gene            complement(758446..758754)
FT                   /locus_tag="TBFG_10672"
FT                   /old_locus_tag="TBFG_00663"
FT   CDS_pept        complement(758446..758754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10672"
FT                   /old_locus_tag="TBFG_00663"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0659c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10672"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05015"
FT                   /protein_id="ABR05015.1"
FT                   /translation="MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGL
FT                   VSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRRITRLSPARLHEACQTLRASTGC"
FT   gene            complement(758741..758986)
FT                   /locus_tag="TBFG_10673"
FT                   /old_locus_tag="TBFG_00664"
FT   CDS_pept        complement(758741..758986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10673"
FT                   /old_locus_tag="TBFG_00664"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0660c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10673"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05016"
FT                   /protein_id="ABR05016.1"
FT                   /translation="MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQD
FT                   VQAYTERPLTDDENALAEIADWGPAEDWADWADAAR"
FT   gene            complement(759096..759533)
FT                   /locus_tag="TBFG_10674"
FT                   /old_locus_tag="TBFG_00665"
FT   CDS_pept        complement(759096..759533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10674"
FT                   /old_locus_tag="TBFG_00665"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0661c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10674"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05017"
FT                   /protein_id="ABR05017.1"
FT                   /translation="MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQ
FT                   EFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIEATSKRGLTLFETTPGLEACDAVLA
FT                   AVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR"
FT   gene            complement(759530..759898)
FT                   /locus_tag="TBFG_10675"
FT                   /old_locus_tag="TBFG_00666"
FT   CDS_pept        complement(759530..759898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10675"
FT                   /old_locus_tag="TBFG_00666"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0662c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10675"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05018"
FT                   /protein_id="ABR05018.1"
FT                   /translation="MFLPNTRAYRRYNRSVWAVRGSTRPQWQPPPKFQHAKCMSMRLAH
FT                   RLQILLDDECHRRITAVARERGVPVATVVREAIDRGLVSPAGRRKSAGRRLLDAADMSV
FT                   PEPRELKQELEALRARRG"
FT   gene            759898..762261
FT                   /locus_tag="TBFG_10676"
FT                   /old_locus_tag="TBFG_00667"
FT   CDS_pept        759898..762261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10676"
FT                   /old_locus_tag="TBFG_00667"
FT                   /product="arylsulfatase atsD (aryl-sulfate
FT                   sulphohydrolase)"
FT                   /note="Mapped to H37Rv Rv0663"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10676"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05019"
FT                   /protein_id="ABR05019.1"
FT                   /translation="MPQPRTHLPIPSAARTGLITYDAKDPDSTYPPIEQLRPPAGAPNV
FT                   LLILLDDVGFGASSAFGGPCRTSTAELLAGNGLRYNRFHTTALCSPTRQALLTGRNHHS
FT                   AGMGGITEIATGAPGYSSVLPNTMSPIARTLKLNGYNTAQFGKCHEVPVWQTSPVGPFD
FT                   AWPSGGGGFEYFYGFIGGEANQWYPSLYEGTTPVEVNRTPEEGYHFMADMTDKALGWIG
FT                   QQKALAPDRPFFVYFAPGATHAPHHVPREWADKYRGRFDVGWDALREETFARQKELGVI
FT                   PADCQLTARHAEIPAWDDMPEDLKPVLCRQMEVYAGFLEYTDHHVGRLVDGLQRLGVLD
FT                   DTLVFYIIDDNGASAEGTINGTYNEMLNFNGLADIETPRFMTDRLDKFGGPESYNHYSV
FT                   GWAHAMDTPYQWTKQVASHWGGTRNGTIVHWPNGIAAKGEMRWQFHHVIDVAPTILEAA
FT                   GLPEPLFVNGVQQHPIEGVSMAYSFDDAQAPDRHETQYFEMFGNRGIYHKGWTAVTKHK
FT                   TPWILVGEQTVAFDDDVWELYDTTKDWSQAKDLAKEMPEKLHELQRLWLIEATRYNVLP
FT                   LDDDTASRINPDLAGRPVLIRGNTQVLFSNMGRLSENCVLNLKNKSHTVTAEVEVPETG
FT                   AEGVIVAQGASIGGWSLYANDGKLKYCYNLGGIKHFYAESADPLPAGAHQVRMEFAYAG
FT                   GGLGKGGEVTLYVDGQQVGEGHVEATLAIVFSADDGCDVGMDSGSPVSPDYAPGSNAFN
FT                   GRIKGVQLAIAEAAAAAGHLVDPEHAIRIALARQ"
FT   gene            762293..762565
FT                   /locus_tag="TBFG_10677"
FT   CDS_pept        762293..762565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10677"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0664"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10677"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05020"
FT                   /protein_id="ABR05020.1"
FT                   /translation="MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGR
FT                   RYRAASAPHPLAVGAHLRDELAKRSADPRLTDELNDLAGHTLDDL"
FT   gene            762562..762900
FT                   /locus_tag="TBFG_10678"
FT                   /old_locus_tag="TBFG_00668"
FT   CDS_pept        762562..762900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10678"
FT                   /old_locus_tag="TBFG_00668"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0665"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10678"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05021"
FT                   /protein_id="ABR05021.1"
FT                   /translation="MTEGEVGVGLLDTSVFIARESGGAIADLPERVALSVMTIGELQLG
FT                   LLNAGDSATRSRRADTLALARTADQIPVSEAVMISLARLVADCRAAGVRRSVKLTDALI
FT                   AATAEIKV"
FT   gene            762897..763070
FT                   /locus_tag="TBFG_10679"
FT   CDS_pept        762897..763070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10679"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0666"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10679"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05022"
FT                   /protein_id="ABR05022.1"
FT                   /translation="MTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSS
FT                   LVRARSCRCTAD"
FT   gene            763055..763285
FT                   /locus_tag="TBFG_10680"
FT   CDS_pept        763055..763285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10680"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05023"
FT                   /protein_id="ABR05023.1"
FT                   /translation="MHGGLIDSTASIWSYCPRPDSQPWQAATRAFSPEATKGAMRALWV
FT                   SQREDLTADAKRVNLLGSMRRMWPKEVEIAS"
FT   gene            763550..767086
FT                   /locus_tag="TBFG_10681"
FT                   /old_locus_tag="TBFG_00669"
FT   CDS_pept        763550..767086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10681"
FT                   /old_locus_tag="TBFG_00669"
FT                   /product="DNA-directed RNA polymerase beta subunit rpoB"
FT                   /note="Mapped to H37Rv Rv0667"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10681"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05024"
FT                   /protein_id="ABR05024.1"
FT                   /translation="MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLR
FT                   EPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMS
FT                   LSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEK
FT                   GTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTV
FT                   GVRIDRKRRQPVTVLLKALGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKL
FT                   RPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHVGEPITSSTLTEEDVVA
FT                   TIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERV
FT                   VRERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLLAL
FT                   GPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYR
FT                   KVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSEV
FT                   DYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAA
FT                   IDAGDVVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGD
FT                   RVEAGQVIADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIE
FT                   EHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGET
FT                   ELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRV
FT                   YVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQ
FT                   ILETHLGWCAHSGWKVDAAKGVPDWAARLPDELLEAQPNAIVSTPVFDGAQEAELQGLL
FT                   SCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGP
FT                   YSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIV
FT                   KGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINL
FT                   SRNESASVEDLA"
FT   gene            767131..771081
FT                   /locus_tag="TBFG_10682"
FT                   /old_locus_tag="TBFG_00670"
FT   CDS_pept        767131..771081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10682"
FT                   /old_locus_tag="TBFG_00670"
FT                   /product="DNA-directed RNA polymerase beta subunit rpoC"
FT                   /note="Mapped to H37Rv Rv0668"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10682"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05025"
FT                   /protein_id="ABR05025.1"
FT                   /translation="MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDG
FT                   LFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVE
FT                   DQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDI
FT                   WSTFTKLAPKQLIVDENLYRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVI
FT                   RNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMK
FT                   RLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLV
FT                   EGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILSPASGRPLAM
FT                   PRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKV
FT                   RLTQLRPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQA
FT                   AIINDLAERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPRKKEILDHYEERA
FT                   DKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPIITIVDSGATGNFT
FT                   QTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSG
FT                   YLTRRLVDVSQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAV
FT                   DEAGNVIVERGQDLGDPEIDALLAAGITQVKVRSVLTCATSTGVCATCYGRSMATGKLV
FT                   DIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVPRGKAPIAD
FT                   VTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEV
FT                   GQQLMEGSADPHEVLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVT
FT                   IIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEPAAGRPVLMGITKASLATDSWLSAAS
FT                   FQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARAAAYT
FT                   IPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR"
FT   gene            complement(771445..773358)
FT                   /locus_tag="TBFG_10683"
FT                   /old_locus_tag="TBFG_00671"
FT   CDS_pept        complement(771445..773358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10683"
FT                   /old_locus_tag="TBFG_00671"
FT                   /product="hypothetical hydrolase"
FT                   /note="Mapped to H37Rv Rv0669c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10683"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05026"
FT                   /protein_id="ABR05026.1"
FT                   /translation="MLSVGRGIADITGEAADCGMLGYGKSDQRTAGIHQRLRSRAFVFR
FT                   DDSQDGDARLLLIVAELPLPMQNVNEEVLRRLADLYGDTYSEQNTLITATHTHAGPGGY
FT                   CGYLLYNLTTSGFRPATFAAIVDGIVESVEHAHADVAPAEVSLSHGELYGASINRSPSA
FT                   FDRNPPADKAFFPKRVDPHTTLVRIDRGEATVGVIHFFATHGTSMTNRNHLISGDNKGF
FT                   AAYHWERTVGGADYLAGQPDFIAAFAQTNPGDMSPNVDGPLSPEAPPDREFDNTRRTGL
FT                   CQFEDAFTQLSGATPIGAGIDARFTYVDLGSVLVRGEYTPDGEERRTGRPMFGAGAMAG
FT                   TDEGPGFHGFRQGRNPFWDRLSRAMYRLARPTAAAQAPKGIVMPARLPNRIHPFVQEIV
FT                   PVQLVRIGRLYLIGIPGEPTIVAGLRLRRMVASIVGADLADVLCVGYTNAYIHYVTTPE
FT                   EYLEQRYEGGSTLFGRWELCALMQTVAELAEAMRDGRPVTLGRRPRPTRELSWVRGAPA
FT                   DAGSFGAVIAEPSATYRPGQAVEAVFVSALPNNDLRRGGTYLEVVRREGASWVRIADDG
FT                   DWATSFRWQRQGRAGSHVSIRWDVPGDTTPGQYRIVHHGTARDRNGMLTAFSATTREFT
FT                   VV"
FT   gene            773553..774311
FT                   /locus_tag="TBFG_10684"
FT                   /old_locus_tag="TBFG_00672"
FT   CDS_pept        773553..774311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10684"
FT                   /old_locus_tag="TBFG_00672"
FT                   /product="endonuclease IV end"
FT                   /note="Mapped to H37Rv Rv0670"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10684"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05027"
FT                   /protein_id="ABR05027.1"
FT                   /translation="MLIGSHVSPTDPLAAAEAEGADVVQIFLGNPQSWKAPKPRDDAAA
FT                   LKAATLPIYVHAPYLINLASANNRVRIPSRKILQETCAAAADIGAAAVIVHGGHVADDN
FT                   DIDKGFQRWRKALDRLETEVPVYLENTAGGDHAMARRFDTIARLWDVIGDTGIGFCLDT
FT                   CHTWAAGEALTDAVDRIKAITGRIDLVHCNDSRDEAGSGRDRHANLGSGQIDPDLLVAA
FT                   VKAAGAPVICETADQGRKDDIAFLRERTGS"
FT   gene            774343..775185
FT                   /locus_tag="TBFG_10685"
FT                   /old_locus_tag="TBFG_00673"
FT   CDS_pept        774343..775185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10685"
FT                   /old_locus_tag="TBFG_00673"
FT                   /product="lipoprotein lpqP"
FT                   /note="Mapped to H37Rv Rv0671"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10685"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05028"
FT                   /protein_id="ABR05028.1"
FT                   /translation="MLRRVAILLAAVLAFAGCSGGTRLAAGFGNGNSVHTLDVDGAGRS
FT                   YRLYKPVGLPSSAPLVVMLHGGFGSAKQAERSYGWDELADSEKFLVAYPDGYHRAWNAN
FT                   GGGCCGRPAREGVDDIGFVRAVVADIANNVSIDPARVYVTGMSNGAIMSYTLACNTSIF
FT                   AAIGVVSGTQLDPCQSPRPVSVIHIHGTADPLVRYHGGPGAGFARIDGPPVPDLNAFWR
FT                   EVNRCGALDTTTEGPVTTSGATCADNRRVVLLTVDDAGHRWPSFATQTLWRFFAAHFR"
FT   gene            775245..776873
FT                   /locus_tag="TBFG_10686"
FT                   /old_locus_tag="TBFG_00674"
FT   CDS_pept        775245..776873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10686"
FT                   /old_locus_tag="TBFG_00674"
FT                   /product="acyl-CoA dehydrogenase fadE8"
FT                   /note="Mapped to H37Rv Rv0672"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10686"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05029"
FT                   /protein_id="ABR05029.1"
FT                   /translation="MSDTHVVTNQVPPLENYNPASSPVLIEALIQEGGQWGLDEVNEVG
FT                   AISASCQAQRWGELADRNRPILHTHDAYGYRVDEVEYDPAYHELMRTAITHGMHAAPWA
FT                   DDRPGAHVVRAAKTSVWTVEPGHICPISMTYAVVPALRYNSELAAVYEPLLTSREYDPE
FT                   LKPATTKAGITAGMSMTEKQGGSDVRAGTTQATPNADGSYSLTGHKWFTSAPMCDIFLV
FT                   LAQAPDGLSCFLLPRVLPDGTRNRMFLQRLKDKLGNHANASSEVEYDGAVAWLVGEEGR
FT                   GVPTIIEMVNLTRLDCALGSATSMRTGLTRAVHHAQHRKAFGAYLIDQPLMRNVLADLA
FT                   VEAEAATIVAMRMAGATDNAVRGNETEALLRRIGLAAAKYWVCKRSTAHAAEALECLGG
FT                   NGYVEDSGMPRLYREAPLMGIWEGSGNVSALDTLRAMATRPACVEVLFDELARSAGQDP
FT                   RLDGHVERLRPQLGDLDTIGYRARKIAEDICLALQGSLLVRHGHPAVAEAFLATRLGGQ
FT                   WGGAYGTMPAGLDLAPILERALVKG"
FT   gene            776884..777822
FT                   /locus_tag="TBFG_10687"
FT                   /old_locus_tag="TBFG_00675"
FT   CDS_pept        776884..777822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10687"
FT                   /old_locus_tag="TBFG_00675"
FT                   /product="enoyl-CoA hydratase echA4"
FT                   /note="Mapped to H37Rv Rv0673"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10687"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05030"
FT                   /protein_id="ABR05030.1"
FT                   /translation="MTHAIRPVDFDNLKTMTYEVTGRIARITFNRPEKGNAIIADTPLE
FT                   LSALVERADLDPGVHVILVSGRGEGFCAGFDLSAYAEGSSSTGGGGAYQGTVLDGKTQA
FT                   VNHLPNQPWDPMIDYQMMSRFVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADQVIA
FT                   AADAKIGYPPTRVWGVPAAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPEPA
FT                   DLDERTERLVARIAALPVNQLIMVKLALNSALLQQGVATSRMVSTVFDGAARHTPEGHA
FT                   FVADAVEHGFRDAVRRRDEPFGDYGRQASRV"
FT   gene            777825..778547
FT                   /locus_tag="TBFG_10688"
FT                   /old_locus_tag="TBFG_00676"
FT   CDS_pept        777825..778547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10688"
FT                   /old_locus_tag="TBFG_00676"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0674"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10688"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05031"
FT                   /protein_id="ABR05031.1"
FT                   /translation="MPAMTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVAL
FT                   TRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTR
FT                   AALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLS
FT                   GWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHD
FT                   FATAMAKRRDATQLLEVT"
FT   gene            778544..779335
FT                   /locus_tag="TBFG_10689"
FT                   /old_locus_tag="TBFG_00677"
FT   CDS_pept        778544..779335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10689"
FT                   /old_locus_tag="TBFG_00677"
FT                   /product="enoyl-CoA hydratase echA5"
FT                   /note="Mapped to H37Rv Rv0675"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10689"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05032"
FT                   /protein_id="ABR05032.1"
FT                   /translation="MSDLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRD
FT                   DAASVAVLWGAGGTFCAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYA
FT                   VAGGLELALWCDLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRG
FT                   VPADEALAMGLANRVVPKGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAAL
FT                   DLEFASIARVAGEALEGARRFAAGAGRHGAPAPRAEQGDTL"
FT   gene            complement(779347..782241)
FT                   /locus_tag="TBFG_10690"
FT                   /old_locus_tag="TBFG_00678"
FT   CDS_pept        complement(779347..782241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10690"
FT                   /old_locus_tag="TBFG_00678"
FT                   /product="transmembrane transport protein mmpL5"
FT                   /note="Mapped to H37Rv Rv0676c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10690"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05033"
FT                   /protein_id="ABR05033.1"
FT                   /translation="MIVQRTAAPTGSVPPDRHAARPFIPRMIRTFAVPIILGWLVTIAV
FT                   LNVTVPQLETVGQIQAVSMSPDAAPSMISMKHIGKVFEEGDSDSAAMIVLEGQRPLGDA
FT                   AHAFYDQMIGRLQADTTHVQSLQDFWGDPLTATGAQSSDGKAAYVQVKLAGNQGESLAN
FT                   ESVEAVKTIVERLAPPPGVKVYVTGSAALVADQQQAGDRSLQVIEAVTFTVIIVMLLLV
FT                   YRSIITSAIMLTMVVLGLLATRGGVAFLGFHRIIGLSTFATNLLVVLAIAAATDYAIFL
FT                   IGRYQEARGLGQDRESAYYTMFGGTAHVVLGSGLTIAGATFCLSFTRLPYFQTLGVPLA
FT                   IGMVIVVAAALTLGPAIIAVTSRFGKLLEPKRMARVRGWRKVGAAIVRWPGPILVGAVA
FT                   LALVGLLTLPGYRTNYNDRNYLPADLPANEGYAAAERHFSQARMNPEVLMVESDHDMRN
FT                   SADFLVINKIAKAIFAVEGISRVQAITRPDGKPIEHTSIPFLISMQGTSQKLTEKYNQD
FT                   LTARMLEQVNDIQSNIDQMERMHSLTQQMADVTHEMVIQMTGMVVDVEELRNHIADFDD
FT                   FFRPIRSYFYWEKHCYDIPVCWSLRSVFDTLDGIDVMTEDINNLLPLMQRLDTLMPQLT
FT                   AMMPEMIQTMKSMKAQMLSMHSTQEGLQDQMAAMQEDSAAMGEAFDASRNDDSFYLPPE
FT                   VFDNPDFQRGLEQFLSPDGHAVRFIISHEGDPMSQAGIARIAKIKTAAKEAIKGTPLEG
FT                   SAIYLGGTAAMFKDLSDGNTYDLMIAGISALCLIFIIMLITTRSVVAAAVIVGTVVLSL
FT                   GASFGLSVLIWQHILGIELHWLVLAMAVIILLAVGADYNLLLVARLKEEIHAGINTGII
FT                   RAMGGSGSVVTAAGLVFAFTMMSFAVSELTVMAQVGTTIGMGLLFDTLIVRSFMTPSIA
FT                   ALLGKWFWWPQVVRQRPVPQPWPSPASARTFALV"
FT   gene            complement(782238..782666)
FT                   /locus_tag="TBFG_10691"
FT                   /old_locus_tag="TBFG_00679"
FT   CDS_pept        complement(782238..782666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10691"
FT                   /old_locus_tag="TBFG_00679"
FT                   /product="membrane protein mmpS5"
FT                   /note="Mapped to H37Rv Rv0677c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10691"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05034"
FT                   /protein_id="ABR05034.1"
FT                   /translation="MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFA
FT                   DDPEPFDPKVVEYEVSGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNIL
FT                   AQGDGTSITCRITVDGEVKDERTATGVDALTYCFVKSA"
FT   gene            782751..783248
FT                   /locus_tag="TBFG_10692"
FT                   /old_locus_tag="TBFG_00680"
FT   CDS_pept        782751..783248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10692"
FT                   /old_locus_tag="TBFG_00680"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0678"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10692"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05035"
FT                   /protein_id="ABR05035.1"
FT                   /translation="MSVNDGVDQMGAEPDIMEFVEQMGGYFESRSLTRLAGRLLGWLLV
FT                   CDPERQSSEELATALAASSGGISTNARMLIQFGFIERLAVAGDRRTYFRLRPNAFAAGE
FT                   RERIRAMAELQDLADVGLRALGDAPPQRSRRLREMRDLLAYMENVVSDALGRYSQRTGE
FT                   DD"
FT   gene            complement(783304..783801)
FT                   /locus_tag="TBFG_10693"
FT                   /old_locus_tag="TBFG_00681"
FT   CDS_pept        complement(783304..783801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10693"
FT                   /old_locus_tag="TBFG_00681"
FT                   /product="conserved threonine rich protein"
FT                   /note="Mapped to H37Rv Rv0679c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10693"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05036"
FT                   /protein_id="ABR05036.1"
FT                   /translation="MVEKPLRADRATHSRLATFALALAAAALPLAGCSSTANPPAATTT
FT                   PATATTTTATSGPTAAPTVTTGESTTASIQIGDMLTYGSIGTTATLDCADGKSLNVAGS
FT                   DNTLTVNGTCETVTVGGANNKIAFDRIDERLVVVGLDNTVTYKNGDPTIDNLGAGNRIN
FT                   KE"
FT   gene            complement(783803..784177)
FT                   /locus_tag="TBFG_10694"
FT                   /old_locus_tag="TBFG_00682"
FT   CDS_pept        complement(783803..784177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10694"
FT                   /old_locus_tag="TBFG_00682"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0680c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10694"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05037"
FT                   /protein_id="ABR05037.1"
FT                   /translation="MKWNTVAASLAAGVITIAVALAAPPPAAHAKNGDTHVTGQGIERT
FT                   LDCNESTLLVNGTQNIVTALGTCWAVTVMGSSNTVVADTIINDITVYGWDETVFFRNGD
FT                   PFIWDRGRELGMVNRLQRVG"
FT   gene            784416..785072
FT                   /locus_tag="TBFG_10695"
FT                   /old_locus_tag="TBFG_00683"
FT   CDS_pept        784416..785072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10695"
FT                   /old_locus_tag="TBFG_00683"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0681"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10695"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05038"
FT                   /protein_id="ABR05038.1"
FT                   /translation="MAAQPQAPSAGGRPRAGKAVKSVARPAKLSRESIVEGALTFLDRE
FT                   GWDSLTINALATQLGTKGPSLYNHVDSLEDLRRAVRIRVIDDIITMLNRVGAGRARDDA
FT                   VLVMAGAYRSYAHHHPGRYSAFTRMPLGGDDPEYTAATRGAAAPVIAVLSSYGLDGEQA
FT                   FYAALEFWSALHGFVLLEMTGVMDDIDTDAVFTDMVLRLAAGMERRTTHGGTAST"
FT   gene            785321..785695
FT                   /locus_tag="TBFG_10696"
FT                   /old_locus_tag="TBFG_00684"
FT   CDS_pept        785321..785695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10696"
FT                   /old_locus_tag="TBFG_00684"
FT                   /product="30S ribosomal protein S12 rpsL"
FT                   /note="Mapped to H37Rv Rv0682"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10696"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05039"
FT                   /protein_id="ABR05039.1"
FT                   /translation="MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDT
FT                   QGVKNRKQARSRYGAKKEKG"
FT   gene            785695..786165
FT                   /locus_tag="TBFG_10697"
FT                   /old_locus_tag="TBFG_00685"
FT   CDS_pept        785695..786165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10697"
FT                   /old_locus_tag="TBFG_00685"
FT                   /product="30S ribosomal protein S7 rpsG"
FT                   /note="Mapped to H37Rv Rv0683"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10697"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05040"
FT                   /protein_id="ABR05040.1"
FT                   /translation="MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYG
FT                   ALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWL
FT                   VGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW"
FT   gene            786246..788351
FT                   /locus_tag="TBFG_10698"
FT                   /old_locus_tag="TBFG_00686"
FT   CDS_pept        786246..788351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10698"
FT                   /old_locus_tag="TBFG_00686"
FT                   /product="elongation factor G (EF-G) fusA1"
FT                   /note="Mapped to H37Rv Rv0684"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10698"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05041"
FT                   /protein_id="ABR05041.1"
FT                   /translation="MAQKDVLTDLSRVRNFGIMAHIDAGKTTTTERILYYTGINYKIGE
FT                   VHDGAATMDWMEQEQERGITITSAATTTFWKDNQLNIIDTPGHVDFTVEVERNLRVLDG
FT                   AVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFSVRTMGERLGANAV
FT                   PIQLPVGAEADFEGVVDLVEMNAKVWRGETKLGETYDTVEIPADLAEQAEEYRTKLLEV
FT                   VAESDEHLLEKYLGGEELTVDEIKGAIRKLTIASEIYPVLCGSAFKNKGVQPMLDAVVD
FT                   YLPSPLDVPPAIGHAPAKEDEEVVRKATTDEPFAALAFKIATHPFFGKLTYIRVYSGTV
FT                   ESGSQVINATKGKKERLGKLFQMHSNKENPVDRASAGHIYAVIGLKDTTTGDTLSDPNQ
FT                   QIVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGM
FT                   GELHLDILVDRMRREFKVEANVGKPQVAYKETIKRLVQNVEYTHKKQTGGSGQFAKVII
FT                   NLEPFTGEEGATYEFESKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNLKVTLLD
FT                   GAYHEVDSSEMAFKIAGSQVLKKAAALAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRR
FT                   GQIQAMEERAGARVVRAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYSEVPANVSKEI
FT                   IAKATGE"
FT   gene            788582..789772
FT                   /locus_tag="TBFG_10699"
FT                   /old_locus_tag="TBFG_00687"
FT   CDS_pept        788582..789772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10699"
FT                   /old_locus_tag="TBFG_00687"
FT                   /product="iron-regulated elongation factor tu (EF-Tu) tuf"
FT                   /note="Mapped to H37Rv Rv0685"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10699"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05042"
FT                   /protein_id="ABR05042.1"
FT                   /translation="MAKAKFQRTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKFPDLNE
FT                   TKAFDQIDNAPEERQRGITINIAHVEYQTDKRHYAHVDAPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYILVALNKADAVDDEELLELVEMEVRELLAAQ
FT                   EFDEDAPVVRVSALKALEGDAKWVASVEELMNAVDESIPDPVRETDKPFLMPVEDVFTI
FT                   TGRGTVVTGRVERGVINVNEEVEIVGIRPSTTKTTVTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGVKREDVERGQVVTKPGTTTPHTEFEGQVYILSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGVVTLPEGTEMVMPGDNTNISVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK"
FT   gene            789910..790707
FT                   /locus_tag="TBFG_10700"
FT                   /old_locus_tag="TBFG_00688"
FT   CDS_pept        789910..790707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10700"
FT                   /old_locus_tag="TBFG_00688"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0686"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10700"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05043"
FT                   /protein_id="ABR05043.1"
FT                   /translation="MLARYIKMQLLVLLCGGLVGPIFLVVYFTLGLGSLMSWMFYVGLI
FT                   ITVADVLVALALTNYGAKTAAKTAALERSGVLALAQITGLSETGTRINDQPLVKVHLHI
FT                   SGPGITPFDTEDRVIASVTRLGNLTARKLVVLVNPATQQYLIDWERSALVNGLVPAQFT
FT                   VAEDNKTYDLSGQTGPLMEILQILKANNVPLNRMVDIRSNPALRQQVQAVVRRAAERQA
FT                   PAAEPASQGSIAERLAELESLRASGAVNAAEYESKRAQIISEI"
FT   gene            790860..791687
FT                   /locus_tag="TBFG_10701"
FT                   /old_locus_tag="TBFG_00689"
FT   CDS_pept        790860..791687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10701"
FT                   /old_locus_tag="TBFG_00689"
FT                   /product="hypothetical short-chain type
FT                   dehydrogenase/reductase"
FT                   /note="Mapped to H37Rv Rv0687"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10701"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05044"
FT                   /protein_id="ABR05044.1"
FT                   /translation="MSARGGSLHGRVAFVTGAARAQGRSHAVRLAREGADIVALDICAP
FT                   VSGSVTYPPATSEDLGETVRAVEAEGRKVLAREVDIRDDAELRRLVADGVEQFGRLDIV
FT                   VANAGVLGWGRLWELTDEQWETVIGVNLTGTWRTLRATVPAMIDAGNGGSIVVVSSSAG
FT                   LKATPGNGHYAASKHALVALTNTLAIELGEFGIRVNSIHPYSVDTPMIEPEAMIQTFAK
FT                   HPGYVHSFPPMPLQPKGFMTPDEISDVVVWLAGDGSGALSGNQIPVDKGALKY"
FT   gene            791701..792921
FT                   /locus_tag="TBFG_10702"
FT                   /old_locus_tag="TBFG_00690"
FT   CDS_pept        791701..792921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10702"
FT                   /old_locus_tag="TBFG_00690"
FT                   /product="hypothetical ferredoxin reductase"
FT                   /note="Mapped to H37Rv Rv0688"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10702"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05045"
FT                   /protein_id="ABR05045.1"
FT                   /translation="MNAHVTSREGVNEFDDGIVIVGGGLAAARTAEQLRRAGYSGRLTI
FT                   VSDEVHLPYDRPPLSKEVLRSEVDDVALKPREFYDEKDIALRLGSAAVSLDTGEQTVTL
FT                   ADGTVLGYDELVIATGLVPRRIPSLPDLDGIRVLRSFDESMALRKHASAARHAVVVGAG
FT                   FIGCEVAASLRGLGVDVVLVEPQPAPLASVLGEQIGQLVTRLHRDEGVDVRTGVTVAEV
FT                   RGKGHVDAVVLTDGTELPADLVVVGIGSTPATEWLEGSGVEVDNGVICDKAGRTSAPNV
FT                   WALGDVASWRDPMGHQARVEHWSNVADQARVVVPAMLGTDVPTGVVVPYFWSDQYDVKI
FT                   QCLGEPHATDVVHLVEDDGRKFLAYYERDGVLVGVVGGGMAGKVMKVRGKIAAGAPIAE
FT                   VLDQTQA"
FT   gene            complement(792918..793172)
FT                   /locus_tag="TBFG_10703"
FT                   /old_locus_tag="TBFG_00691"
FT   CDS_pept        complement(792918..793172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10703"
FT                   /old_locus_tag="TBFG_00691"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0689c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10703"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05046"
FT                   /protein_id="ABR05046.1"
FT                   /translation="MLGWTVKPGRVADGWQAPGVHLMARCSGPQPASERRADMDGGDID
FT                   AAVARVRAAGALAEPSRQPDDMSAECADDQGARCHLGQL"
FT   gene            complement(793785..794834)
FT                   /locus_tag="TBFG_10704"
FT                   /old_locus_tag="TBFG_00692"
FT   CDS_pept        complement(793785..794834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10704"
FT                   /old_locus_tag="TBFG_00692"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0690c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10704"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05047"
FT                   /protein_id="ABR05047.1"
FT                   /translation="MTGTEHLVHTLRSQGRVCTSSGSPMYRELLELVAADVESGGVFAS
FT                   ILADQKGAPEGQAVPLRLLGGLHRMVLDGRAPVLRRWYPSTGGTWQAEAAWPDIVRTAT
FT                   DQPESLRAALDRPPQTNEVGRSAALIGGLLIACLQFDLPIRLFEIGSSAGLNLRPDRYR
FT                   YRYLGGEWGLADSPVRIDNAWLGELPPTATVRIVERHGYDIAPIDVTSPDGELNALSYI
FT                   WPDQTDRLERLRGAIAVARNIPADLHRQAAHAAVAGMTLTDDALTVLWHSITWQYLPAD
FT                   ERAAIRAGIDALAAQADAHCPFVHLTLEPAHQRPGAQIKYLVRMRSWPGGHARVLGECH
FT                   PHGPPVTWQ"
FT   gene            complement(794831..795427)
FT                   /locus_tag="TBFG_10705"
FT                   /old_locus_tag="TBFG_00693"
FT   CDS_pept        complement(794831..795427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10705"
FT                   /old_locus_tag="TBFG_00693"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0691c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10705"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05048"
FT                   /protein_id="ABR05048.1"
FT                   /translation="MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGI
FT                   ARRTLFRYYASKNAIPWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESET
FT                   IRHRKRMRVILQTPELQAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVA
FT                   LSAYEHWLRDESVSLTEALGAAFDVVGAGLDRLNQ"
FT   gene            795592..795921
FT                   /locus_tag="TBFG_10706"
FT                   /old_locus_tag="TBFG_00695"
FT   CDS_pept        795592..795921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10706"
FT                   /old_locus_tag="TBFG_00695"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0692"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10706"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05049"
FT                   /protein_id="ABR05049.1"
FT                   /translation="MWGLLTVPAPAQARRADSSEFDPDRGWRLHPQVAVRPEPFGALLY
FT                   HFGTRKLSFLKNRTILAVVQTLADYPDIRSACRGAGVDDCDQDPYLHALSVLTGSNMLV
FT                   PRQTT"
FT   gene            795918..797093
FT                   /locus_tag="TBFG_10707"
FT                   /old_locus_tag="TBFG_00696"
FT   CDS_pept        795918..797093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10707"
FT                   /old_locus_tag="TBFG_00696"
FT                   /product="coenzyme PQQ synthesis protein E pqqE"
FT                   /note="Mapped to H37Rv Rv0693"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10707"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05050"
FT                   /protein_id="ABR05050.1"
FT                   /translation="MTSPVPRLIEQFERGLDAPICLTWELTYACNLACVHCLSSSGKRD
FT                   PGELSTRQCKDIIDELERMQVFYVNIGGGEPTVRPDFWELVDYATAHHVGVKFSTNGVR
FT                   ITPEVATRLAATDYVDVQISLDGATAEVNDAIRGTGSFDMAVRALQNLAAAGFAGVKIS
FT                   VVITRRNVAQLDEFATLASRYGATLRITRLRPSGRGTDVWADLHPTADQQVQLYDWLVS
FT                   KGERVLTGDSFFHLAPLGQSGALAGLNMCGAGRVVCLIDPVGDVYACPFAIHDHFLAGN
FT                   VLSDGGFQNVWKNSSLFRELREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPE
FT                   CVQGHSEPALARERHLPRPRADHSRGRRVSKPVPLTLSMRPPKRPCNESPV"
FT   gene            797096..798286
FT                   /locus_tag="TBFG_10708"
FT                   /old_locus_tag="TBFG_00697"
FT   CDS_pept        797096..798286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10708"
FT                   /old_locus_tag="TBFG_00697"
FT                   /product="L-lactate dehydrogenase (cytochrome) lldD1"
FT                   /note="Mapped to H37Rv Rv0694"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10708"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05051"
FT                   /protein_id="ABR05051.1"
FT                   /translation="MAEAWFETVAIAQQRAKRRLPKSVYSSLIAASEKGITVADNVAAF
FT                   SELGFAPHVIGATDKRDLSTTVMGQEVSLPVIISPTGVQAVDPGGEVAVARAAAARGTV
FT                   MGLSSFASKPIEEVIAANPKTFFQVYWQGGRDALAERVERARQAGAVGLVVTTDWTFSH
FT                   GRDWGSPKIPEEMNLKTILRLSPEAITRPRWLWKFAKTLRPPDLRVPNQGRRGEPGPPF
FT                   FAAYGEWMATPPPTWEDIGWLRELWGGPFMLKGVMRVDDAKRAVDAGVSAISVSNHGGN
FT                   NLDGTPASIRALPAVSAAVGDQVEVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLA
FT                   ANGQAGVENVLDILRGGIDSALMGLGHASVHDLSPADILVPTGFIRDLGVPSRRDV"
FT   gene            798476..799231
FT                   /locus_tag="TBFG_10709"
FT                   /old_locus_tag="TBFG_00698"
FT   CDS_pept        798476..799231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10709"
FT                   /old_locus_tag="TBFG_00698"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0695"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10709"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05052"
FT                   /protein_id="ABR05052.1"
FT                   /translation="MNSSYHRRVPVVGELGSATSSQLPSTSPSIVIPLGSTEQHGPHLP
FT                   LDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGASGEHQRFAGTISIGTEAL
FT                   TMLLVEYGRSAACWARRLVFVNGHGGNVGALTRAVGLLRAEGRDAGWCPCTCPGGDPHA
FT                   GHTETSVLLHLSPADVRTERWRAGNRAPLPVLLPSMRRGGVAAVSETGVLGDPTTATAA
FT                   EGRRIFAAMVDDCVRRVARWMPQPDGMLT"
FT   gene            799280..800692
FT                   /locus_tag="TBFG_10710"
FT                   /old_locus_tag="TBFG_00699"
FT   CDS_pept        799280..800692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10710"
FT                   /old_locus_tag="TBFG_00699"
FT                   /product="hypothetical membrane sugar transferase"
FT                   /note="Mapped to H37Rv Rv0696"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10710"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05053"
FT                   /protein_id="ABR05053.1"
FT                   /translation="MTATRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLRLAPAARGL
FT                   LCDGRLKVRDEVSAELARILLDATVAHPRPPSGPSHRDVTVVIPVRNNASGLRRLVTSL
FT                   RGLRVIVVDDGSACPVESDDFVGAHCDIEVLHHPHSKGPAAARNTGLAACTTDFVAFLD
FT                   SDVTPRRGWLESLLGHFCDPTVALVAPRIVSLVEGENPVARYEALHSSLDLGQREAPVL
FT                   PHSTVSYVPSAAIVCRSSAIRDVGGFDETMHSGEDVDLCWRLIEAGARLRYEPIALVAH
FT                   DHRTQLRDWIARKAFYGGSAAPLAVRHPDKTAPLVISGGALMAWILMSICTGLGRLASL
FT                   VIAVLTGRRIARAMRCAETSFLDVLAVATRGLWAAALQLASAICRHYWPLALLAAILSR
FT                   RCRRVVLIAAVVDGVVDWLRRREGADDDAEPIGPLTYLVLKRVDDLAYGAGLWYGVVRE
FT                   RNIGALKPQIRT"
FT   gene            800694..802133
FT                   /locus_tag="TBFG_10711"
FT                   /old_locus_tag="TBFG_00700"
FT   CDS_pept        800694..802133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10711"
FT                   /old_locus_tag="TBFG_00700"
FT                   /product="hypothetical dehydrogenase"
FT                   /note="Mapped to H37Rv Rv0697"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10711"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05054"
FT                   /protein_id="ABR05054.1"
FT                   /translation="MTAAVRHSDVLVVGAGSAGSVVAERLSMDSSCVVTVLEAGPGLAD
FT                   PGLLAQTANGLQLPIGAGSPLVERYRTRLTDRPVRHLPIVRGATVGGSGAINGGYFCRG
FT                   LPSDFDRASIPGWAWSDVLEHFRAIETDLDFETPVHGRSGPIPVRRTHEMTGITESFMA
FT                   AAEDAGFAWIADLNDVGPEMPSGVGAVPLNIVNGVRTSSAVGYLMPALGRPNLTLLART
FT                   RAVRLRFSATTAVGVDAIGPGGPVSLSADRIVLCAGAIQSAHLLMLSGVGEEEVLRSAG
FT                   VKVLMALPVGMGCSDHPEWVMPTNWAVAVDRPVLEVLLSTHDGIEIRPYTGGFVAMTGD
FT                   GTAGHRDWPHIGVALMQPRARGRITLVSSDPQIPVRIEHRYDSEPADVAALRQGSALAH
FT                   ELCGAATRIGPAVWATSQHLCGSAPMGTDDDPRAVVDPRCRVRGIENLWVIDGSVLPSI
FT                   TSRGPHATIVMLGHRAAEFVQ"
FT   gene            802594..803205
FT                   /locus_tag="TBFG_10712"
FT   CDS_pept        802594..803205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10712"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0698"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10712"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05055"
FT                   /protein_id="ABR05055.1"
FT                   /translation="MGRRGNRRVHVDRVRLTGTERELRAENQSPPIFRPQNTLGDGANG
FT                   LPLAVCTTTAHTCHTSHTHPSRWTPNPVPATKGVPAGLVQATFIIENLDPGNNDTPTPP
FT                   TPKLRLARKPGHHRRSEYDADSVLRRKDTSRRCVQADDVRCVQLVQDPRRGRVELGGYR
FT                   AELTVGRRAAVNCQRPQYGADGWPVRLGCGVGGAARGDQR"
FT   gene            complement(802921..803568)
FT                   /locus_tag="TBFG_10713"
FT                   /old_locus_tag="TBFG_00701"
FT   CDS_pept        complement(802921..803568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10713"
FT                   /old_locus_tag="TBFG_00701"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0698"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10713"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05056"
FT                   /protein_id="ABR05056.1"
FT                   /translation="MALAKLAQSADRIAARQRMQRSLAQLVATCELPAPTGTAPIERRI
FT                   SESFAASRSTRRSPIAQSMTRPSPPRPGSPTLPVDGEDPFAEAVLTASVSCRLYPTDTG
FT                   GTPADRCTPATGGEFPTSALIASRGAAYPATQPNGPSIRTILRALAIHRRPSANSKLGA
FT                   VTTEFDTSAPRILDQLHASDVIRLDASARCILSPQHRIRIVFRSPMVPRFSG"
FT   gene            804248..804553
FT                   /locus_tag="TBFG_10714"
FT                   /old_locus_tag="TBFG_00702"
FT   CDS_pept        804248..804553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10714"
FT                   /old_locus_tag="TBFG_00702"
FT                   /product="30S ribosomal protein S10 rpsJ"
FT                   /note="Mapped to H37Rv Rv0700"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10714"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05057"
FT                   /protein_id="ABR05057.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNIQ"
FT   gene            804570..805223
FT                   /locus_tag="TBFG_10715"
FT                   /old_locus_tag="TBFG_00703"
FT   CDS_pept        804570..805223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10715"
FT                   /old_locus_tag="TBFG_00703"
FT                   /product="50S ribosomal protein L3 rplC"
FT                   /note="Mapped to H37Rv Rv0701"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10715"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05058"
FT                   /protein_id="ABR05058.1"
FT                   /translation="MARKGILGTKLGMTQVFDESNRVVPVTVVKAGPNVVTRIRTPERD
FT                   GYSAVQLAYGEISPRKVNKPLTGQYTAAGVNPRRYLAELRLDDSDAATEYQVGQELTAE
FT                   IFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKG
FT                   TRMAGRMGNDRVTVLNLLVHKVDAENGVLLIKGAVPGRTGGLVMVRSAIKRGEK"
FT   gene            805223..805894
FT                   /locus_tag="TBFG_10716"
FT                   /old_locus_tag="TBFG_00704"
FT   CDS_pept        805223..805894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10716"
FT                   /old_locus_tag="TBFG_00704"
FT                   /product="50S ribosomal protein L4 rplD"
FT                   /note="Mapped to H37Rv Rv0702"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10716"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05059"
FT                   /protein_id="ABR05059.1"
FT                   /translation="MAAQEQKTLKIDVKTPAGKVDGAIELPAELFDVPANIALMHQVVT
FT                   AQRAAARQGTHSTKTRGEVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDY
FT                   SQRTPKKMIAAALRGALSDRARNGRIHAITELVEGQNPSTKSARAFLASLTERKQVLVV
FT                   IGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDVVFSVEALNAYIAANTTTSEEVS
FT                   A"
FT   gene            805894..806196
FT                   /locus_tag="TBFG_10717"
FT                   /old_locus_tag="TBFG_00705"
FT   CDS_pept        805894..806196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10717"
FT                   /old_locus_tag="TBFG_00705"
FT                   /product="50S ribosomal protein L23 rplW"
FT                   /note="Mapped to H37Rv Rv0703"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10717"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05060"
FT                   /protein_id="ABR05060.1"
FT                   /translation="MATLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIA
FT                   VEKIFAVKVASVNTANRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA"
FT   gene            806397..807239
FT                   /locus_tag="TBFG_10718"
FT                   /old_locus_tag="TBFG_00706"
FT   CDS_pept        806397..807239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10718"
FT                   /old_locus_tag="TBFG_00706"
FT                   /product="50S ribosomal protein L2 rplB"
FT                   /note="Mapped to H37Rv Rv0704"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10718"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05061"
FT                   /protein_id="ABR05061.1"
FT                   /translation="MAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNA
FT                   HGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGEKRY
FT                   IIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGGGAKLARSAGSSI
FT                   QLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGKRPSVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRNANKSSNKFIVRRRRTGKKHSR"
FT   gene            807280..807561
FT                   /locus_tag="TBFG_10719"
FT                   /old_locus_tag="TBFG_00707"
FT   CDS_pept        807280..807561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10719"
FT                   /old_locus_tag="TBFG_00707"
FT                   /product="30S ribosomal protein S19 rpsS"
FT                   /note="Mapped to H37Rv Rv0705"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10719"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05062"
FT                   /protein_id="ABR05062.1"
FT                   /translation="MPRSLKKGPFVDEHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFI
FT                   GHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKSKRR"
FT   gene            807558..808151
FT                   /locus_tag="TBFG_10720"
FT                   /old_locus_tag="TBFG_00708"
FT   CDS_pept        807558..808151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10720"
FT                   /old_locus_tag="TBFG_00708"
FT                   /product="50S ribosomal protein L22 rplV"
FT                   /note="Mapped to H37Rv Rv0706"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10720"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05063"
FT                   /protein_id="ABR05063.1"
FT                   /translation="MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDI
FT                   LRWAPQAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAF
FT                   RIRRRTSHITVVVESRPAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKA
FT                   PASSGVKKTPAKKAPAKKAPAKASETSAAKGGSD"
FT   gene            808151..808975
FT                   /locus_tag="TBFG_10721"
FT                   /old_locus_tag="TBFG_00709"
FT   CDS_pept        808151..808975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10721"
FT                   /old_locus_tag="TBFG_00709"
FT                   /product="30S ribosomal protein S3 rpsC"
FT                   /note="Mapped to H37Rv Rv0707"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10721"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05064"
FT                   /protein_id="ABR05064.1"
FT                   /translation="MGQKINPHGFRLGITTDWKSRWYADKQYAEYVKEDVAIRRLLSSG
FT                   LERAGIADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILE
FT                   VKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMS
FT                   RSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPAGA
FT                   DRPRRERPSGTRPRRSGASGTTATGTDAGRAAGGEEAAPDAAAPVEAQSTES"
FT   gene            808979..809395
FT                   /locus_tag="TBFG_10722"
FT                   /old_locus_tag="TBFG_00710"
FT   CDS_pept        808979..809395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10722"
FT                   /old_locus_tag="TBFG_00710"
FT                   /product="50S ribosomal protein L16 rplP"
FT                   /note="Mapped to H37Rv Rv0708"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10722"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05065"
FT                   /protein_id="ABR05065.1"
FT                   /translation="MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNR
FT                   QIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLF
FT                   ELSYPNEGVARAALTRAIHKLPIKARIITREEQF"
FT   gene            809395..809628
FT                   /locus_tag="TBFG_10723"
FT                   /old_locus_tag="TBFG_00711"
FT   CDS_pept        809395..809628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10723"
FT                   /old_locus_tag="TBFG_00711"
FT                   /product="50S ribosomal protein L29 rpmC"
FT                   /note="Mapped to H37Rv Rv0709"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10723"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05066"
FT                   /protein_id="ABR05066.1"
FT                   /translation="MAVGVSPGELRELTDEELAERLRESKEELFNLRFQMATGQLNNNR
FT                   RLRTVRQEIARIYTVLRERELGLATGPDGKES"
FT   gene            809628..810035
FT                   /locus_tag="TBFG_10724"
FT                   /old_locus_tag="TBFG_00712"
FT   CDS_pept        809628..810035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10724"
FT                   /old_locus_tag="TBFG_00712"
FT                   /product="30S ribosomal protein S17 rpsQ"
FT                   /note="Mapped to H37Rv Rv0710"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10724"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05067"
FT                   /protein_id="ABR05067.1"
FT                   /translation="MAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPK
FT                   HTPRTPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSV
FT                   AGIGDRVSLMETRPLSATKRWRLVEILEKAK"
FT   gene            810204..812567
FT                   /locus_tag="TBFG_10725"
FT                   /old_locus_tag="TBFG_00713"
FT   CDS_pept        810204..812567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10725"
FT                   /old_locus_tag="TBFG_00713"
FT                   /product="arylsulfatase atsA (aryl-sulfate
FT                   sulphohydrolase)"
FT                   /note="Mapped to H37Rv Rv0711"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10725"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05068"
FT                   /protein_id="ABR05068.1"
FT                   /translation="MAPEATEAFNGTIELDIRDSEPDWGPYAAPVAPEHSPNILYLVWD
FT                   DVGIATWDCFGGLVEMPAMTRVAERGVRLSQFHTTALCSPTRASLLTGRNATTVGMATI
FT                   EEFTDGFPNCNGRIPADTALLPEVLAEHGYNTYCVGKWHLTPLEESNMASTKRHWPTSR
FT                   GFERFYGFLGGETDQWYPDLVYDNHPVSPPGTPEGGYHLSKDIADKTIEFIRDAKVIAP
FT                   DKPWFSYVCPGAGHAPHHVFKEWADRYAGRFDMGYERYREIVLERQKALGIVPPDTELS
FT                   PINPYLDVPGPNGETWPLQDTVRPWDSLSDEEKKLFCRMAEVFAGFLSYTDAQIGRILD
FT                   YLEESGQLDNTIIVVISDNGASGEGGPNGSVNEGKFFNGYIDTVAESMKLFDHLGGPQT
FT                   YNHYPIGWAMAFNTPYKLFKRYASHEGGIADPAIISWPNGIAAHGEIRDNYVNVSDITP
FT                   TVYDLLGMTPPGTVKGIPQKPMDGVSFIAALADPAADTGKTTQFYTMLGTRGIWHEGWF
FT                   ANTIHAATPAGWSNFNADRWELFHIAADRSQCHDLAAEHPDKLEELKALWFSEAAKYNG
FT                   LPLADLNLLETMTRSRPYLVSERASYVYYPDCADVGIGAAVEIRGRSFAVLADVTIDTT
FT                   GAEGVLFKHGGAHGGHVLFVRDGRLHYVYNFLGERQQLVSSSGPVPSGRHLLGVRYLRT
FT                   GTVPNSHTPVGDLELFFDENLVGALTNVLTHPGTFGLAGAAISVGRNGGSAVSSHYEAP
FT                   FAFTGGTITQVTVDVSGRPFEDVESDLALAFSRD"
FT   gene            812615..813514
FT                   /locus_tag="TBFG_10726"
FT                   /old_locus_tag="TBFG_00714"
FT   CDS_pept        812615..813514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10726"
FT                   /old_locus_tag="TBFG_00714"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0712"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10726"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05069"
FT                   /protein_id="ABR05069.1"
FT                   /translation="MLTELVDLPGGSFRMGSTRFYPEEAPIHTVTVRAFAVERHPVTNA
FT                   QFAEFVSATGYVTVAEQPLDPGLYPGVDAADLCPGAMVFCPTAGPVDLRDWRQWWDWVP
FT                   GACWRHPFGRDSDIADRAGHPVVQVAYPDAVAYARWAGRRLPTEAEWEYAARGGTTATY
FT                   AWGDQEKPGGMLMANTWQGRFPYRNDGALGWVGTSPVGRFPANGFGLLDMIGNVWEWTT
FT                   TEFYPHHRIDPPSTACCAPVKLATAADPTISQTLKGGSHLCAPEYCHRYRPAARSPQSQ
FT                   DTATTHIGFRCVADPVSG"
FT   gene            813815..814756
FT                   /locus_tag="TBFG_10727"
FT                   /old_locus_tag="TBFG_00715"
FT   CDS_pept        813815..814756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10727"
FT                   /old_locus_tag="TBFG_00715"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0713"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10727"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05070"
FT                   /protein_id="ABR05070.1"
FT                   /translation="MAGSDPPTGGPASQAGSDAGASPEHKHMSRRKHLVLDVCIILGVL
FT                   IAYVFSLLGYDWLAHTPGPLPQPDVGTTDDTVVLIRFEELHTVANRLDVKVLVLPDDSM
FT                   IDHRLQVLTTDTSVRLYPENELGDLQYPVGKLPAQVATTIEAHGNPGAWPFDTYTTDTV
FT                   QADVLVGAGDNRQYVPARVEVTGSLEGWDISAVRVGESSQTSDRPDNVIITLKRAKGPL
FT                   VFDLGICLVLITLPTLALFVAIQMITGRRKFQPPFGTWYAAMLFAVVPLRTILPGSPPA
FT                   GAWIDRAVVIWVLIALAAAMVVYIVAWYRESD"
FT   gene            815242..815610
FT                   /locus_tag="TBFG_10728"
FT                   /old_locus_tag="TBFG_00716"
FT   CDS_pept        815242..815610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10728"
FT                   /old_locus_tag="TBFG_00716"
FT                   /product="50S ribosomal protein L14 rplN"
FT                   /note="Mapped to H37Rv Rv0714"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10728"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05071"
FT                   /protein_id="ABR05071.1"
FT                   /translation="MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKD
FT                   AIPGGNVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGR
FT                   ELREKRFMKIISLAPEVL"
FT   gene            815611..815928
FT                   /locus_tag="TBFG_10729"
FT                   /old_locus_tag="TBFG_00717"
FT   CDS_pept        815611..815928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10729"
FT                   /old_locus_tag="TBFG_00717"
FT                   /product="50S ribosomal protein L24 rplX"
FT                   /note="Mapped to H37Rv Rv0715"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10729"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05072"
FT                   /protein_id="ABR05072.1"
FT                   /translation="MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHT
FT                   AISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKD
FT                   I"
FT   gene            815928..816491
FT                   /locus_tag="TBFG_10730"
FT                   /old_locus_tag="TBFG_00718"
FT   CDS_pept        815928..816491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10730"
FT                   /old_locus_tag="TBFG_00718"
FT                   /product="50S ribosomal protein L5 rplE"
FT                   /note="Mapped to H37Rv Rv0716"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10730"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05073"
FT                   /protein_id="ABR05073.1"
FT                   /translation="MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNM
FT                   GVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMW
FT                   EFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINV
FT                   VTSAATDDEGRALLRALGFPFKEN"
FT   gene            816496..816681
FT                   /locus_tag="TBFG_10731"
FT                   /old_locus_tag="TBFG_00719"
FT   CDS_pept        816496..816681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10731"
FT                   /old_locus_tag="TBFG_00719"
FT                   /product="30S ribosomal protein S14 rpsN1"
FT                   /note="Mapped to H37Rv Rv0717"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10731"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05074"
FT                   /protein_id="ABR05074.1"
FT                   /translation="MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLR
FT                   EMAHAGELPGVQKSSW"
FT   gene            816845..817243
FT                   /locus_tag="TBFG_10732"
FT                   /old_locus_tag="TBFG_00720"
FT   CDS_pept        816845..817243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10732"
FT                   /old_locus_tag="TBFG_00720"
FT                   /product="30S ribosomal protein S8 rpsH"
FT                   /note="Mapped to H37Rv Rv0718"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10732"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05075"
FT                   /protein_id="ABR05075.1"
FT                   /translation="MTMTDPIADFLTRLRNANSAYHDEVSLPHSKLKANIAQILKNEGY
FT                   ISDFRTEDARVGKSLVIQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGLGVA
FT                   IISTSSGLLTDRQAARQGVGGEVLAYVW"
FT   gene            817267..817806
FT                   /locus_tag="TBFG_10733"
FT                   /old_locus_tag="TBFG_00721"
FT   CDS_pept        817267..817806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10733"
FT                   /old_locus_tag="TBFG_00721"
FT                   /product="50S ribosomal protein L6 rplF"
FT                   /note="Mapped to H37Rv Rv0719"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10733"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05076"
FT                   /protein_id="ABR05076.1"
FT                   /translation="MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVAR
FT                   NDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNL
FT                   EFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGV
FT                   RYEGEQIRRKVGKTGK"
FT   gene            817809..818177
FT                   /locus_tag="TBFG_10734"
FT                   /old_locus_tag="TBFG_00722"
FT   CDS_pept        817809..818177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10734"
FT                   /old_locus_tag="TBFG_00722"
FT                   /product="50S ribosomal protein L18 rplR"
FT                   /note="Mapped to H37Rv Rv0720"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10734"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05077"
FT                   /protein_id="ABR05077.1"
FT                   /translation="MAQSVSATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQ
FT                   LVNDLNGTTVAAASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTY
FT                   GGRIAALADAARENGLSF"
FT   gene            818197..818859
FT                   /locus_tag="TBFG_10735"
FT                   /old_locus_tag="TBFG_00723"
FT   CDS_pept        818197..818859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10735"
FT                   /old_locus_tag="TBFG_00723"
FT                   /product="30S ribosomal protein S5 rpsE"
FT                   /note="Mapped to H37Rv Rv0721"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10735"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05078"
FT                   /protein_id="ABR05078.1"
FT                   /translation="MAEQPAGQAGTTDNRDARGDREGRRRDSGRGSRERDGEKSNYLER
FT                   VVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEARKSFFR
FT                   APLIGGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVHDILAKSLGSDN
FT                   AINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRKSEALAASVLPDRTI"
FT   gene            818862..819059
FT                   /locus_tag="TBFG_10736"
FT                   /old_locus_tag="TBFG_00724"
FT   CDS_pept        818862..819059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10736"
FT                   /old_locus_tag="TBFG_00724"
FT                   /product="50S ribosomal protein L30 rpmD"
FT                   /note="Mapped to H37Rv Rv0722"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10736"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05079"
FT                   /protein_id="ABR05079.1"
FT                   /translation="MSQLKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNAATRG
FT                   LIAVVRHLVEVEPAQTGGKT"
FT   gene            819059..819499
FT                   /locus_tag="TBFG_10737"
FT                   /old_locus_tag="TBFG_00725"
FT   CDS_pept        819059..819499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10737"
FT                   /old_locus_tag="TBFG_00725"
FT                   /product="50S ribosomal protein L15 rplO"
FT                   /note="Mapped to H37Rv Rv0723"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10737"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05080"
FT                   /protein_id="ABR05080.1"
FT                   /translation="MTLKLHDLRPARGSKIARTRVGRGDGSKGKTAGRGTKGTRARKQV
FT                   PVTFEGGQMPIHMRLPKLKGFRNRFRTEYEIVNVGDINRLFPQGGAVGVDDLVAKGAVR
FT                   KNALVKVLGDGKLTAKVDVSAHKFSGSARAKITAAGGSATEL"
FT   gene            819532..821403
FT                   /locus_tag="TBFG_10738"
FT                   /old_locus_tag="TBFG_00726"
FT   CDS_pept        819532..821403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10738"
FT                   /old_locus_tag="TBFG_00726"
FT                   /product="protease IV sppA"
FT                   /note="Mapped to H37Rv Rv0724"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10738"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05081"
FT                   /protein_id="ABR05081.1"
FT                   /translation="MPIFGGFCVCSRALGGRWVRWVNMVAFLPSIPVVEDLRALVGRVD
FT                   TARHHGVPNGCVLEFNLRSVPPETTGFDPLTVLTGGGRPMALRDAVAAIHRAAEDPRVA
FT                   GLIARVQLPPSPAGAVQELREAIAAFSAVKPSLAWAETYPGTLSYYLASAFGEVWMQPS
FT                   GSVGLVGFATNATFLRDALHKAGIEAQFVARGEYKSAANLFTEDGFTDAHREAVTRMLD
FT                   SLQDQVWQAVAKSRNIGVDALDELADRAPLLRDDAVTCGLIDRIGFRDQAYARMAELVG
FT                   VEKGSPESSGSQTSPDEKPPRMYLARYASSARPRLTPPVPSIPGRRSKPTIAVVTLEGP
FT                   IVNGRGGPQFLPLGPSSAGGDTIAAALREVAADDSVSAIVLRVDSPGGSVTASETIWRE
FT                   VARARDRGKPVVASMGAVAASGGYYVSMGADAIVANPGTITGSIGVITGKLVVRDLKDR
FT                   LGVGSDAVRTNANADAWSIDAPFTPDQQAHREAEADLFYSDFVERVAEGRKMTTDAVDV
FT                   VARGRVWTGADALDRGLVDELGGLRTAVRRAKVLAGLDEDTEVRIVSYPGSSLWDMVRP
FT                   RPSSRPAAASLPDAMGALLARSIVGIVEQVEQTLSGASVLWLGESRL"
FT   gene            complement(821408..822313)
FT                   /locus_tag="TBFG_10739"
FT                   /old_locus_tag="TBFG_00727"
FT   CDS_pept        complement(821408..822313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10739"
FT                   /old_locus_tag="TBFG_00727"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0725c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10739"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05082"
FT                   /protein_id="ABR05082.1"
FT                   /translation="MPRAHDDNWDLASSVGATATMVAAGRALATKDPRGLINDPFAEPL
FT                   VRAVGLDFFTKLIDGELDIATTGNLSPGRAQAMIDGIAVRTKYFDDYFRTATDGGVRQV
FT                   VILAAGLDARAYRLPWPAGTVVYEIDQPQVIDFKTTTLAGIGAKPTAIRRTVYIDLRAD
FT                   WPAALQAAGLDSTAPTAWLAEGMLIYLPPDPRTGCSTTAPNSVLRAARSLPNLSRALWI
FT                   STQAGYEKWRIRFASTAWTSTWRRWCIPANAATSSTTCAPRAGTLRAQCGPTYSGAMVC
FT                   PFPPHTTTIRSAKSSSSAVV"
FT   gene            complement(822406..823509)
FT                   /locus_tag="TBFG_10740"
FT                   /old_locus_tag="TBFG_00728"
FT   CDS_pept        complement(822406..823509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10740"
FT                   /old_locus_tag="TBFG_00728"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0726c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10740"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05083"
FT                   /protein_id="ABR05083.1"
FT                   /translation="MTYTGSIRCEGDTWDLASSVGATATMVAAARAMATRAANPLINDQ
FT                   FAEPLVRAVGVDVLTRLASGELTASDIDDPERPNASMVRMAEHHAVRTKFFDEFFMDAT
FT                   RAGIRQVVILASGLDSRAYRLAWPAQTVVYEIDQPQVMEFKTRTLAELGATPTADRRVV
FT                   TADLRADWPTALGAAGFDPTQPTAWSAEGLLRYLPPEAQDRLLDNVTALSVPDSRFATE
FT                   SIRNFKPHHEERMRERMTILANRWRAYGFDLDMNELVYFGDRNEPASYLSDNGWLLTEI
FT                   KSQDLLTANGFQPFEDEEVPLPDFFYVSARLQRKHRQYPAHRKPAPSWRHTACPVNELS
FT                   KSAAYTMTRSDAHQASTTAPPPPGLTG"
FT   gene            complement(823712..824368)
FT                   /locus_tag="TBFG_10741"
FT                   /old_locus_tag="TBFG_00729"
FT   CDS_pept        complement(823712..824368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10741"
FT                   /old_locus_tag="TBFG_00729"
FT                   /product="L-fuculose phosphate aldolase fucA"
FT                   /note="Mapped to H37Rv Rv0727c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10741"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05084"
FT                   /protein_id="ABR05084.1"
FT                   /translation="MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPS
FT                   SVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWAT
FT                   MFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLV
FT                   AVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL"
FT   gene            complement(824365..825345)
FT                   /locus_tag="TBFG_10742"
FT                   /old_locus_tag="TBFG_00730"
FT   CDS_pept        complement(824365..825345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10742"
FT                   /old_locus_tag="TBFG_00730"
FT                   /product="D-3-phosphoglycerate dehydrogenase serA2"
FT                   /note="Mapped to H37Rv Rv0728c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10742"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05085"
FT                   /protein_id="ABR05085.1"
FT                   /translation="MTPRPRALVTAPLRGPGFAQLRRLADVVYDPWIDQRPLRIYSAEQ
FT                   LADRITAVAADVLVVESDSVGGPVFERGLRVVAATRGDPSNVDIPGATAAGIPVLHTPA
FT                   RNADAVAEMTVALLLAVARHLIPADADVRSGNIFRDGTIPYQRFRGAEIAGLTAGLVGL
FT                   GAVGRAVRWRLSGLGLRVIAHDPYRDDAGHSLDELLAEADIVSMHAAVTDDTIGMIGAQ
FT                   QFAAMRDGAVFLNTARSQLRDTDALVDALRGGKLAAAGLDHFTGEWLPTDHPLVSMPNV
FT                   VLTPHIGGATWNTEARQARMVADDLGALLSGNRPAHVVNPEVLGS"
FT   gene            825376..826722
FT                   /locus_tag="TBFG_10743"
FT                   /old_locus_tag="TBFG_00731"
FT   CDS_pept        825376..826722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10743"
FT                   /old_locus_tag="TBFG_00731"
FT                   /product="D-xylulose kinase xylB"
FT                   /note="Mapped to H37Rv Rv0729"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10743"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05086"
FT                   /protein_id="ABR05086.1"
FT                   /translation="MSRDDVTIGIDIGTTAVKAVAADDNGRVTARVRIGHQLAVPAPDR
FT                   LEHDADEAWRRGPLAALDRLVGPDTRALAVAAMVPSLTAVDPAGRPITPGLLYGDARGR
FT                   VPNASVARAQSVPSVGETAEFLRWTAGQALDASGYWPAPAVANYALSGEAVIDYATAVT
FT                   TLPLFDGTGWNATACADCGVTVDRMPRVETFGVGVGQVRGTGAVLAVGAVDALCEQIVA
FT                   GADRDGDVLVLCGATLIVWTTISAARQVPGLWTIPHTAPGKSQIGGASNAGGLFLNWVD
FT                   RVIGPGDPALADPRRVPVWLPYIRGERTPFHEPDRRAVLDGVDLSQDAASVRRAAYEAS
FT                   GFVVRQLIELSGAPVARIVAAGGGTRIQPWMQAIADATGRPVEVSRVAEGAALGAAFLG
FT                   RLAAGLESSIADAARWASTDRIVEPSADWAGPTKERYRRFLALSGSKLA"
FT   gene            826735..827463
FT                   /locus_tag="TBFG_10744"
FT                   /old_locus_tag="TBFG_00732"
FT   CDS_pept        826735..827463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10744"
FT                   /old_locus_tag="TBFG_00732"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0730"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10744"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05087"
FT                   /protein_id="ABR05087.1"
FT                   /translation="MHGARTGVSFYAYAMTDHDQTAARREIADALLAALERRHEVADAI
FT                   VEAANKAAAVEAIVNLLGTSHLAAEAVMSMSFDQLTQDARTKIIAELDDLNKQLSFTVK
FT                   ERPASSGEGLELRPFSPDEDRDIFARRTEEMGAAGDGSGGPAGSVDDEIRAAQKRVDDE
FT                   EAAWFVAVDSGVKVGMVFGELVHGEVDVRIWIHPDHRKKGYGTAALRKSRSEMAWAFPA
FT                   VPMVARAPAAQPAQPGSAGR"
FT   gene            complement(827552..828508)
FT                   /locus_tag="TBFG_10745"
FT                   /old_locus_tag="TBFG_00733"
FT   CDS_pept        complement(827552..828508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10745"
FT                   /old_locus_tag="TBFG_00733"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0731c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10745"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05088"
FT                   /protein_id="ABR05088.1"
FT                   /translation="MTQTGSARFEGDSWDLASSVGLTATMVAAARAVAGRAPGALVNDQ
FT                   FAEPLVRAVGVDFFVRMASGELDPDELAEDEANGLRRFADAMAIRTHYFDNFFLDATRA
FT                   GIRQAVILASGLDSRAYRLRWPAGTIVFEVDQPQVIDFKTTTLAGLGAAPTTDRRTVAV
FT                   DLRDDWPTALQKAGFDNAQRTAWIAEGLLGYLSAEAQDRLLDQITAQSVPGSQFATEVL
FT                   RDINRLNEEELRGRMRRLAERFRRHGLDLDMSGLVYFGDRTDARTYLADHGWRTASAST
FT                   TDLLAEHGLPPIDGDDAPFGEVIYVSAELKQKHQDTR"
FT   gene            828669..829994
FT                   /locus_tag="TBFG_10746"
FT                   /old_locus_tag="TBFG_00734"
FT   CDS_pept        828669..829994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10746"
FT                   /old_locus_tag="TBFG_00734"
FT                   /product="preprotein translocase secY subunit"
FT                   /note="Mapped to H37Rv Rv0732"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10746"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05089"
FT                   /protein_id="ABR05089.1"
FT                   /translation="MLSAFISSLRTVDLRRKILFTLGIVILYRVGAALPSPGVNFPNVQ
FT                   QCIKEASAGEAGQIYSLINLFSGGALLKLTVFAVGVMPYITASIIVQLLTVVIPRFEEL
FT                   RKEGQAGQSKMTQYTRYLAIALAILQATSIVALAANGGLLQGCSLDIIADQSIFTLVVI
FT                   VLVMTGGAALVMWMGELITERGIGNGMSLLIFVGIAARIPAEGQSILESRGGVVFTAVC
FT                   AAALIIIVGVVFVEQGQRRIPVQYAKRMVGRRMYGGTSTYLPLKVNQAGVIPVIFASSL
FT                   IYIPHLITQLIRSGSGVVGNSWWDKFVGTYLSDPSNLVYIGIYFGLIIFFTYFYVSITF
FT                   NPDERADEMKKFGGFIPGIRPGRPTADYLRYVLSRITLPGSIYLGVIAVLPNLFLQIGA
FT                   GGTVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEGFLK"
FT   gene            829991..830536
FT                   /locus_tag="TBFG_10747"
FT                   /old_locus_tag="TBFG_00735"
FT   CDS_pept        829991..830536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10747"
FT                   /old_locus_tag="TBFG_00735"
FT                   /product="adenylate kinase adk (ATP-AMP
FT                   transphosphorylase)"
FT                   /note="Mapped to H37Rv Rv0733"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10747"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05090"
FT                   /protein_id="ABR05090.1"
FT                   /translation="MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL
FT                   GVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRG
FT                   TDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVD
FT                   AVGTMDEVFARALRALGK"
FT   gene            830539..831339
FT                   /locus_tag="TB