(data stored in SCRATCH zone)

EMBL: CP000718

ID   CP000718; SV 1; circular; genomic DNA; STD; PRO; 58679 BP.
XX
AC   CP000718; AAKT02000000-AAKT02000003;
XX
PR   Project:PRJNA16070;
XX
DT   24-JUL-2007 (Rel. 92, Created)
DT   30-SEP-2019 (Rel. 142, Last updated, Version 8)
XX
DE   Yersinia pseudotuberculosis IP 31758 plasmid p_59kb, complete sequence.
XX
KW   .
XX
OS   Yersinia pseudotuberculosis IP 31758
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
OG   Plasmid p_59kb
XX
RN   [1]
RP   1-58679
RX   PUBMED; 17784789.
RA   Eppinger M., Rosovitz M.J., Fricke W.F., Rasko D.A., Kokorina G.,
RA   Fayolle C., Lindler L.E., Carniel E., Ravel J.;
RT   "The complete genome sequence of Yersinia pseudotuberculosis IP31758, the
RT   causative agent of Far East scarlet-like fever";
RL   PloS Genet. 3(8):0-E142(2007).
XX
RN   [2]
RP   1-58679
RA   Eppinger M., Rosovitz M., Fricke W.W., Rasko D.A., Lindler L.E.,
RA   Carniel E., Ravel J.;
RT   ;
RL   Submitted (05-JUN-2007) to the INSDC.
RL   Microbial Genomics and Pathogen Functional Genomic Resource Center, J.
RL   Craig Venter Institute, 9712 Medical Center Drive, Rockville, MD 20850, USA
XX
DR   MD5; f820cc30f5613fd73b9e1214aea832e0.
DR   BioSample; SAMN02604043.
DR   EuropePMC; PMC1959361; 17784789.
DR   RFAM; RF01089; PK-repBA.
DR   RFAM; RF01760; traJ-II.
XX
CC   Inquiries for DNA can be made to Elizabeth Carniel
CC   (carniel2@pasteur.fr).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..58679
FT                   /organism="Yersinia pseudotuberculosis IP 31758"
FT                   /plasmid="p_59kb"
FT                   /strain="IP 31758"
FT                   /serotype="O:1b"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="stool of a patient presenting with
FT                   scarlet-like fever in the Primorski region of the former
FT                   USSR; in 1971 sent to the Institut Pasteur (Paris, France)
FT                   by Dr. Timofeeva (Antiplague Institute, Irkoutsk)"
FT                   /collection_date="1966"
FT                   /db_xref="taxon:349747"
FT   gene            complement(519..1556)
FT                   /locus_tag="YpsIP31758_A0041"
FT   CDS_pept        complement(519..1556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAR13133.1"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT88"
FT                   /protein_id="ABS45597.1"
FT                   /translation="MHRQNSPSIFNDAQFIHTQEKTRRGEANALRKGVSKIHRRYIPAF
FT                   NDSVPRGAAGQVVARMRNHDWKRNQALCELRKSGYTPFKKRTDPNFVPKPMRITPRSEC
FT                   REALTALSLALAANCNYDPTAEYPFEVMCSIEDLARSMGVLHVYEDGRKAYDILLNALS
FT                   VIEQLNYCVVHREIDPDVGQYKPIRMWLTPQFFLSRGFQMDEVRELLNKYRQWAIKNGL
FT                   SESLKKKYQRHLLRMARLGIDIERRHSLKNLLRKIKRQVVSADLQDEKKAAVVDIGQYL
FT                   DKLAKAPKKIKKASLTPYETAYQRWAESMPRSDIYRMKWAIEKEYPDLRGEAYYKLLLE
FT                   RAGAI"
FT   gene            complement(1836..2138)
FT                   /locus_tag="YpsIP31758_A0042"
FT   CDS_pept        complement(1836..2138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0042"
FT                   /product="plasmid stabilization system protein, RelE/ParE
FT                   family"
FT                   /note="identified by match to protein family HMM PF05016"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45605"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT96"
FT                   /protein_id="ABS45605.1"
FT                   /translation="MPRLIWTQEAIQDVDRLYKFLAEKNVEAARKAAKVILDETTKIEA
FT                   FPEIGRPAEFINVYCRELLVPFGVSGYVVLYRYDGQLTTILAVKHQFEAGYLPEF"
FT   gene            complement(2126..2416)
FT                   /locus_tag="YpsIP31758_A0043"
FT   CDS_pept        complement(2126..2416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45628"
FT                   /db_xref="GOA:A0A0U1QTB9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB9"
FT                   /protein_id="ABS45628.1"
FT                   /translation="MKTSSNTPVSVKIEPTIKARMERLGESRERTMHWLVTDAIKKYVE
FT                   HEEKREELKEAAHKAWLSFQETGLHVSSEEANEWLTSLSEGHYKEPPKCHV"
FT   gene            complement(3354..3650)
FT                   /locus_tag="YpsIP31758_A0044"
FT   CDS_pept        complement(3354..3650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0044"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA6"
FT                   /protein_id="ABS45615.1"
FT                   /translation="MHKSLYLSLPLEWFYDLIYNTTVIYSKCYLQEVIMRISIVQMVND
FT                   YYEGNREKAAKAAGIKTIQQFNNLVSKGYEVARLDNGDWIMLTSKTKIFKSHI"
FT   gene            complement(3928..4839)
FT                   /locus_tag="YpsIP31758_A0045"
FT   CDS_pept        complement(3928..4839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0045"
FT                   /product="hypothetical protein"
FT                   /note="similar to Atu6113 from A. tumifaciens C58 pTi
FT                   plasmid"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45573"
FT                   /db_xref="GOA:A0A0U1QT64"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT64"
FT                   /protein_id="ABS45573.1"
FT                   /translation="MSEDSNLPGLRMVVLAGPNGSGKSTVTDGLRLSQKFPPLYINADD
FT                   ISKNELGHIPDANSRNMAAAKLAEERRKTALKNGEAFAFETVMSTPGKIALFDEARSLG
FT                   FSVDLIFVTTNDPMINFVRVENRVQLGGHAVPEEKIFERYARAMQLLPSAIEKADTAEV
FT                   YDNSENGILPQLIAAKKDSIIEYSEPISDWVKECLISICNERCSSRERLITELKVLDPD
FT                   AEILDANIGNNKCYSGLIVGITDFHVMQRLNTNPKQYLLHDKALCAPRTYEVKKSSVIS
FT                   YAFGADGKHKLLSPKKSHGKSL"
FT   gene            5634..6002
FT                   /locus_tag="YpsIP31758_A0046"
FT   CDS_pept        5634..6002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0046"
FT                   /product="conjugal transfer protein TrbA"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45633"
FT                   /db_xref="GOA:A0A0U1QTC4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTC4"
FT                   /protein_id="ABS45633.1"
FT                   /translation="MYNLILFTNILRILEERGMTKSELHEVSGVSISFLSDLTNGKANP
FT                   SLKVMEAIADALDTPLPILLESTDLDQDSLDALAGGKMPRSLPEGYERVSAIVTDHQAY
FT                   IIRKWHEAAQKKIDTRTS"
FT   gene            6020..7120
FT                   /locus_tag="YpsIP31758_A0047"
FT   CDS_pept        6020..7120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0047"
FT                   /product="conjugal transfer protein TrbB"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02782"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45613"
FT                   /db_xref="GOA:A0A0U1QTA4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA4"
FT                   /protein_id="ABS45613.1"
FT                   /translation="MYQLKPPIGRLFYYHKTNKISVVLAPAKFSLYRIWHLIMLSNENS
FT                   GIMQPNVEETSIGSRAKEKLRRDLGPLIIDALEDKMTAEIMLNPDGKLWIETFGKPMRH
FT                   IGDLSFVRAEAIIKTIAGYHGKEITTLKPTLEGELPIDGSRFAGQLPPVVSGPTFAIRR
FT                   KAVSIFTLTQYVESNVMTAHQSEVIRNAIRDHRNILVIGGTGSGKTTLVNAIINEMVVF
FT                   DPSERVFIIEDTGEIQCAAENCVQYHSTLEVTMTMLLKTTLRMRPDRILVGEVRGAEAL
FT                   DLLDAWNTGHEGGAATLHANNALSGLTRLKSLISRNSSAPAEIEPLIAEAVHIIIHISR
FT                   TPEGRRIQEVVEVSGYVDGKYITRNL"
FT   gene            7133..7513
FT                   /locus_tag="YpsIP31758_A0048"
FT   CDS_pept        7133..7513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0048"
FT                   /product="conjugal transfer protein TrbC"
FT                   /note="identified by match to protein family HMM PF04956"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45594"
FT                   /db_xref="GOA:A0A0U1QT85"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT85"
FT                   /protein_id="ABS45594.1"
FT                   /translation="MQMTMPSINISNKTMLLLGIALLLMLSTHPALASNTSGGGLPFDE
FT                   WFTKIRQSVTGPFAFTAAIVGLVATGATLIFGGDMNGFMKTLIFIVLVMSFLVAAQNTL
FT                   AAITGQGAQIAMTFKFMEAGSI"
FT   gene            7516..7830
FT                   /locus_tag="YpsIP31758_A0049"
FT   CDS_pept        7516..7830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0049"
FT                   /product="conjugal transfer protein TrbD"
FT                   /note="mating pair formation; identified by match to
FT                   protein family HMM PF05245"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45606"
FT                   /db_xref="GOA:A0A0U1QT97"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT97"
FT                   /protein_id="ABS45606.1"
FT                   /translation="MALRTIPIRKSGNRHNLFMDGDREMVMFSGLLAAILIFAAQDWRA
FT                   FFAGVVLWFSALWLLRLMAKSDPKMRQIYMRQRLYKKYYPARSTPFRINTEAQGKQYND
FT                   "
FT   gene            7823..10360
FT                   /locus_tag="YpsIP31758_A0050"
FT   CDS_pept        7823..10360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0050"
FT                   /product="conjugal transfer protein TrbE"
FT                   /note="identified by match to protein family HMM PF03135;
FT                   match to protein family HMM TIGR00929"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45576"
FT                   /db_xref="GOA:A0A0U1QT67"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT67"
FT                   /protein_id="ABS45576.1"
FT                   /translation="MIEYIPIAYGILGFLLVLILFSLIRAANNEISLKKFRSKDAGVSD
FT                   LLNYAAVVADGVIVGKNGSFMSAWLYKGDDNASSTDAQRELISFRINQAFAKMGSGWMV
FT                   HIDAVRRPAPNYSETGASHFRDPISAAVDEERRQYFESLGTLYEGFFVLTLTWFPPLLA
FT                   QRKIIELMFDDDSEKHSKTSQTHHLIEQFQTETKNFADRLSSSISLVQLCSEKVINEDG
FT                   SEVTHDNLLSWLQFCLTGIIQPILLPNNPMYIDALIGGQELYAGVVPRIGRKFIQCVAI
FT                   EGFPLNSYPGILSSLAELSIEYRWSTRFIFLDNFEAVSHLEKFRKKWKQKIHGFFDQLF
FT                   NTGRGDVNEDALSMVGDASAAIAETNSGMVNQGYYTNNIILMGEDRALVEASARRVEKE
FT                   IQRLGFASRTETINTMDAFFGSLPGHGVENVRRPLMNTMNVADMIPTSTIWTGENYAPS
FT                   PLYQPNAPALMSCVTNGSSPFRLNLHVRDLGHGFMFGPTRSGKSTHLSTIAMQFLRYFG
FT                   SRVYSFDKGMSMYPTCKAVGGNHFTVAANDDKLSFAPLSILKTRSDKAWAMEWIDTILA
FT                   LNGVITTAAQRNEIAKAIVNMAESNSKTISEFSLLIQDEGIRNALKQYTVDGLMGHLLD
FT                   AEEDGLTLADFITFEIEDLMNLGEKFALPVLLYLFRRIETSLDGRPTLIILDEAWLMLG
FT                   HEVFREKIREWLKTLAKLNCSVLMATQNLSDASNSGILDVIVESTATKIYLPNVNAREE
FT                   SAAALYTRMGLNPRQIEIIASAVPKQDYYFVSEKGRRLYNLALGPLALAFVGSTDKESI
FT                   AAIKELEARYGDAWVHEWLRIKGISLNDYGVAA"
FT   gene            10357..11079
FT                   /locus_tag="YpsIP31758_A0051"
FT   CDS_pept        10357..11079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0051"
FT                   /product="conjugal transfer protein TrbF"
FT                   /note="identified by match to protein family HMM PF04585"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45580"
FT                   /db_xref="GOA:A0A0U1QT71"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT71"
FT                   /protein_id="ABS45580.1"
FT                   /translation="MIFNLFKKKEKTLAAKVSQTDNPYLNARRTWNGHVSGVMSAIQIW
FT                   QVVGILALLIALTAVGGIIKIGSQSKFVPLVFQQDSTGNTLSVTRADKIPDAKIEDYRT
FT                   TAAKFIENIRLVTADSSLQRKAVLQTYSYLSAKDPSTIKANEYLNSSKEANPFNRATKE
FT                   LVSVDVKSVMIISDESWQVDWEETLRGRDGTLKGKPYMMRAIVNLYQNQPTDDNAEVEV
FT                   LRNPHFIFVRDFNWSKPL"
FT   gene            11094..11981
FT                   /locus_tag="YpsIP31758_A0052"
FT   CDS_pept        11094..11981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0052"
FT                   /product="conjugal transfer protein TrbG"
FT                   /note="identified by similarity to SP:P55404; match to
FT                   protein family HMM PF03524; match to protein family HMM
FT                   TIGR02775"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45575"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT66"
FT                   /protein_id="ABS45575.1"
FT                   /translation="MKKTIISILALSVLATPSYSVLADDLADQYFSKETRQLTPQEKAA
FT                   IAIGEKWQTGNATSKPVAATDGSIRFIFGSGQIQILCAVLQVCDIALQPGEQVNSINAG
FT                   DPRFIVEPAITGSGASEQLHLIVKPLDVGLDTSLVVGTDRRTYHFRLRSSRKEFMPLVS
FT                   FTYPEDAQAKWAAIQAREKKEKTDNTIPQTGEYLGNLNFNYDISGSARWKPTRVYNDGT
FT                   KTIIEMSSEMRQSEAPTLLVVRKNGGVFSDPETVMVNYRVQGNRYIVDTIFDKAMLVVG
FT                   VGSSQDRVTITRGK"
FT   gene            11984..12433
FT                   /locus_tag="YpsIP31758_A0053"
FT   CDS_pept        11984..12433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0053"
FT                   /product="conjugal transfer protein TrbH"
FT                   /note="identified by match to protein family HMM PF07283"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45624"
FT                   /db_xref="InterPro:IPR010837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB5"
FT                   /protein_id="ABS45624.1"
FT                   /translation="MRKILVLTLLVFSIAGCISSPNGNYASAPIGFDQKMAEDTVKQLV
FT                   LLYPPAHTRFTLKQSPTDAYGAYLVKSLRLKGYAIAELSHTDKQAASKTAFSSNTNMTL
FT                   EYIVDSVANTNLYRVTINVGKQTLSRAYVSQNGSIYPSVSWARKE"
FT   gene            12438..13817
FT                   /locus_tag="YpsIP31758_A0054"
FT   CDS_pept        12438..13817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0054"
FT                   /product="conjugal transfer protein TrbI"
FT                   /note="identified by match to protein family HMM PF03743"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45619"
FT                   /db_xref="GOA:A0A0U1QTB0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB0"
FT                   /protein_id="ABS45619.1"
FT                   /translation="MANTDNQMSPSNSPGSIGKTGVRRVNNLPLIIVLSVITIFIAIIA
FT                   MVAVKRSDQQNQAPETPKSEKTVSSSSMAADIVAGHNNGIIPPEQITAPTQASEPTEPT
FT                   EPTTAIPVAKVDNPNEPPVPPRNNGSRQDIPNDPDLDRIKMAKLQQFEEAVKAKTTVSI
FT                   PTLRDNATGADGATPTRDQTLARLEAVRRQIDQTQNEDPTSAYKKRLQQLQGNGGMSGD
FT                   NASSGGDGLATSSSNDIEQFAGTGVTDRWALNTKVEAPRSPFEIRAGAVVPGVMISGVN
FT                   SDLPGQIMGQVTQDVFDTPTGKHLLIPQGTRLTGSYTSDVAFGQSAVMIAWQRMIFPDG
FT                   KALDIAAMPGADSAGYSGFRDQVNNHLFRIFSSAFLLSGVTAGVTYSQGRNENSNGNNS
FT                   PTASSALSEALGQQFGQVTAQMIAKNLNIAPTLEIRPGYRFNIIVIKDMTFKKPYKPFD
FT                   Y"
FT   gene            13835..14611
FT                   /locus_tag="YpsIP31758_A0055"
FT   CDS_pept        13835..14611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0055"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /note="identified by match to protein family HMM TIGR02780"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45614"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA5"
FT                   /protein_id="ABS45614.1"
FT                   /translation="MTFLNNRSLAAKIMFLVALSGSPVTQTSYAGGIPVMDLTNLTQNI
FT                   MTAMESVAQTLKQIEQYKTQLQQYENMLQNTMAPAAWIWDQANNTINDLMRSVDTLNYY
FT                   KQQVGSIDKYLDQYQDVTWYRNSPCFKGKSCSPQQMQAIRDTIAASSEAQKRSNDAMLR
FT                   GVDQQQVSLQNDARQLVNLQQQAQGATGQMAAMQYANQLASSQTNQLLQIRGLLLAQQT
FT                   ATATRAAAVNAKESIETAGAESFRAGSLDKSPVKKW"
FT   gene            14774..16195
FT                   /locus_tag="YpsIP31758_A0056"
FT   CDS_pept        14774..16195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0056"
FT                   /product="conjugal transfer protein TrbL/VirB6"
FT                   /note="identified by match to protein family HMM PF04610;
FT                   match to protein family HMM TIGR02783"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45603"
FT                   /db_xref="GOA:A0A0U1QT94"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT94"
FT                   /protein_id="ABS45603.1"
FT                   /translation="MTVLELVISKKVLRKSGNTMKKISLSVLAVVLLIVALQAQAGTGI
FT                   NSAGLLDDILERFANTASGWGDRIVSYGLWLFWGLTLLSMVWTYGMMVLKKSDIQEFFA
FT                   ETIRFLAATGFFLWILVNGPAIAISIINTCRQIAANASGLSNALSPSGIVDIGFDIAGK
FT                   VVDKSSIWSPADSTVGLLVATVILCMLALVAINMLLMLITGWLLAYAGVFILGFGGGHW
FT                   TQDIAIAYYKQVLGVGIQTFVMILLVGIGQSFIDQYYAAMGDDMALKELLVMLVASFVL
FT                   LMLVAQLPPMFAGIVGAGSGGGSLAFGMGAALGAAGMAAATAGAAGAAAISGATSAAGG
FT                   MSALQAAFESAQQSMDAGSSPSGEGRSSSGGSLSEAMGRAGGFARSMGSSLVDAARDVA
FT                   QEKAGAIKDSIQERVSETTGGKMADSIRESSGMNIGNDNSQFDGDGLGAGNNAGNSAST
FT                   PETDEEMIDQFVNKK"
FT   gene            16248..16868
FT                   /locus_tag="YpsIP31758_A0057"
FT   CDS_pept        16248..16868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0057"
FT                   /product="conjugal transfer protein TrbN"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45592"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT83"
FT                   /protein_id="ABS45592.1"
FT                   /translation="MVFLDLPPQLHERVVCSITSALKYEVPANIVLGIAEKEGGKPGQW
FT                   VKNTNGTHDVGPLQFNTQYLKELSKYGITAEDVAQAGCYSYDLAAWRLRGHLMNDKGDI
FT                   WTRAANYHSRTPKFNAPYRADLIQKATKWGDWLEARFVTYTVTTPGAAPARIASRITTV
FT                   AKPQNEIVKKTIEVKSISNIEKKYNPAAAQALASVFAPKMGNN"
FT   gene            16987..17466
FT                   /locus_tag="YpsIP31758_A0058"
FT   CDS_pept        16987..17466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0058"
FT                   /product="transcriptional activator"
FT                   /note="identified by match to protein family HMM PF02357"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45629"
FT                   /db_xref="GOA:A0A0U1QTC0"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTC0"
FT                   /protein_id="ABS45629.1"
FT                   /translation="MKNWYLLSYKYGQVNRVQFGLDRLGVNSFSPSIQVKKVRSDSGTI
FT                   RLVNEPMFPTYLFVEFDIESIHTTTISSTLGVNYFVKFGTEPKPIPLSLIHQLMNRSEC
FT                   SSQRNEEIDEIATIPDKKLRCALFIKLITQIPDSFEQNSLIKTHHLPATHQTLSS"
FT   gene            17489..18421
FT                   /locus_tag="YpsIP31758_A0059"
FT   CDS_pept        17489..18421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0059"
FT                   /product="putative secretion system protein PilL"
FT                   /note="identified by similarity to GB:AAL05516.1"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45578"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT69"
FT                   /protein_id="ABS45578.1"
FT                   /translation="MQRETQLFIMVAIIMSSSVYADDGSDDIYRISDDYISNIQIERPI
FT                   LVSSNTQSRLLSASSSSPQIVEPPKKPTIQLVALNNIIQSGTPSPIEFRGSGADNQSFY
FT                   DAIRKIAPTGWTISISSDIDKDFKNKKFKWVGNDLWLNILQRVLAENNINGYVNWSLKR
FT                   ISFVYPQNEKNKQTALITPNVPVTTTSVAVQNDNKNPFNSKSAISKPTPEKIIPPLKIW
FT                   NANVGLTLHSTLLKWSGEVPCNIIGKWTINWNSSKDYSIDSALTFRGEYLDAVTQLFNL
FT                   YKKANSPLFIDVYKTQCLIIVSDASENKK"
FT   gene            18434..20140
FT                   /locus_tag="YpsIP31758_A0060"
FT   CDS_pept        18434..20140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0060"
FT                   /product="type IV pilus/secretion system protein, PilN
FT                   family"
FT                   /note="identified by match to protein family HMM PF07655;
FT                   match to protein family HMM TIGR02520"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45570"
FT                   /db_xref="GOA:A0A0U1QT61"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR013359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT61"
FT                   /protein_id="ABS45570.1"
FT                   /translation="MKIKLITACVMAALLSGCSIGRINKVIDSAQSDSEKVSNMIAETA
FT                   TVRPPVKIHDEQWINPIPIKSATADIPAAMINCVITYKPVRPQDVYQFGQDVTQQCNIP
FT                   VRISPDAAAMLSGNNSTGGGGRPTNQMSSVPAPIVPPEANGMVPLQTLGTMQPGNNGSV
FT                   AYSGGVARKITDVAFSGNVARLLDIVTSRLGVSWRYANGEITIFYLQTKRFDIDTTNAK
FT                   YTLENQQKSGLSTQSGSNGTGEKSSGISGTSGSNTLQTTEMSNDIYGDIQKTVESMLTP
FT                   GVGRVSINQTSGVVVVTDVPNVVRNIGEYLQDENSKLSKQVLFKVVIYTITSEVSDNVG
FT                   IDWDIIFKSLSGKYGINLASSSGLSTDLANGSFEILDTATGKAAQFAGSQFMLQALSKQ
FT                   ANVTDTKTLNLMTTNLATAGLLIGKQTTYLQRSSITSIGSGNSSEPVQSLEPGQITTGT
FT                   NIVILPKILNDNEKMMLTMMLDITSLNKLRKIDTADKKLSIEGPDSDSSSIPQRIWLKP
FT                   GETILMSGFEQIVKDGSKQGMGDPNNIIMGGNMSGSDKKQSFVITITPILR"
FT   gene            20150..21484
FT                   /locus_tag="YpsIP31758_A0061"
FT   CDS_pept        20150..21484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0061"
FT                   /product="putative type IV secretion system protein PilO2"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45582"
FT                   /db_xref="GOA:A0A0U1QT73"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT73"
FT                   /protein_id="ABS45582.1"
FT                   /translation="MATETKERKKIRVVTYNNKQFVVGLEWRSITGGRNFMKEVKRIGK
FT                   EEKLDVVAIRQTESVQAGFAPQTDIPLKGKYSFSISLVSLLPGRWIGVFPVAPDDASNN
FT                   EYIIIATSDGIIFPATDKIIMEDEVEQEVNDLKSRLSLGEGKVEIYGDAKKFFWVTSEI
FT                   SLSEILAAKNLKKEYKLKLLTWGLTKKQIYFFIALFIAALFALYLVNVYLEAKAEEERL
FT                   ERVEARKKAEKINEEARYKASLDSLKHPWVTQASIQNFIKTCDSKLPEIPLSLAGRKPV
FT                   TLDCSHNSMDVLYERLDGSSVGSTEFKEKVEQLFNTTPSFNMKQPSIVGFSLALDNKPD
FT                   GDDPVASMSEQLNKFVTLLQRNNIEFTLTDAPSPEKKFDGQGVELPLPDWREIYFSYDS
FT                   MYPPRDIFKQNNLSGMRVTNIIYVINNDTSEILYKVKGVIYYGKK"
FT   gene            21471..21914
FT                   /gene="pilP2"
FT                   /locus_tag="YpsIP31758_A0062"
FT   CDS_pept        21471..21914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP2"
FT                   /locus_tag="YpsIP31758_A0062"
FT                   /product="type IV pilus biogenesis/secretion protein PilP"
FT                   /note="identified by similarity to GB:AAP22530.1; match to
FT                   protein family HMM TIGR03021"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45604"
FT                   /db_xref="InterPro:IPR022753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT95"
FT                   /protein_id="ABS45604.1"
FT                   /translation="MVKSKLIKNRVYFLLLSIIISCSVSANEISEVKSVWDLDVLQSQT
FT                   TYLKALAAFQEAKDKSGGTMPIVGSVAPGVNSAQKILLPQVIKIVGNGSGLSVRLVLSN
FT                   GTEMTKKKGDSIPGGYKLTKVTLDEVSISDAAGTSFILSEVGS"
FT   gene            21911..23443
FT                   /locus_tag="YpsIP31758_A0063"
FT   CDS_pept        21911..23443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0063"
FT                   /product="putative type IV secretion system protein PilQ"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45632"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTC3"
FT                   /protein_id="ABS45632.1"
FT                   /translation="MKVLNLSGIDGVADYHLPAKLKDAMCLVKTDLGNIELRVSSHLIN
FT                   SAEVMDYERQLKKTNTEFKLVPSNIAEIVELNQQSGVTTQEQLNIIHGKIFEIFSAATD
FT                   ARSSDIHFRLRSKLCNVFFRVDGKLRFYKELTPEDGKSYINSLFNTRCEDRSHQSISYQ
FT                   EPCGAKVSEDFVQPLGLSGGRFASRPVADGGMVAVIRLISRRNEILSMEQLGLTDTEIE
FT                   TLERAIAKPTGVIFLTGPMGSGKSTLAQVVCELLTSRDPGIHLLTVENPVESPIKGAVQ
FT                   TSLGTGEEWWEAIKSMMRLDLNWILIGEVRDPLSASAAIEAAQTGHNVLTTIHTTFPID
FT                   TISRLKSLNVQSDLITDASLITCLVGQRLAPKLCPSCKQKYTDSSKSVAPVIKKIIDKH
FT                   CDIDSIYLKNPQGCTECSGAGVKGRVGIFEVIEVDANFMDIYHSQGKIKAYEHWYINGG
FT                   ATLCTNTLRLVNTGEIDPVLSHKDVCNLDRDYLIFTDEVRAAAKVNREKINE"
FT   gene            23436..24500
FT                   /locus_tag="YpsIP31758_A0064"
FT   CDS_pept        23436..24500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0064"
FT                   /product="putative type IV secretion system protein PilR"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45588"
FT                   /db_xref="GOA:A0A0U1QT79"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT79"
FT                   /protein_id="ABS45588.1"
FT                   /translation="MNKFNRALYKMTFNVNDREDVYDNFRQYLIDGQSVDNTFKNLIVN
FT                   YTRRGRKPNSPMAEIIREWEEKFKLGDTLGESLREWIPEQELSVIDACDTAGRPWDGFQ
FT                   KAIKIARSAERIKKTIKGAFFTSIYMFLLSFILLAFACSLLVPTLLEAVPLFRWSTTQK
FT                   FVYYFYIFISGYWWALIAVCLIVGYIIYHSLDRWTGNSRFHADKFVPYSLYKEMHGATF
FT                   IINVDAMLSAGIPLKDSLIKIRNMSDSDWLIERVNGAISGLTEGEENLGLALDISNFEF
FT                   PSEDAIIKMQSLFETANKEGSLERFGERQLENTISRVERKTAVIKVASMVFGAGCTVGI
FT                   FFVMYSLIQQVFGI"
FT   gene            24517..25023
FT                   /locus_tag="YpsIP31758_A0065"
FT   CDS_pept        24517..25023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0065"
FT                   /product="putative type IV secretion system protein PilS2"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45586"
FT                   /db_xref="GOA:A0A0U1QT77"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT77"
FT                   /protein_id="ABS45586.1"
FT                   /translation="MKILKKGLNAITDETIAKVVGFLFLAGVVVAGVVLNGKIGSTTMV
FT                   NAMSTLLNEAKGLRTSAGYGTGDLTPALIRSKSIQKGLKIDGDKLYNPTNGPVTITGSG
FT                   MTFTLATSKVKDEDCMKLATTLSGADIESMKINSGSTVTSEMSQIDAANQCNAGKENTI
FT                   SITSY"
FT   gene            25039..25992
FT                   /locus_tag="YpsIP31758_A0066"
FT   CDS_pept        25039..25992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0066"
FT                   /product="type IV secretion system protein"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45602"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT93"
FT                   /protein_id="ABS45602.1"
FT                   /translation="MTESLLKDSGFVDLYLGDDYTDIKGMIGASNRLAPAPEILKNDIE
FT                   SLRQQCLNFYHAEKRNEFSIFYGERLYRVTTTIDVYQNIGFVIRQTPNELFTLQKVGLS
FT                   SDLIKLISQNNNSGLVLVSGKMGAGKTTTAAAMICHRIKESGNLGVSIEDPIETLLGGK
FT                   HGDGRCIQLEVSDNEGYPLAIKRALRMGANNILIGEIRDAQTAHEVMKASLNGAFIVAT
FT                   IHANNCIDAIERYSIFCNEINSKANSIIAKSLFIVTNQVLMPSIYESNIRGYTCTVNGY
FT                   DIRASTTIQAKIRDGNFQTLKDEFDSINQKQMRHSL"
FT   gene            26005..27261
FT                   /locus_tag="YpsIP31758_A0001"
FT   CDS_pept        26005..27261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0001"
FT                   /product="bacterial shufflon protein, N-terminal constant
FT                   region"
FT                   /note="identified by match to protein family HMM PF04917"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45579"
FT                   /db_xref="InterPro:IPR007001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT70"
FT                   /protein_id="ABS45579.1"
FT                   /translation="MKKFKKGLAAISGQTIALIAGLIVLATITVPAVNLLQRDQSYSVA
FT                   ASHANRVEKAVNKYILEQSAIVGAGSTASSPYTIDVPLLISKGYLPSGFAAQNNFSSTY
FT                   KTLVFQPSTQKFHSMTFLDGGTQLSMSAARKFATRIGDSGGVIENGVANGVQGLWSENL
FT                   SAFGGFNPGDGHVVIAGFFSNGSVVNEYLYRKAVPGHPELNTMSTALNMGANDINAVRD
FT                   LNAAGNAVVQGNITAGNTVTATGTVKAATTDTSGETYTGGWFRTRGDTGWYSEKWGGGW
FT                   HMTDGTWLRAYGGKSIYTAGIVQAATFQPGQVSVVNTACPESGRISRDATGAILSCQSG
FT                   VWATSGKVVVINGYNPTCPANKIPVARYWTQAGGSNYGDYCSLQTGWAGVTTPSCESCA
FT                   NWEKCHMVYSQTWSATACS"
FT   gene            27495..27896
FT                   /locus_tag="YpsIP31758_A0002"
FT   CDS_pept        27495..27896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0002"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45577"
FT                   /db_xref="GOA:A0A0U1QT68"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT68"
FT                   /protein_id="ABS45577.1"
FT                   /translation="MKYKSLPKELELIEYSISNVNLGERKENIENGFKQLLLACDGKGD
FT                   SDFYGEAVKLKCLLIKQRNTLRISGCEEDSLHNLTAAIEFIKDLSWSYFRTTLQAESIA
FT                   DTISLYFGPCLFALVITTFSFGAYILITR"
FT   gene            27901..28332
FT                   /locus_tag="YpsIP31758_A0003"
FT   CDS_pept        27901..28332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0003"
FT                   /product="type IV pilus biogenesis protein PilM"
FT                   /note="identified by similarity to GB:BAB12660.1"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45625"
FT                   /db_xref="GOA:A0A0U1QTB6"
FT                   /db_xref="InterPro:IPR009987"
FT                   /db_xref="InterPro:IPR041883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB6"
FT                   /protein_id="ABS45625.1"
FT                   /translation="MLGTNTMMVILFIFIGAISYRAVNENNRQATVIAYDQAAATTFFL
FT                   YVEQLDGFLSANPTFTGSVTTQIQFPAWLNENKDIMMYVENGRGYVYMSAKSNVYDSLV
FT                   SRTENSSMIGLTDSNSIITNLGPIPKPSVIPQNYIVYMI"
FT   gene            28344..28967
FT                   /locus_tag="YpsIP31758_A0004"
FT   CDS_pept        28344..28967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0004"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45611"
FT                   /db_xref="GOA:A0A0U1QTA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA2"
FT                   /protein_id="ABS45611.1"
FT                   /translation="MANILFFLVSIITTTAIAYLLPAIVSRAEQEVLSQYDEVKLASQY
FT                   RTAVEPLLALFLACVAPVFYAVQSDITLSVFIGLLALVSYIDIMRQWVPDILIHLLSWY
FT                   SLSCLALGFITSDVLYSLLSLLLLLLPFLAINAYSWIKNRSYIYASGDIYILLSVGLWL
FT                   DYRFALSAAALSILSASIYAKIAGKEKVPFVPFILFSLLVFSTI"
FT   gene            28986..29492
FT                   /locus_tag="YpsIP31758_A0005"
FT   CDS_pept        28986..29492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0005"
FT                   /product="transglycosylase SLT domain"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45590"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT81"
FT                   /protein_id="ABS45590.1"
FT                   /translation="MKDIAQGFILILTLLVPLSSYAYCFQAAGDTYQIDPLLLISIADV
FT                   ESSMNYKAIGQNKKNGVVKSEDLGLMQINTSWLPKLGKSFGITREHLLNNPCQNVYVGA
FT                   YVLANNISSNGVNWESIGAYNAGFKSANEEFRLRYAKKVYSKYINLLRGNRAIIIAKAS
FT                   RGERV"
FT   gene            29517..30002
FT                   /locus_tag="YpsIP31758_A0006"
FT   CDS_pept        29517..30002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45616"
FT                   /db_xref="GOA:A0A0U1QTA7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA7"
FT                   /protein_id="ABS45616.1"
FT                   /translation="MSINNKDIELLKLILINRDKDIVKMKINIRNHEKIRGNIKISLAA
FT                   FIIIFIGGFIVEFKGFTLFILIALGASIPIHLYQLKKHTTSPEALNISSLNDEMIANIS
FT                   KSGSKELKDELHKLVVAHGYITYSGISGILNENNKEENKQRLSELINNVGSQVILKP"
FT   gene            30036..30335
FT                   /locus_tag="YpsIP31758_A0007"
FT   CDS_pept        30036..30335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0007"
FT                   /product="hypothetical protein"
FT                   /note="possibly involved in plasmid conjugation"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45609"
FT                   /db_xref="InterPro:IPR009989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA0"
FT                   /protein_id="ABS45609.1"
FT                   /translation="MKKIVILLLSLAICFSSLPAKAADACEVVICMYGKVTGNSQKECS
FT                   GAEGDFFGLNGFKKKGRFDPTKTAEMRQSFLEQCSTADPAKVSQIISVFGRIRG"
FT   gene            30468..30716
FT                   /locus_tag="YpsIP31758_A0008"
FT   CDS_pept        30468..30716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0008"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein from Yersinia
FT                   pseudotuberculosis IP 32953, GenBank Accession Number
FT                   BX936400.1"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA3"
FT                   /protein_id="ABS45612.1"
FT                   /translation="MGQLTIRTTPEQEALIAKVQALSGEKTASKTLIAALYEFEPNRAK
FT                   IRELQKKIEALENDFDNLKSVVVNYQNSQKALLNINI"
FT   gene            30797..31144
FT                   /locus_tag="YpsIP31758_A0009"
FT   CDS_pept        30797..31144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0009"
FT                   /product="single-strand binding protein family protein"
FT                   /note="identified by match to protein family HMM PF00436"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45574"
FT                   /db_xref="GOA:A0A0U1QT65"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT65"
FT                   /protein_id="ABS45574.1"
FT                   /translation="MQQNNIFVGNLAAPLEMKGENDKLICKFTLIANEYIGKDLSTNES
FT                   KYREVSIRFTGFGKVATRLEKALLVGDQVIASFSISNNNYEREGKMVYGHNFIVQDFQL
FT                   GAPGKARKERT"
FT   gene            complement(32134..32799)
FT                   /locus_tag="YpsIP31758_A0010"
FT   CDS_pept        complement(32134..32799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0010"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein from Yersinia pestis
FT                   pG8786 plasmid, GenBank Accession Number AJ698720.1"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45601"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT92"
FT                   /protein_id="ABS45601.1"
FT                   /translation="MSAAEVFKAHCPTCDGVRNCQVHGKIEKNYEIDNDNGYMSVQSEH
FT                   KLLECMGCESIFYHEILTSNEGIDYDNCPHGNTVLNPMESTVTFPSPRQQAVRPEWLFG
FT                   LLTIDRQLYNIFCEVYSACEHKLYISASIGLRTILDRITEILEIYPTLSLEEKMEKLQE
FT                   EGLIVAVEKQQLLIVTNAENAVTHGSWSPNEATFISLLLIVEDITRRMLLNDDNISKA"
FT   gene            complement(32812..32982)
FT                   /locus_tag="YpsIP31758_A0011"
FT   CDS_pept        complement(32812..32982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0011"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45608"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT99"
FT                   /protein_id="ABS45608.1"
FT                   /translation="MIKIETPEQHEAQLMRLEQLMKLNPALNTPEDVEIEKLAGAIEAY
FT                   ENIHYPINDKI"
FT   gene            33378..33923
FT                   /locus_tag="YpsIP31758_A0012"
FT   CDS_pept        33378..33923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45630"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTC1"
FT                   /protein_id="ABS45630.1"
FT                   /translation="MFICDEKKNLSVSNTKYINLAFKETEFVADNDYMKNQAELLASRF
FT                   TDETSRTDIIMYVIDVIECAEKNNFDVTDMLRVFHFLADRFGFGYQVNTFGTEQQVTAY
FT                   KYASSCYNEIVVVPISRIKYVKQHDRVIKKNGLSLCRVSIVTTDNEEFKLHIDDQIISS
FT                   LKCDVILKCAVKFIDQAL"
FT   gene            34385..34684
FT                   /locus_tag="YpsIP31758_A0013"
FT   CDS_pept        34385..34684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT84"
FT                   /protein_id="ABS45593.1"
FT                   /translation="MMQKNEPYDLAIAFILENERTCNLSDSDPEKTDKNECFLFVAGYI
FT                   KALSDFKLINKEQSIDLRNKMGYFGSIPSVFLVAKPTDLEGRYGDIFRQNPIID"
FT   gene            35038..35337
FT                   /locus_tag="YpsIP31758_A0014"
FT   CDS_pept        35038..35337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT63"
FT                   /protein_id="ABS45572.1"
FT                   /translation="MKIENPPESYITNLKSIPAFDDWLWMINKNDRLPRGQYFKARQYA
FT                   KELLMPSKNQVFEVFDLRTVRAFTPPITISQRRDDFYEGNMLKVLDSQSGKKHD"
FT   gene            35377..35859
FT                   /locus_tag="YpsIP31758_A0015"
FT   CDS_pept        35377..35859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0015"
FT                   /product="type IV pilus biogenesis protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45607"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT98"
FT                   /protein_id="ABS45607.1"
FT                   /translation="MACRIYQRGLMKRKYVNLKNILLFGAVLSSIFCLSAYAKDLNCIT
FT                   RAEADYDVPAGLLNVMAAYEAKRNQPVANKLYGPMQLHSVVIPMAAEGIHSTEHEIKYN
FT                   DCQNYRAAAWLLMNSFGGNLYSDIFNAVNNYYYGFGKQSYGVITLKIKDMYQHEKR"
FT   gene            complement(36026..36691)
FT                   /locus_tag="YpsIP31758_A0016"
FT   CDS_pept        complement(36026..36691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0016"
FT                   /product="surface exclusion protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45621"
FT                   /db_xref="GOA:A0A0U1QTB2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB2"
FT                   /protein_id="ABS45621.1"
FT                   /translation="MFNTKNKILKSTIVLIAAIVIAKGWFSILIYSSYWAAVNGFGNYH
FT                   LLISHMAGMIFILAVLVPYHRWVSPLGFGKVLQKSSLLPILAVVLVYFAEYSYGKLTGA
FT                   APEKFVQNLLNQPFAQLSGVFLTILLVAPFNEEIVFRGVILNVFRSSHAWTMWLGAVII
FT                   ALLFSLIHNQYENISTFVLITSMSIIFTWARMRSGGLLLPVLLHSLASIMAVTFTWLG"
FT   gene            complement(36756..37538)
FT                   /locus_tag="YpsIP31758_A0017"
FT   CDS_pept        complement(36756..37538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45610"
FT                   /db_xref="InterPro:IPR041519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA1"
FT                   /protein_id="ABS45610.1"
FT                   /translation="MSSTKQWFEDEEENRREAWIRARLSDPDLGNDSDEWQELEEEYDN
FT                   YKDFMEDMAREEYEEQQWLKNNPHTDIYVSSISLLDEILDEGKEHTSETFYKMQIAYCV
FT                   TIMESCLGDMIKSIVLSDNRYRNYAVYQIEHLRKKEINLVYLIDKEDVVGKSVQEYLTG
FT                   ITYHDIPIVERTYRAILQIKKYKNIDTTKIDVLTTLRNDIVHRNGKTREGNDSIKFDYN
FT                   AVLEAFDTTKIFLTEMKDMISEAIKYHEEKQMNKDLEN"
FT   gene            complement(37549..38265)
FT                   /locus_tag="YpsIP31758_A0018"
FT   CDS_pept        complement(37549..38265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45617"
FT                   /db_xref="GOA:A0A0U1QTA8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA8"
FT                   /protein_id="ABS45617.1"
FT                   /translation="MTGIFISSGMTMLHWLNTHIGTDWATYQGWGISIIGLGISVIGII
FT                   GAPKIIKKYKLRQTNKNNNGNINQAGRDLNITTINHISHAKTESGIEEKKKAHDLNIIE
FT                   EILTLLPYEATLNEAEQSSIVGMTYQFARNLDEAGKYRDENYRLYNYAVNEVKDNFIIA
FT                   ITAFYNSLTPFLTVDHPEREPLRLDLPYDWRNNPKSEKTYRKYQSEMCETSAVMIENYK
FT                   LFIKTIKENDFITDTI"
FT   gene            38579..39370
FT                   /locus_tag="YpsIP31758_A0019"
FT   CDS_pept        38579..39370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0019"
FT                   /product="putative integrase/resolvase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45598"
FT                   /db_xref="GOA:A0A0U1QT89"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT89"
FT                   /protein_id="ABS45598.1"
FT                   /translation="MQIADNEMSSIIPHDLGQISRSAIRAPAPLFSYGHALALREKVLA
FT                   SGDAELPLYLLAPEVTVLLSYLPDLRQRLLIETLWNTGARLNEALALTPACFHIEGDSP
FT                   FVVLKTLKQRQKGRGRPKEGQTLKRIVPLLDENYVRLVHEYLATFRPKKYAPLWVNEHG
FT                   DTISDETPRTWLRAAVTRANRDSVTFSLPVITPKTFRHSFAMHLVQSGVAFKVVQTFMG
FT                   HKDAASTEVYTRIFALDVGAQYGVKFSMAAADAMALVRRRS"
FT   gene            39534..39689
FT                   /locus_tag="YpsIP31758_A0021"
FT   CDS_pept        39534..39689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45596"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT87"
FT                   /protein_id="ABS45596.1"
FT                   /translation="MKLAPQLANTDCQHNTILVLLRMLKNAINNSYKSPEKPGLILPIY
FT                   RQLTAH"
FT   gene            complement(39675..42635)
FT                   /locus_tag="YpsIP31758_A0020"
FT   CDS_pept        complement(39675..42635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0020"
FT                   /product="DNA primase TraC"
FT                   /note="identified by similarity to SP:P27189; match to
FT                   protein family HMM PF01751"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45587"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT78"
FT                   /protein_id="ABS45587.1"
FT                   /translation="MADTLKKPFHEQVAEKLIEQLKQGTAPWQRPWKAGSSGFLPINPT
FT                   SGKRYKGINAIQLISQGHSDRRWMTYKQATQAGAHVRQGEKGTSIQYWKFTEEQDKLDQ
FT                   LGKPVLDKDGQPIKVIVQLERPRVFFASVFNAEQIDGLPPLPPKEEKEDLWKAIEQAEK
FT                   ILENSGALISHQEGDRAFYRLSTDSIQLPSKEQFSSADKYYATALHELGHWTGHQQRLD
FT                   RDLGHPFGSDMYAKEELRAEIASMIMGDELGIGHDPEQHVAYVGSWIKALQNDPLEIFR
FT                   AAADAEKIQEYIFGLSLIQEQQKEQTQEQHQGITITLGQEETYLLPSQWTGNTQVRGCV
FT                   ELLDENGELSVVEASAENREPEFFGIYAENEEGLHLWVADCETEELANSIAAELKKHYQ
FT                   LGKEDYMEQHLHDLPGYSVIRKDGDIRDTDIYVNADDWCQSKNESMLENQQDDQVPHLL
FT                   DIPEEGVKYLIDDDDYRIIFESELKQFNQPIKKESKDIKQEKTFIKVPFAEKDEAKDLG
FT                   AKWDRQKQSWYVPAGIDVNPFEKWSVSQEQAITGNPREIPQNANWPQNMYPPSSFPSNP
FT                   ESAEKTEESKVYLAVPFGEHKEAKSFGALWDKTAKSWYIGPNADTEKLGKWKLENITNE
FT                   QSPALSLHEEFSNALISMGCIVSGKHPIMDGTEQRIAVEGDKNKETAGFYIAHSNGHPA
FT                   GYIKNNRSGIELKWKSKGYTLDPEQKAAMQAEAATNLAARATERNKAQEQAANRVVSQL
FT                   KKLTVITTPTPYLAKKGIQPAEGVFTDKEGQKTYIPAIDENGKQWSMQYISEDGTKRFA
FT                   KGSKKEGCFHPIGGLDALASAPILIIGEGYATAKTLAETLNFCTVAAFDAGNLKAVAIA
FT                   LHAKFPDKPIIIAGDDDQAEELARGRNPGKVFAKEAAQAVGGKEVFPIFAPGEQAGNPK
FT                   AFSDFNDLSVNSELGKRGVERQIKCVVESLTQQVTKQKSQVRQVKKAQKETHSMSR"
FT   gene            complement(42628..42861)
FT                   /locus_tag="YpsIP31758_A0022"
FT   CDS_pept        complement(42628..42861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0022"
FT                   /product="putative conjugal transfer protein TraD"
FT                   /note="identified by similarity to SP:P27193"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45589"
FT                   /db_xref="InterPro:IPR016703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT80"
FT                   /protein_id="ABS45589.1"
FT                   /translation="MNQKTNYPDVAVFNNEKDSSSVLNEKLNDAYTPGFQADFDPEEAV
FT                   EVGAFVEDALSEGDATESVVDLIDSDKGNKHG"
FT   gene            complement(42867..44906)
FT                   /locus_tag="YpsIP31758_A0023"
FT   CDS_pept        complement(42867..44906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0023"
FT                   /product="DNA topoisomerase III"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01396; match to protein
FT                   family HMM PF01751; match to protein family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45591"
FT                   /db_xref="GOA:A0A0U1QT82"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT82"
FT                   /protein_id="ABS45591.1"
FT                   /translation="MSDIKRLFIAEKPNVARAIAAELGITGKGNGYIKCGSDTITWCFG
FT                   HMFEQAEPDEYTPDDVPRTPKGNKIWRENELPIIPEEWIIKPREDAESQLKVISGFLKE
FT                   ADLIVNAGDPDREGQLLVDELLEYYNCNLPVKRYWVSSQDSVAVKRGLADLKDNKQFYG
FT                   YGVAALARGRCDWLIGMNLSRAYTLRAKRGGYAVLLSVGRVQTPVLSLVVGRDREIEAF
FT                   KPIPFYKIKAAVKCNDSAFVTDWIAKEDQEGLDSEGRLVDRNIASKLADKLNEKTGEIK
FT                   EYKKTPQKKLHPFGFSLSSLTVVASNKFGYSSADVLEICQSLYETHKLTSYPRSDCKFL
FT                   PETQFADAHAVLSAIKHVNPDKADLVDAVDIKIKSRIWNDNEVSAHHAIIPTMHMGSAD
FT                   RLNVKEKNIYDLIVRSYLAQFYPVHEFLKTTVSIDIDTETFKAEGNTVTHAGWKSIYTE
FT                   SEEDDEKNAVQTFVVMKKGDTVTCLKSSLVDSKTKAPPRFNDGSLIAAMENIHKYVPDS
FT                   ELKKLLRDGDGIGTVATRPFIIEELKNKGYLELKGKQLISTTLGRSIIDIYPEVMKSAV
FT                   LTALNERVFIDIQKEPSGIDDFLEKQIKFITDQVEKAGNGVAKVSGAKQVAKISTIHKC
FT                   KSCGKGLVHRTGKKGLWWSCSGYPECNQSYPDAKGKPNYTKGKE"
FT   gene            complement(44942..45466)
FT                   /locus_tag="YpsIP31758_A0024"
FT   CDS_pept        complement(44942..45466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0024"
FT                   /product="conjugal transfer protein TraF"
FT                   /note="identified by match to protein family HMM TIGR02771"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45627"
FT                   /db_xref="GOA:A0A0U1QTB8"
FT                   /db_xref="InterPro:IPR014139"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB8"
FT                   /protein_id="ABS45627.1"
FT                   /translation="MKQSHSLAFVVSGIALISTIIYISGIRVNTSESIPVGLYLMTPSP
FT                   ISKGEYVVFCPPPTSDFDKARSRGYINSGFCSGNYGYMMKRILAAKGDVVSINSNGVIV
FT                   NNIKIPYSKPLSVDLSGNPLPSINILNHTLQESELLLMTDQSNSSFDSRYFGFIDKQQI
FT                   HSVIRPILSWK"
FT   gene            complement(45463..47400)
FT                   /locus_tag="YpsIP31758_A0025"
FT   CDS_pept        complement(45463..47400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0025"
FT                   /product="conjugal transfer protein TraG"
FT                   /note="identified by similarity to SP:Q00185; match to
FT                   protein family HMM PF02534"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45571"
FT                   /db_xref="GOA:A0A0U1QT62"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT62"
FT                   /protein_id="ABS45571.1"
FT                   /translation="MTTKSNSAVGPQTKASRTKKSKLVPMLAITSLAAGVQAATQYFAY
FT                   AFNYQSVLGSNLNQIYPPWAIYTWWDKWHDIYPTYFTTAGSVGTMVGAAGLIGCALIKM
FT                   ISSHSSKANEHLHGSARYAEKKDILEAGLLGNNEGVYVGAWEDDKGKLHYLRHNGPEHI
FT                   LTYAPTRSGKGVGLVVPTLLSWPHSAVITDLKGELWAMTAGWRKEYAKNKTIRFEPATL
FT                   NGSARWNPLDEIRIATEYEVGDVQNLSTLIVDPDGKGLNDHWQKTSQALIVGLILHALY
FT                   KAKEEGTPATLPYIDRMLSDPNKDIAELWMEMSQYGHVNGENHPVVGSSARDMMDRPDD
FT                   EAGSVLSSAKSYLSLYRDPVVARNVSSSDFCIKDLMNHDDPVSLYIVTQPNDKARLRPL
FT                   VRVMTNMIFRLLADKMEFERVQQKVPRWRQILAKFGFKQPALSYIRSKKTYKHRLLGMI
FT                   DEFPSLGKLEILQESLAFVAGYGIKLYLICQDINQLKSRETGYGPDETITSNCHVQNAY
FT                   PPNRVETAEHLSKLTGQATVVKEQITTSGRRASAMLGQVSRTIQEVQRPLLTVDECLRM
FT                   PGPKKDAEGQITDAGDMVVYVAGYPTIYGKQPLYFKDPIFTARAAVPEPKFSDKIRGNL
FT                   LLTEGEVIAL"
FT   gene            complement(47397..50018)
FT                   /locus_tag="YpsIP31758_A0026"
FT   CDS_pept        complement(47397..50018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0026"
FT                   /product="conjugal transfer protein TraI"
FT                   /note="identified by match to protein family HMM PF03432"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45618"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTA9"
FT                   /protein_id="ABS45618.1"
FT                   /translation="MIIRHIPMKSVKRSSYSGLTKYITNEQGKQERVGDINITNCNSED
FT                   VDWAINEIQATQKLNTRATGDKTYHLFISFPAGESPSADILKDIEARVCSSIGYGEHQR
FT                   VSAVHHDTDNLHIHISINKIHPSKHTLHEPYRAYSTFGDIAGKLEIEHGLQQTNHTAKK
FT                   VGAENRAHDMEHHAGVESLLSWVKRECLESIRNSKSWGELHQVIQNNGLELRESGNGLI
FT                   ITDQQGIAVKASSVSRDISKGKLEVKLGKFEKPQPQNKRSPKNNIGHSKRPRVGKVGQQ
FT                   PPPRSRHRFHRLGNIDSIDIDNGPRYKKEPIRMKANTTELYAKYKAEQSNVSAIRTAQW
FT                   VAARNKKNRAIEAAKRTGRLKRAAIKLLNGKGVNKKALYSLTSRTVKIDVEKAKAEYLK
FT                   ERKVIYEKCRRQAWADWLKSNATEGNKEALSALRSRESRQKLKGNTVTGKQADKNNSTP
FT                   ISDITPDNITKTGTVIYRVGDSAIRDDGDSLKVSRGASQDGLEAALHMAIKRYGENISV
FT                   NGSDEFKEKIVQAAVKAKLNIKFDDTDLELRRQFVMSQQATKEQTHDSRTDSRTTNRSS
FT                   IRTIATRGTRGASIRKRESGGRNARDIKPYTRSVGRTPPPEKTHNLRNLSELDMVQHTN
FT                   RSEVLLPSYVSSNVEQQGTKSNDGMRWGVRRARGVIHKRRSIDDKSRDIRPQVARVGKA
FT                   PPPNSQNKWRHLSQLNNLELDLKAIRPLVARVGTTPPPLSQNRLRSLSELRKVELAQGV
FT                   KKIQPPVNKSPLADFIPQKVISTLSTGQVAADKYVNEREAKRGKGFDIVKHYRYNDYKG
FT                   GASFAGIRQIDSESLALLKCDDHVIVMPVEAATVRRLKRLSIGDEVIVTEKGVIKTKGR
FT                   SR"
FT   gene            complement(50056..50412)
FT                   /locus_tag="YpsIP31758_A0027"
FT   CDS_pept        complement(50056..50412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0027"
FT                   /product="conjugal transfer protein TraJ"
FT                   /note="identified by similarity to SP:P17909"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT74"
FT                   /protein_id="ABS45583.1"
FT                   /translation="MIDTVGKKITRKHGRHLRVPVLPDEEILIKANAAAAGLSIAEYLR
FT                   RLALGHTIYGVIDQHQVIELSKINADLGRLGGLLKLWLTNDERLVRLDSKAIEVLLCRI
FT                   SDTQSAMFEVVKKL"
FT   gene            complement(50435..50554)
FT                   /locus_tag="YpsIP31758_A0028"
FT   CDS_pept        complement(50435..50554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT86"
FT                   /protein_id="ABS45595.1"
FT                   /translation="MKLANRQAGYLSSLSLIRASGTQWESCSARLAGYRRLSA"
FT   gene            50746..51123
FT                   /locus_tag="YpsIP31758_A0029"
FT   CDS_pept        50746..51123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0029"
FT                   /product="conjugal transfer protein TraK"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45585"
FT                   /db_xref="InterPro:IPR035225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT76"
FT                   /protein_id="ABS45585.1"
FT                   /translation="MAKSLSQRIAERQKLLSPLGRGGANRAEFLAQREDIADALQDGWS
FT                   IKQIWDTLYDEGKITFSYDPFTKYVKNIIRSNKQLPVLSGVQQGQIPEQKPKDAQSQTP
FT                   KSIFSTGLPKFQHNPGADNDN"
FT   gene            51135..51863
FT                   /locus_tag="YpsIP31758_A0030"
FT   CDS_pept        51135..51863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0030"
FT                   /product="conjugal transfer protein TraL"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45600"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT91"
FT                   /protein_id="ABS45600.1"
FT                   /translation="MANIHMVLQGKGGVGKSFISSLIAQYMASSGQLPLCVDTDPVNAS
FT                   FLGYKALKVRRLEIMEGDEVNTRNFDELVEWIAETKVDMVIDNGASSFIPLSSYLVSNA
FT                   VPGLLQEMSHQLIIHSVVTGGQALPETLAGLESLVKWFPDETIFIVWLNPYWGPIIDNG
FT                   KTFEEMPVYEKYKERISAIIHLPELKEETYGKDLTDMLQARLTFDQALKMKDLSIMTRQ
FT                   RLKMIQKLVYNQLDLLAKAS"
FT   gene            51860..52300
FT                   /locus_tag="YpsIP31758_A0031"
FT   CDS_pept        51860..52300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0031"
FT                   /product="putative conjugal transfer protein TraM"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45599"
FT                   /db_xref="GOA:A0A0U1QT90"
FT                   /db_xref="InterPro:IPR028140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT90"
FT                   /protein_id="ABS45599.1"
FT                   /translation="MTDEIDELIKDIALKNGVAIDRDDPIMILQTMQLRFLAGNKKAQV
FT                   EMLDEFKEELEGVASRWGLESKSLAEKILNNSLKASKETMAIQLQESVQATSRAVGSEI
FT                   EIKLACLNEPVQWAKKIAIYNLIASLVTFLTACMIIVFFLFK"
FT   gene            complement(52464..53483)
FT                   /pseudo
FT                   /locus_tag="YpsIP31758_A0032"
FT                   /note="phosphoribosyltransferase, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            53734..54021
FT                   /locus_tag="YpsIP31758_A0033"
FT   CDS_pept        53734..54021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ38110.1"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT72"
FT                   /protein_id="ABS45581.1"
FT                   /translation="MKLSDVATIKTNYPEADFWITRRGSLKTCGQPTYDFNSEHIGIRV
FT                   ERTDILLARYLFYCMENLHKNGNWERLATGSLELVNIRVSDVRAIGLKLR"
FT   gene            54309..54728
FT                   /locus_tag="YpsIP31758_A0034"
FT   CDS_pept        54309..54728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB3"
FT                   /protein_id="ABS45622.1"
FT                   /translation="MNIDLPNIEEQRKMLFADNVEKSCAALRNNLNAPHFSATSGVEVQ
FT                   TYGDKHLRTEQQGWEVPAPELIYAWFEQFKEVFPEYNSDKKLAALLGLHTSGDRRIRSF
FT                   KNGEQKIPYGVWRKFLVLTGRVNQEIIPVMGFFND"
FT   gene            54761..55000
FT                   /locus_tag="YpsIP31758_A0035"
FT   CDS_pept        54761..55000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45623"
FT                   /db_xref="GOA:A0A0U1QTB4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB4"
FT                   /protein_id="ABS45623.1"
FT                   /translation="MNGYELRLWRKGLSWEQERAAEELGVSRRAYQYYEKNGPPMVVIL
FT                   ATRALSLKMMWPEISKTQPLTEELRLISTLVPRV"
FT   gene            complement(55088..55408)
FT                   /locus_tag="YpsIP31758_A0036"
FT   CDS_pept        complement(55088..55408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB7"
FT                   /protein_id="ABS45626.1"
FT                   /translation="MLGRQKQKLVISETDIDTALAHLRALPYGTPFPMRWDRQHLLNLL
FT                   HETIGNRPQINKCHDVAPGVFAIIKPFGADLVSRGEPDGRLQVLLLIRSSGTDPARITT
FT                   LG"
FT   gene            complement(55522..56574)
FT                   /locus_tag="YpsIP31758_A0037"
FT   CDS_pept        complement(55522..56574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0037"
FT                   /product="transcription repressor protein KorB"
FT                   /note="identified by similarity to SP:P07674; match to
FT                   protein family HMM PF02195; match to protein family HMM
FT                   PF06613; match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45584"
FT                   /db_xref="GOA:A0A0U1QT75"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR010575"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037048"
FT                   /db_xref="InterPro:IPR042075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QT75"
FT                   /protein_id="ABS45584.1"
FT                   /translation="MTSKEKKSSLGLDAIGDLSSLLAGKGPSPTSPIDLDMNLIDEDPN
FT                   QPRTEENPGFSIQSLNELAETIRQRGVKTPISVRDNPDSPGRYLINHGARRMRASKIAQ
FT                   KKTIPGFIDNDYNEIDQVIENLQRNELTAREIADFIGRELAKGKKKGVIAKELGVSAAF
FT                   VSQHVTLLDLPDAIAKAFNSGRIKDVTVINELVTAFKKNAKAVTSWLEDEDQEISRGSV
FT                   KLLREFIDNKNDDSNSNISSDTDLVSEDERDIYNSPEFDGSSEDNNGEDNTDNGGDDSD
FT                   ESNSKKSKSEDKSKLKKSFVEVIVDERAARIMLDRRPSLKGLAWFKCEDNGEEFEAELS
FT                   SVTLVAIIEG"
FT   gene            complement(56571..57656)
FT                   /locus_tag="YpsIP31758_A0038"
FT   CDS_pept        complement(56571..57656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0038"
FT                   /product="plasmid partition protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45620"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTB1"
FT                   /protein_id="ABS45620.1"
FT                   /translation="MGNVHEKTALESRVPGSHKRLGCGPTNHRYSKWCLGRGDAASNVC
FT                   SDVRAFPRGCISSSESCLDSTSGEKSAGGIREGYSDTSGTKSIHSQEMGRGNSKKTGWQ
FT                   KMKTLVVAQQKGGVGKTSTLVHIAYDFFERGLKVAVIDLDTQGNASFTLKEYESGYLAS
FT                   QMFEESTKDFHSVFSQLPDGPLLSLIKSDPVLANMESKPVADVVANFKAKIAALSDCGF
FT                   DVVLIDTAPSLGVSLATALYASDYVVSPIELEAYSIQGIGKMVTTIINVRQFNPSLNFL
FT                   GMVPSKVDGRNPRHGQHLAELKEAYPQLMIPAAIGLRSSIADALATGVPVWKIKKTAAR
FT                   KAAKEVRELAKYIFEKMEIAE"
FT   gene            complement(57838..58155)
FT                   /locus_tag="YpsIP31758_A0040"
FT   CDS_pept        complement(57838..58155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YpsIP31758_A0040"
FT                   /product="putative stable inheritance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YpsIP31758_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABS45631"
FT                   /db_xref="GOA:A0A0U1QTC2"
FT                   /db_xref="InterPro:IPR035362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1QTC2"
FT                   /protein_id="ABS45631.1"
FT                   /translation="MSNIYKFPATEQTDKNTTPINNVLAKKQNSFVDSIVKIIWLLTVI
FT                   CWPVARWILAIDVAFQFSRMLWHWNTQGTYAGWTFLIHFSVLVVLTFFVNNFKPKKMKT
FT                   R"
XX
SQ   Sequence 58679 BP; 17473 A; 11857 C; 11746 G; 17603 T; 0 other;
     tacagtaatt aaagcaatga ttttgtttaa tggtcgaaga caaaagatag ttacagcgac        60
     gaaatactga gttcataaat aatttgctgg cttttattta ttgcctggag cgtagcgaaa       120
     ggaggtacca atatctttta gagctattgc tgatggctgt tattaagttt gattacagct       180
     acgtgatgtt tatgcccgta gcaaagcgga gggaggtact ttagagctga ggtacgaaag       240
     ctctgtgctt tctacctcct gttaaggaca tgtttagtta tggattaacg ttcgaaatta       300
     actatatatg aaggacatag ttcgaagtta attgattaaa agtcgcccat tagcgaattt       360
     ttggccaaat gtctgcattt ttagaggcaa ccaacctctt tcttgcctca ttatgatttg       420
     ttagatcgcc taaattggct gaatttgctt atacgagcca gcagaagcac cgcgaaatat       480
     cgcggtcact atgtatagga aggggaggtt tgtggctctc agatggctcc agctcgttct       540
     aacaggagtt tatagtatgc ctctcctctg agatctggat attccttttc tattgcccat       600
     ttcattctat aaatgtcaga tctaggcata gactcagccc acctctggta tgcagtttca       660
     tacggtgtta aagatgcttt ctttattttt ttaggcgctt tagccagttt atcaaggtat       720
     tggccaatat cgacaacagc cgcttttttc tcatcttgta aatcagcact aacaacctga       780
     cgtttaattt tacgtaatag attttttagt gagtgccgtc tttcaatatc gatacccaat       840
     ctagccatac gcaataaatg tctttgatac ttcttcttga ggctttcact caagccattt       900
     tttatggccc attgccggta tttatttaat aactcccgaa cctcatccat ctggaaaccc       960
     cgagacaaga agaactgtgg ggttaaccac attctgatcg gcttgtattg gccaacatca      1020
     ggatcaattt cacggtgaac aacacaataa ttcaattgtt caatgaccga taaagcattg      1080
     agtaaaatat cgtaagcctt acggccatcc tcataaacat gtaacacccc catgctccga      1140
     gccaaatcct caatagagca catcacttca aaagggtact cagccgtagg gtcatagtta      1200
     cagtttgcag ccaatgcaag tgatagagct gttaatgctt ctctgcattc gcttcttggc      1260
     gttatgcgca taggcttagg aacgaaatta gggtcagttc gtttcttaaa tggggtatag      1320
     cccgattttc ggagttcgca taatgcctga ttgcgcttcc aatcatgatt acgcatacgt      1380
     gcgactactt gaccagcagc tccccgaggc actgagtcat taaatgcggg tatatagcgt      1440
     cgatgaatct tagatacccc tttacgaaga gcattagctt ctccgcgccg agttttctct      1500
     tgtgtatgaa taaattgtgc atcgttaaag atgcttggtg aattctgtct atgcacctaa      1560
     tcctgtgctt atggcagaat ggggttgttt tagagcaaac atgcgttata atccttcata      1620
     ggtttatacc taacccctcg atgtctagtc accttccgcc aagttgatag ctagaaatcg      1680
     gggggtttgc cttttctgga gactgatgat actcattttg tctccaactt actatcgcta      1740
     tatccgttgt gatcgtatcc gttgattaat ttttagccgt gaaattcttt taaaaacaac      1800
     gtttgattca ttttcataca atcactgtag tgcttttaaa actctggcag ataccccgct      1860
     tcaaactgat gttttacagc taagatagtg gttagttggc catcatatcg gtataacact      1920
     acatatccac ttacaccgaa cggcactaac aactctctgc aatacacatt tataaactca      1980
     gcgggtcgtc caatttcagg aaatgcctca attttagtag tttcatctaa aattactttt      2040
     gctgcttttc ttgcagcttc tacattcttc tctgctaaaa atttatagag gcgatctaca      2100
     tcttgtatcg cctcctgagt ccaaatcaga cgtggcactt aggaggttcc ttataatgcc      2160
     cctccgacaa actggtgagc cattcattgg cctcttcaga tgaaacatgc aagccagttt      2220
     cttggaagga tagccaagct ttatgagcgg cctcttttaa ctcttctctt ttctcttcat      2280
     gttcaacata cttcttgata gcatctgtaa ctagccagtg catagtacgt tcacggcttt      2340
     cacccaaacg ttccatacga gccttaatag ttggctcaat cttgactgat acaggtgtat      2400
     tggaagaggt cttcatagta tgtcctcctt atcgctcgat ggactcttgt actatagact      2460
     acttaaaact attttcaact accatcagat cgcaaactga tcgaatggat cgagttaagg      2520
     atctgggtct gctatcaatt ccttgcattt cttactcgta cctgcctccg aattgacagc      2580
     ataatagcgc tttttcattc ggaactctcg ctaaaaacca tcaaaataat gatcccataa      2640
     aattacaaaa aacagatcaa gatctacatt ttgatctatt gcgtccacat ttgctcttgg      2700
     atttacggag tttacgccaa aggaaaagct ttaaggggtt gcgccggaac cgccttaaga      2760
     ggaaatgctg gcatttctgc gacctactgt gaacatcgag acacagtaat gctggcagtt      2820
     ggagcctctt catctgatta cctggtgtta aattgcttgc aaacgttacc acatgcaatt      2880
     gctatcataa ttgcggccgg cgccgcagtt ggccaacacc gattgccagc agaacatgac      2940
     tcaggttagt ctccggacga aacgaaatac tgtcagaaag tgggatttag gctgcaatag      3000
     gtatcatgat ggggttgtac accggaaccg ccgaaatttc cggcgtcatt ggcttcggat      3060
     catgttttac taatcaaagt atcctctcct atagccccgc cgtagcggga cgatttggta      3120
     tctaaagacc aagctttttc tttgtatatt ctatatctat ataatgagtc caatttgcct      3180
     tgtaaaattc aatcgcggct tcttccaatg tgatcaaacc agcttcgaat tctattttta      3240
     ctgattcatg aaagccaggt atatcaaacg ctttttttct acgactcata taattatctc      3300
     gttgtttgtt taacttgaga taattataac acttgtgtta tataactcaa gtgttatata      3360
     tgacttttaa agattttcgt tttgctcgtc agcatgatcc aatcgccatt atctaatctc      3420
     gcaacctcat agccctttga aactagatta ttaaactgtt gaatcgtctt aattcccgct      3480
     gctttcgctg ctttttctcg attaccttca tagtaatcat tcaccatttg gacaatagaa      3540
     atacgcataa ttacctcttg taaataacat ttagagtata taactgttgt gttatatatc      3600
     aagtcataaa accactccaa tgggagcgat aggtataatg atttatgcat agcacctttc      3660
     tctggcgtaa aacgttttga acctggattt tgctcgccac tctcactcta aaaactgtgt      3720
     ttgttatccc tgacttttct ctaagttagg gtagttattg gtagaaataa ggtagaggac      3780
     atttagctgc tctggaaagc aggctacatg cgggttacaa aatacagagc gcgacgcaat      3840
     tacgaacttt ttagccttat ttcaatcgat ttttcaataa aaaagctcac aggagtgagc      3900
     taattcataa cttattgaac cagacagtta taacgatttt ccatgacttt ttttagggga      3960
     tagtaattta tgcttaccgt cagcgccaaa agcataagaa ataaccgaag actttttaac      4020
     ttcataagtt ctcggggcgc agagagcttt atcatggagt aaatattgtt tggggtttgt      4080
     attaagtcgc tgcattacat gaaagtctgt tataccaaca ataaggccgc tataacattt      4140
     attgtttcca atattcgcgt ctaatatctc tgcatcggga tctagcactt ttaattcagt      4200
     tatcaaacgt tcccgagaag aacatcgctc attgcatatg ctaattaaac attcttttac      4260
     ccaatcagat ataggttctg agtattcaat tatcgaatct ttcttagctg caatcagctg      4320
     agggagtatg ccattctcgc tgttatcata aacctctgcg gtgtcagcct tttcaattgc      4380
     gctgggcaat agctgcatgg ctcgcgcata acgttcaaaa atcttttctt ccggaactgc      4440
     atggccaccg agctgcaccc tgttttcaac gcgaacaaaa ttgatcattg gatcgttggt      4500
     tgtaacgaaa attaaatcaa cgctgaaacc gagtgatctc gcttcatcaa aaagagcaat      4560
     ctttcctggc gtagacatga cggtttcaaa tgcaaaagct tcaccatttt ttaaagcagt      4620
     ttttcgccgt tcttctgcca attttgcagc agccatgtta cgactgttag catcggggat      4680
     atggcctaac tcatttttag aaatatcatc agcgttgata taaagaggcg ggaatttttg      4740
     ggaaagcctt aatccatcag ttacagtgct tttccctgaa ccattcggtc cagccaagac      4800
     taccatccgt agccctggta aattagaatc ttcactcatg cagtatgtac gcgcctcttt      4860
     ttcgcttcaa caacacgacc aggcattaca attttctcaa gcttcccatt aggaaatttg      4920
     cgataccaaa cgccatccac tttgacgggt tcaggtaatc ctctctctcg attttcagca      4980
     gcagctttaa ccactgcgcc agccatcagt gtatttgcgt gttctcttcc tataagttca      5040
     attattgatt tcttcataat tcaacctctt caagtaagga ctatgcttat agtttagtcc      5100
     tttctatatc atttgtccgg tgcaatctta cccaactcaa gctgtctaat cgtttatttg      5160
     ttaatcgata taaggttaag ttaaatctta aaaccgacta gaatcagaat aagtctaagg      5220
     tcatgataat cagtgcatta tatgattgcc attcacttta ctgaccgata ggagtttgaa      5280
     aaccaaggta ctgacgttag atagctgctc gacaataccg atttgttgat tttttgggga      5340
     aatttgtaag ttttccccaa gattttatgc ggatgtattg tattttatct cgtagctgcc      5400
     aatgatcgct aattcaattt ttgtttacgg cgatattaaa aactgcggga taaatgccaa      5460
     tggtaaggtc ttggcttcgg tgtcgcgagt agaaactctt aaaactggaa ttttttagcc      5520
     ttcataaaca atgccacttg cttactgaag aatgagttta gctaaacaat ttccataaat      5580
     caataacttt agcggctaaa attcatgccg aaaccataag gcaacggtaa actgtgtaca      5640
     atcttatctt atttactaac attcttcgca tcttagaaga acgaggaatg acaaaaagtg      5700
     aattacatga agtttcaggt gtatctattt catttttgtc tgatctcacc aatggtaagg      5760
     cgaatccatc gttaaaggtc atggaggcta ttgctgatgc cttagatact ccattaccta      5820
     tccttttgga gtcaaccgat cttgatcaag actctctgga tgcgttagcc ggtggaaaaa      5880
     tgccgaggag tcttcctgaa gggtatgaac gggtatcggc tattgttact gatcatcagg      5940
     cttatatcat aagaaaatgg catgaggccg cacaaaagaa aatcgatacc agaaccagct      6000
     aaacgatagc aaattcaata tgtaccagct aaagcctcca atagggaggc ttttttatta      6060
     tcataaaaca aacaaaatat ccgttgttct tgcgccagca aaattttcgt tatatcgtat      6120
     atggcaccta attatgctat caaacgagaa ttccggcatc atgcaaccta acgttgaaga      6180
     aacatcaata ggctccagag caaaagaaaa gctgcgtaga gacttagggc cactcatcat      6240
     tgatgctctc gaagataaga tgaccgccga aattatgctc aatcctgatg gcaaattatg      6300
     gattgaaaca tttggtaagc ccatgcgcca catcggggat ctttctttcg taagagctga      6360
     agccattata aaaactatcg ctggttatca cggtaaagag ataaccactc taaaaccaac      6420
     gcttgagggt gaactgccta ttgacggttc acgttttgca ggacaactcc caccagtagt      6480
     tagcggccca acttttgcta tacgcagaaa agcagtatca atcttcactc ttactcaata      6540
     tgtagaaagc aacgtaatga cagcgcatca aagcgaagtc attagaaatg cgatcagaga      6600
     ccatcgaaat attttggtta ttggtggcac cggctccggt aaaaccacac ttgtaaacgc      6660
     cattatcaat gaaatggtcg tattcgatcc cagcgaacga gttttcatca ttgaagacac      6720
     cggagaaatc cagtgtgccg ctgaaaattg tgttcaatat cactcaaccc tagaagtcac      6780
     gatgacgatg ttactaaaaa ccacattacg tatgcggcca gaccgcattc tggtaggtga      6840
     ggttcgcggt gcagaagcat tagatcttct cgatgcttgg aatactggcc atgaaggagg      6900
     agcagcaacc ctacatgcaa acaatgcgtt aagtggttta acccgattga aatctcttat      6960
     ctctcgtaat tcgtcagcac cagcggaaat agaacccctt attgcagagg cggttcacat      7020
     aataattcat ataagtcgta ctccagaagg tcgccgcata caggaagttg ttgaagtttc      7080
     aggttatgtg gacggcaaat atattactcg caatctttga ggagaagtac aaatgcagat      7140
     gaccatgccg agtatcaaca ttagtaacaa aacaatgctt ttgttaggca ttgctttgct      7200
     gctgatgtta tctacacatc cggcattagc atcgaatacg agtggaggag ggctaccatt      7260
     tgatgaatgg ttcaccaaaa ttcgtcagtc tgtaaccggc ccgttcgcat ttacagctgc      7320
     aatagttgga ttagtagcaa ccggtgccac cctcattttt ggaggggata tgaatggctt      7380
     tatgaaaact ttgattttta ttgttcttgt aatgtccttc ttagtagccg ctcaaaatac      7440
     actggcggca atcacaggcc aaggtgccca aatcgctatg acatttaaat tcatggaagc      7500
     ggggtctata taacaatggc cttacgcacg atccccattc gtaaatccgg taatcgacat      7560
     aacctcttca tggatgggga tcgtgaaatg gttatgtttt ctggtttgtt ggccgccata      7620
     ttgatatttg ctgctcaaga ttggcgagct ttctttgctg gtgtggttct ctggtttagt      7680
     gctctttggc tattaagact aatggcaaaa tcagacccca aaatgcgaca aatttatatg      7740
     cgccagcgcc tctataaaaa atattatcct gcaagatcaa ctccgtttcg aatcaataca      7800
     gaagcgcaag gaaagcaata caatgattga atatattcct atagcctatg gaatattagg      7860
     atttttattg gttctaatcc tattttcctt aatacgcgct gcaaataacg agatcagctt      7920
     aaaaaaattt cggtcaaaag atgctggggt atccgattta cttaactatg cagctgttgt      7980
     agcagatggc gtaatcgtgg gtaaaaatgg ctcctttatg tccgcatggt tatataaagg      8040
     tgatgataat gcgagtagca ctgacgccca acgggagcta atttcatttc gtatcaatca      8100
     agcatttgcc aaaatgggtt ctggctggat ggtacatata gatgccgttc gtcgccctgc      8160
     gccaaattac agtgagacag gagcatcaca cttcagagat ccaatatcag cggcagttga      8220
     tgaagaacgt cgtcaatact ttgaaagttt agggacgtta tatgaaggct tttttgtctt      8280
     aaccttaacg tggttccctc cattactggc gcaaagaaaa ataatagaat tgatgtttga      8340
     tgatgattca gaaaaacaca gtaaaacatc acaaactcat cacttaatcg agcaattcca      8400
     aacagaaaca aaaaatttcg cagatcgcct ttcttcatca atatccctag ttcaattatg      8460
     tagtgaaaaa gtaatcaatg aagatggcag cgaagttacc catgataatc tactgagttg      8520
     gttgcaattc tgtttaaccg gaattattca acctatatta ttaccaaaca atccaatgta      8580
     tatagatgct ctaattggtg gccaagagct ttatgcgggc gttgttccgc gaataggccg      8640
     caaatttatt caatgtgtgg ccattgaagg tttcccatta aattcttatc caggaatatt      8700
     atcttcattg gctgagttat ctattgaata tcgctggtca acacgattta tatttttaga      8760
     taattttgaa gcggtaagtc atttagaaaa attccgtaaa aaatggaagc aaaaaattca      8820
     tggtttcttt gatcagctat tcaacactgg tcgcggagat gtcaatgaag atgctttaag      8880
     catggttggg gatgcctcag cagccatagc agaaacaaat agtggcatgg ttaatcaagg      8940
     atactacaca aataacatca tcttaatggg ggaagatagg gcgcttgtag aagcttcagc      9000
     acgtcgagtt gaaaaagaga ttcagcgtct agggtttgca tccagaaccg aaacgataaa      9060
     tacaatggac gcattctttg ggtctttacc tggtcatggt gtggaaaatg ttaggcgacc      9120
     tctcatgaac accatgaacg ttgctgatat gattccaacc agcactattt ggactggtga      9180
     aaactacgcc cctagccctc tatatcagcc aaatgctcca gcactcatga gttgtgttac      9240
     aaacggtagc tctcctttta ggttaaatct acacgttcgt gatttaggtc atggttttat      9300
     gtttggccca acgcggtcag ggaaatcaac ccatttatca actattgcca tgcagtttct      9360
     aagatatttt ggctctcgcg tttatagttt tgataaaggg atgtcaatgt atcccacttg      9420
     taaagctgtt gggggaaatc atttcactgt tgctgccaat gatgacaaat tatcttttgc      9480
     tcctttatca atattaaaaa ccaggagtga taaagcgtgg gcaatggaat ggatagatac      9540
     gattctggct ttaaacggag ttataacaac agctgctcag cgcaacgaaa ttgcaaaagc      9600
     aatcgtcaat atggcggaga gtaattctaa aaccatatct gagttttcat tattaattca      9660
     agatgaaggt ataaggaatg cactgaaaca atatacagtt gatggcttga tgggtcattt      9720
     acttgatgct gaggaagatg gattaaccct tgctgacttc ataacatttg aaattgaaga      9780
     tttaatgaac ctaggcgaaa aatttgcgct tccagttctt ctttatttat tcagacgtat      9840
     agaaacatct ttagatggtc gaccaacatt aatcattctt gacgaagcat ggttaatgtt      9900
     aggccatgag gtattccgtg aaaaaattcg tgagtggctt aaaaccctcg caaaattgaa      9960
     ttgcagtgta ttaatggcta ctcaaaacct ttctgacgca agtaattctg gaatattaga     10020
     cgttattgtc gaatctaccg ccacgaaaat ttatcttcct aatgttaacg ccagagaaga     10080
     atctgcggca gctctctata cccgaatggg ccttaaccct cgccaaattg agatcatcgc     10140
     ttcagcggta ccaaaacaag attactactt cgtaagtgag aagggtcgca gattatacaa     10200
     ccttgcatta ggcccgttag cactcgcatt cgtgggaagt acagataaag agtccattgc     10260
     tgcgatcaag gagttagaag cacgatacgg tgatgcttgg gtacatgaat ggttacgaat     10320
     caaaggcatt agccttaatg attatggagt tgcagcatga ttttcaatct gttcaaaaag     10380
     aaagaaaaaa ctttagcggc taaagtttct caaaccgata acccctattt gaatgcacgt     10440
     cgtacgtgga atggtcatgt ttcaggggtt atgtcagcta ttcagatctg gcaggtagtt     10500
     ggcatactgg ctctcctaat tgctttaaca gccgtaggag gaataattaa gattggtagc     10560
     cagtcaaaat ttgttcctct tgtttttcag caagatagta cgggaaatac tctttcagta     10620
     actcgcgctg acaagatacc tgatgcaaaa attgaagact atcggactac agcagctaag     10680
     tttattgaaa acattcggct agttaccgct gattcaagtt tacaaagaaa ggctgtttta     10740
     caaacttatt cttatttgtc cgcgaaagat ccatcaacaa taaaagccaa tgaatacctt     10800
     aatagcagta aagaagccaa tccatttaat cgggcaacta aagaattagt cagtgttgat     10860
     gttaaatcag taatgattat ttcagatgaa tcatggcaag tagattggga ggaaacattg     10920
     aggggaagag atggaactct aaaaggtaaa ccatacatga tgagagccat tgttaattta     10980
     tatcagaatc aaccaacaga tgataatgca gaagttgaag tgttacgtaa tccacacttt     11040
     atctttgttc gtgattttaa ttggtcaaaa ccactttaac taggggctaa aaaatgaaaa     11100
     aaacaattat ctctatatta gcccttagtg ttttggctac accctcatat tctgttcttg     11160
     ctgatgattt agccgaccaa tatttttcaa aagaaactcg gcaattaaca cctcaagaaa     11220
     aagccgcgat tgctattggt gaaaaatggc aaacaggcaa tgctaccagc aaacctgtag     11280
     cggcgactga tggatctatt cggtttattt ttggttccgg acaaattcag attttatgcg     11340
     ctgttcttca agtttgtgat attgcattac aaccaggaga gcaagtcaac agcattaatg     11400
     ctggcgaccc acgctttatt gttgaacctg ctattactgg atctggtgct tctgaacaat     11460
     tacatctgat tgtgaagcca ttagatgttg gcctagacac atcgcttgtc gtcggaacag     11520
     atcgcagaac atatcatttt cgtcttcgtt cttcccgcaa agagtttatg ccgttagttt     11580
     cattcaccta ccccgaagat gctcaagcta aatgggcagc aattcaggcg agagagaaga     11640
     aagagaagac tgataatacc attccacaaa ctggtgaata tcttgggaac ttaaacttca     11700
     attacgatat ttccggatca gctcgttgga agccaacccg agtatataac gatggtacaa     11760
     aaaccattat tgaaatgtcg tctgaaatgc gtcagtccga agcaccaact ctattagttg     11820
     ttagaaaaaa tggaggggtg ttcagtgacc ctgaaacggt aatggttaac tatcgagtac     11880
     aaggaaatcg ttacatagta gacacgattt ttgacaaggc aatgctcgtt gtcggtgtcg     11940
     gctcaagtca agaccgcgta acaattaccc gagggaaata acaatgcgga aaattcttgt     12000
     tctgacttta ttagttttca gtatcgcggg gtgtatatcc tcaccaaacg gcaattatgc     12060
     gagtgcgcca attggcttcg atcaaaaaat ggcagaggac acagttaaac aacttgtttt     12120
     gttatacccg ccagcgcata cccgcttcac tttaaagcag tctcctactg atgcttatgg     12180
     tgcatattta gttaaatctc ttcgccttaa gggttatgcc atagctgagc tatcacacac     12240
     agataagcaa gctgcaagta aaaccgcgtt ctcttcaaac acaaatatga cgttggaata     12300
     catcgttgat tctgtagcca atacaaatct ttatcgtgtc acgataaatg tgggtaaaca     12360
     gacattaagt agggcttacg tctcacagaa cggcagtatc tatccgtcag tatcttgggc     12420
     gaggaaggaa taagactatg gcaaataccg ataatcaaat gtctccatcc aactctcctg     12480
     gttcaatagg aaaaacgggt gttcgtcgag tgaataatct tccactaatt attgttctct     12540
     ctgtgataac aatatttatc gctattattg ctatggttgc agtaaaaagg tctgaccaac     12600
     aaaatcaagc ccctgaaacc ccaaaatcag aaaaaacagt tagcagctct tcaatggccg     12660
     cagatattgt cgctggccat aataacggta ttatcccacc agaacagatt accgccccaa     12720
     ctcaagcatc agaaccaact gagccaacag aaccaacaac agcgattcca gttgcaaaag     12780
     ttgataaccc aaatgaacca ccagtacctc ctcgtaataa cgggagccgc caagatatac     12840
     ctaacgatcc cgatttagac cgtataaaaa tggcaaagct gcaacaattt gaagaagcag     12900
     ttaaagctaa gacaactgtt tctattccaa cacttcgcga taatgcaacc ggcgcagatg     12960
     gggcaacacc gacaagagat caaaccttgg cgcgcttaga agctgttcgg cgtcaaattg     13020
     atcaaacaca aaatgaagac ccaacttcgg cctacaaaaa acgcttacag caattgcaag     13080
     gtaatggcgg gatgagcgga gataacgcga gttctggcgg tgatggcctt gctacatcca     13140
     gtagcaacga tattgaacaa tttgccggta ctggcgtaac agaccgttgg gcattgaata     13200
     caaaagttga agctcctcgt tcaccatttg aaattagagc tggtgcggtt gttcctggcg     13260
     taatgatcag tggcgttaat tctgatttgc ctggtcaaat aatgggccaa gtgacacaag     13320
     atgtatttga tactccaacg ggcaaacatc tattaattcc tcaaggaact cggctgactg     13380
     gctcatacac aagtgatgtc gcttttggtc agtcagcagt aatgattgct tggcaacgta     13440
     tgattttccc tgatggaaag gcgctagata ttgcagcaat gcccggagct gatagtgccg     13500
     gttattccgg cttccgagat caagttaata atcatttatt ccggatattt tcctcagcat     13560
     tcctactctc tggcgttact gcgggggtga cgtatagcca agggagaaat gagaacagca     13620
     atgggaataa tagccctacc gcaagcagcg cattaagtga agcgttaggt caacagtttg     13680
     gccaagtcac cgcccaaatg attgccaaga atttaaacat tgcaccaact ttagaaattc     13740
     gtcctggtta tcgcttcaat attattgtca ttaaagatat gacatttaaa aagccttata     13800
     agccatttga ttactaacct ttgagggatg tgttatgact tttttaaaca accgttcttt     13860
     agccgctaaa attatgttct tggtcgcgct atcaggttcg ccagtaacac aaacatccta     13920
     tgcgggtggt attccggtaa tggatttgac caatttaacg caaaacatca tgactgcgat     13980
     ggaaagtgta gcgcagacac tcaaacagat tgaacagtat aaaactcagc ttcagcaata     14040
     cgagaatatg ctgcaaaaca ctatggctcc ggctgcatgg atatgggatc aagccaacaa     14100
     cacaattaac gacttaatgc gttctgtaga cacattgaat tattacaaac agcaggttgg     14160
     cagtattgat aaatacttgg atcagtatca agacgtcact tggtatcgca actctccatg     14220
     tttcaaaggt aagagctgtt cacctcaaca gatgcaagca attcgcgaca ctatcgctgc     14280
     cagttctgaa gcacagaaac gcagtaatga tgcaatgtta cgcggcgtgg atcagcaaca     14340
     agtatctctg caaaacgatg cccgacagtt ggtgaactta cagcaacaag cccaaggagc     14400
     tacagggcaa atggcagcaa tgcaatacgc caatcaatta gccagttccc aaactaatca     14460
     gcttctacaa attcgcggtt tactactggc acaacaaaca gcgacagcta cacgcgccgc     14520
     cgcagttaat gcaaaagaat cgattgaaac agctggggcc gagagtttcc gagctggcag     14580
     cttagataaa agcccagtga aaaaatggta atcataggag atcacatgaa aatgaaaaaa     14640
     catctttttt tggcgttaac aatctcagtt attggttttc tagttggctg cgacaaccca     14700
     acagttgcaa cagaaaaaca gccatgtgaa aacaaaaatg agttaacaaa agctgaacaa     14760
     caggcgattg ctagtgactg ttttagaact ggtaatttcg aaaaaagtcc tgagaaaaag     14820
     tggtaacacc atgaaaaaaa tctctctgtc cgtattagct gtagtgctcc tgattgtggc     14880
     tcttcaggcg caagctggca ccggcattaa tagtgctggc ttacttgatg acatattaga     14940
     acgtttcgct aatacggcct ccggatgggg agatcgcata gttagctatg gtctgtggct     15000
     attttgggga ctaacccttc ttagcatggt atggacttac ggcatgatgg tattaaagaa     15060
     atcggatatt caagagttct ttgcggaaac aatacgtttt ctagccgcca ccggtttctt     15120
     tttatggata ttagttaatg gcccagccat tgctatttca ataattaata cctgccgcca     15180
     aatagcggct aacgcttctg gtttaagtaa tgctttatca ccgtcaggca ttgtagatat     15240
     tggtttcgat attgccggaa aagtggttga taaatcatct atatggtcac cggctgactc     15300
     cactgttgga ctgttggttg caaccgttat tttatgcatg ttggccctag tcgcaatcaa     15360
     catgctctta atgctaatta ccggctggct cttagcttac gctggcgttt ttattcttgg     15420
     attcggcggt ggccattgga ctcaagatat tgccatagcg tattacaagc aagtactcgg     15480
     ggtaggtata cagactttcg tcatgatcct cttagtcggt attgggcaat catttattga     15540
     ccagtattac gcggcgatgg gtgatgacat ggcccttaaa gaactgttgg ttatgctcgt     15600
     tgcttccttc gttctattaa tgttagttgc tcaactacca ccaatgtttg cgggaattgt     15660
     cggagccggt tctggaggcg gttcattggc gttcggtatg ggggcggccc ttggagcagc     15720
     aggtatggcc gcagctacag caggtgccgc tggtgccgcc gcaatcagtg gagcaacaag     15780
     cgccgcaggt ggaatgtcag cgcttcaggc agcatttgaa tcagcgcagc aaagcatgga     15840
     cgctggcagt agccctagtg gtgaaggacg tagctcttca ggtggaagtc tttcagaagc     15900
     aatgggaagg gcggggggtt ttgctaggtc gatgggatca agtcttgtcg atgctgcccg     15960
     tgatgttgct caagaaaaag ctggagcaat aaaagactca attcaggaaa gagtctctga     16020
     aaccactggt ggaaaaatgg ctgactcgat ccgtgaaagt agtggaatga atattggaaa     16080
     tgataacagt caatttgatg gtgatggtct aggggctgga aacaatgcag gaaatagcgc     16140
     ttccacacca gaaaccgatg aagaaatgat tgatcaattt gttaataaaa aatgatgggc     16200
     aggagcttaa ttatgaacac aacaaataca tcagcaggag aataattatg gttttccttg     16260
     atctaccacc tcaattacat gagcgcgttg tttgttcaat tacctctgca ttaaagtacg     16320
     aggtaccggc caacattgta cttggtatcg ctgaaaaaga aggcggtaag ccagggcaat     16380
     gggtcaaaaa taccaacggt actcacgatg ttggcccatt acagtttaat actcagtatt     16440
     taaaagaatt aagcaagtat ggtattaccg cagaagatgt cgctcaagca gggtgttatt     16500
     catatgatct tgctgcctgg aggttgcgtg gccatcttat gaatgacaag ggagatatat     16560
     ggacaagagc cgccaattat cattcccgaa caccaaagtt taatgcgcca tatcgtgctg     16620
     acctgataca gaaagcaact aaatggggag attggcttga agcgcgattt gtaacttata     16680
     cggttacgac tcctggagcg gcacctgcga ggattgctag cagaattacg actgtagcca     16740
     aaccacaaaa tgaaattgta aaaaaaacaa ttgaagttaa atcgattagt aatattgaaa     16800
     aaaaatacaa tccggcagca gctcaagcgc ttgcttccgt atttgctcca aaaatgggaa     16860
     ataattaata caggtatcac tcagttttaa acggttaaat gtagttaaaa tttgctaact     16920
     cacaaaatcc ccaattctgg cgtgattttg gcggagcttg cccaatagat agaaaggcat     16980
     ttaaaaatga aaaactggta tctgttatca tacaaatatg gacaggttaa cagagttcaa     17040
     tttggtttag atagattagg cgttaatagt ttcagcccaa gtatacaggt gaaaaaagtt     17100
     agatctgaca gcggaactat acgccttgta aatgaaccga tgtttcctac atatttattt     17160
     gtagagtttg atattgagtc aatacataca acaacaataa gttcaacact tggcgtaaat     17220
     tactttgtca agttcggaac agaaccaaaa ccaattccgt tatcactaat acaccaacta     17280
     atgaataggt ctgaatgtag tagtcaaaga aatgaagaaa tcgatgaaat agctactatc     17340
     ccagataaaa aattacgctg tgctttattt attaagttga taacacagat accagatagt     17400
     tttgaacaaa attcattaat taaaactcat catttaccag ctacacatca aacattatct     17460
     agctaatagc attaaaaagg cagaaaaaat gcaaagagaa acccaattat tcatcatggt     17520
     agcaatcatt atgtcatcat cagtatacgc tgatgatggc agtgatgata tttatcgtat     17580
     aagcgatgac tatatatcaa acattcaaat tgaacgtcct atattagtga gcagcaatac     17640
     acaaagtcgc ctactatcgg cttcatcatc ctctccgcag attgtagaac cacctaaaaa     17700
     accgaccata caacttgtcg ctctcaacaa cataattcaa agtgggacac cctcaccaat     17760
     tgaattcaga gggagtgggg ctgataatca gtcgttctat gacgcaatac gaaaaatagc     17820
     gcctactgga tggacaatat caatctcaag cgacatagat aaagatttca aaaataagaa     17880
     attcaaatgg gtaggaaatg acctatggtt gaatattctg caaagggttt tagctgagaa     17940
     taatattaac ggttatgtaa actggtcatt aaagagaatt tcatttgttt atccacaaaa     18000
     tgaaaaaaac aagcaaactg cattgattac accaaatgtt ccggtgacca caacctcagt     18060
     tgccgttcag aacgataaca agaacccatt taatagcaag agtgctatta gcaaaccgac     18120
     tccagaaaaa ataataccgc cactaaaaat atggaatgcc aatgtgggat taacgctaca     18180
     cagtacactt ctaaaatgga gtggtgaagt gccatgtaac attataggca agtggactat     18240
     aaactggaac tcttcaaagg attactcgat agactcagct ttaacattca gaggcgaata     18300
     tcttgatgca gtaacccagc tttttaattt gtataaaaaa gcaaattccc cgttatttat     18360
     tgatgtatat aaaacacaat gtttaataat tgttagcgat gctagcgaaa ataaaaaata     18420
     atttgggcga catatgaaaa ttaaattaat aactgcttgt gtcatggcgg cgctgctttc     18480
     tggttgctca attggccgta ttaataaagt aatagactcc gcgcagtcag attctgaaaa     18540
     agtcagcaat atgattgcag aaacggcaac tgttagaccg ccagttaaaa tccatgatga     18600
     gcaatggatt aaccctattc cgattaagtc agcaacagca gatattccgg cagcaatgat     18660
     taattgcgtg atcacttata aaccagtacg gcctcaagat gtgtatcagt tcggccagga     18720
     cgttacgcag cagtgcaata ttccagttcg aatttcacct gatgcagccg ctatgttatc     18780
     aggcaataac agcactggag gggggggacg gccaaccaat caaatgagca gcgttccagc     18840
     tccgattgtt ccccctgaag ctaacggcat ggttccacta cagacgttgg gaaccatgca     18900
     accaggtaac aatggtagcg tggcttatag cggcggtgta gcccgtaaaa ttacagatgt     18960
     ggcattctct ggcaacgtgg cacgtctact cgatattgtc acctctcgcc ttggcgtgtc     19020
     gtggcgatat gcaaacggtg aaatcactat tttctatctc caaactaagc gatttgatat     19080
     cgatacgact aatgcaaaat atacattaga aaatcagcaa aaaagtggct tatccactca     19140
     aagcggaagc aatggcactg gtgaaaaatc aagtgggata tctggtacta gcggctctaa     19200
     cacactgcaa acaactgaaa tgtcgaatga tatctatgga gacattcaaa aaacggttga     19260
     aagtatgtta acgccaggag tagggcgagt aagcataaat caaacctctg gtgtcgttgt     19320
     tgtaaccgat gttcccaacg tggtgcgtaa tattggtgag tatctgcaag atgagaacag     19380
     taaactttcc aaacaggttt tatttaaagt tgtcatttac actattacat ctgaagtttc     19440
     tgataatgtc ggaattgatt gggatattat ctttaaatcc ctatcaggaa aatatggtat     19500
     aaaccttgcc agctcatcag gattaagtac cgatttggca aatgggagct ttgaaatttt     19560
     agatactgct acaggtaaag cagctcaatt tgccggttct cagttcatgc ttcaagcatt     19620
     gtcaaaacaa gcgaatgtaa cagatacaaa aacacttaat ttgatgacca caaacttagc     19680
     tacggctggt ttattaatcg gtaaacaaac gacttattta cagcgttcat ctataacttc     19740
     aataggtagt ggtaattctt ctgaaccggt tcagtcatta gaaccaggac aaataaccac     19800
     tggtactaat attgttatat taccaaaaat attaaatgat aatgaaaaga tgatgttgac     19860
     aatgatgtta gatataacgt cattaaataa attaaggaaa atagataccg cagataaaaa     19920
     attaagtatt gaagggccgg attctgattc cagttctatt ccacaacgga tttggttgaa     19980
     accaggtgaa acaatcctaa tgagtggctt tgaacagatt gtgaaggatg gcagtaagca     20040
     gggcatgggt gatcctaata atattataat gggcggtaac atgtcgggca gtgataagaa     20100
     acagtccttc gtcattacta ttacgcctat tcttcgctaa ggagtattta tggctactga     20160
     aacgaaggaa aggaaaaaga tacgggtagt aacttataac aataaacaat ttgtcgtcgg     20220
     gctggaatgg agaagtatta ctggcggcag aaactttatg aaagaagtaa agcgaatagg     20280
     caaagaggaa aaacttgatg ttgttgcaat aagacagacg gaatcagtcc aagccggttt     20340
     tgctccacaa acagacattc cattgaaagg gaagtattca ttttcaattt cacttgtctc     20400
     tctgttacct ggtcgctgga ttggtgtatt tcctgttgcc cctgatgatg caagtaataa     20460
     tgaatatatt attattgcta catcagatgg gattatattc cctgcaacag ataagataat     20520
     catggaagat gaagttgagc aagaggttaa cgaccttaaa tctcgactat cgctaggtga     20580
     aggtaaagtt gagatatacg gtgacgcaaa aaaattcttt tgggtaacgt ctgagatttc     20640
     tttaagtgaa attttagcgg ctaaaaacct gaagaaagaa tataagctga aactgttaac     20700
     atggggatta accaaaaagc agatctactt ctttattgcc ttatttatcg ctgcattgtt     20760
     tgccctttat ttagtgaatg tgtatctcga agcgaaagcc gaagaggaaa ggcttgaaag     20820
     agtcgaagcc agaaagaaag cggaaaagat taacgaagag gccagatata aagccagtct     20880
     ggacagttta aaacatccgt gggtaacaca agcgtctatt caaaacttca tcaaaacgtg     20940
     tgatagcaaa cttccagaga ttcctttgtc tttggctgga cgtaagcctg tcacacttga     21000
     ttgtagccat aacagtatgg acgttctcta tgaaaggtta gacggttctt cagtgggcag     21060
     tacagagttt aaagaaaagg tagaacagtt atttaatacc accccgtcat ttaacatgaa     21120
     acagccctct atcgtgggat tttctctggc gttagataac aaaccggatg gtgatgatcc     21180
     agttgcatcg atgagtgagc agttgaataa gtttgttacg ttacttcagc gaaataatat     21240
     tgagttcact ttaactgatg cgccatcccc tgaaaaaaag tttgatggtc aaggggtgga     21300
     gctaccctta cctgactgga gagaaatata tttctcttat gattcgatgt atccaccgcg     21360
     agatatattt aaacagaaca atttaagcgg tatgagagtt acaaacatca tatacgtcat     21420
     taacaatgat acatctgaaa ttttatataa ggtaaaaggg gttatttatt atggtaaaaa     21480
     gtaagctaat aaagaataga gtttattttc tattgctatc tataatcatc tcttgttctg     21540
     tcagtgcaaa tgaaataagt gaagttaaat cagtttggga tttagatgta ttgcaaagcc     21600
     aaactactta ccttaaagcc ttagctgcgt ttcaggaagc taaagataaa agcggtggaa     21660
     caatgccgat tgtcgggagt gttgcaccag gggttaactc cgcacaaaaa atactcttac     21720
     cacaagttat taaaattgtg ggtaatggca gtggtctatc ggtgagattg gttttatcta     21780
     atggtacaga aatgaccaag aagaaaggcg actctatacc agggggatac aaactaacaa     21840
     aagtaactct tgatgaagtg agtatttctg atgctgcggg gacgtccttt attcttagtg     21900
     aggttggctc atgaaagttt taaatttatc cggtattgat ggtgttgctg attatcattt     21960
     gccagcaaaa ttaaaagatg caatgtgtct ggtcaaaaca gatttaggca atattgaatt     22020
     aagggtgtca agccacttaa ttaactctgc tgaagtcatg gattatgagc gacaactaaa     22080
     aaaaacaaac acggaattta aattagttcc atccaatata gctgagattg tagagcttaa     22140
     tcagcaaagt ggggtaacaa ctcaagagca gttgaatatt attcacggta aaatatttga     22200
     aattttttcg gcggcaacag acgcgagatc gtccgatata cattttcgtt tacgcagtaa     22260
     gttatgcaat gtctttttta gagttgatgg gaagttaagg ttctataaag agttaacgcc     22320
     agaagatggt aagtcatata ttaactctct cttcaataca cggtgcgaag accggagtca     22380
     tcagtcaatt tcctaccaag aaccttgtgg ggcgaaagtt agcgaggatt ttgtacagcc     22440
     attggggtta agtggagggc gctttgccag tcggcctgtt gctgatgggg ggatggttgc     22500
     tgttattcgt cttatctctc gacgaaatga aattctgtca atggaacagc tgggtttaac     22560
     tgacactgaa atagaaacgt tggagcgggc tatagcaaag cctaccggag tgatatttct     22620
     aaccggccct atgggatcgg ggaaaagtac cctggctcag gttgtttgtg aactgctcac     22680
     cagtcgagat ccagggatac acctgttaac ggtggagaac cctgtggaat cccctattaa     22740
     aggtgccgtt caaacgtcac ttggaacggg agaagagtgg tgggaagcaa ttaaaagcat     22800
     gatgcgcctg gatttgaact ggatactgat tggtgaagta cgagatcccc tttctgcttc     22860
     agcagctatt gaagcggctc aaaccggcca caatgtactg acaacaatcc ataccacatt     22920
     tcctattgat actatttctc ggttaaaaag tcttaatgta caaagtgatt tgattactga     22980
     tgcgtcattg attacctgcc tggttggtca acgactggct ccaaagctgt gtccctcatg     23040
     taaacaaaag tacaccgata gcagcaaatc ggttgcacca gtaattaaaa agattattga     23100
     taaacactgt gatattgaca gtatttattt gaaaaaccct caaggatgta ctgaatgctc     23160
     aggggctgga gtaaaaggcc gagtgggtat atttgaagtc attgaagtcg atgcaaactt     23220
     tatggatatt tatcatagcc aggggaagat aaaggcttat gaacattggt atataaatgg     23280
     tggtgccaca ttatgtacta acactcttcg tttagttaat accggcgaaa tcgaccctgt     23340
     tttaagtcat aaagacgttt gtaatttgga tcgcgattat ctcatcttta ctgatgaagt     23400
     gagagccgca gccaaagtga atagagagaa gataaatgaa taagtttaat cgtgctcttt     23460
     ataaaatgac gttcaatgtt aatgaccgag aggatgttta tgacaatttc agacaatatc     23520
     ttatagatgg tcagtctgtt gataatacat tcaagaattt gattgttaat tatacccggc     23580
     gagggagaaa acccaatagc ccgatggctg agattataag ggaatgggaa gagaaattta     23640
     agttgggcga tacattaggt gagtctttga gagaatggat acccgaacag gagctaagtg     23700
     tcatagatgc ttgtgatact gctggacggc cttgggatgg ttttcaaaaa gcaatcaaga     23760
     tagcaagatc tgcggaaaga attaaaaaaa ctatcaaggg tgcctttttt accagcatct     23820
     acatgttttt actttctttt attttactgg cttttgcttg ctcactcctt gtccctacat     23880
     tgctcgaagc cgtgccttta tttagatgga gtaccacaca gaaatttgtt tattattttt     23940
     atatatttat cagtggttat tggtgggcat taattgccgt ttgtttgata gttggatata     24000
     ttatttatca ttcattagac agatggacag gcaactcacg atttcatgct gataagtttg     24060
     ttccgtattc tctatataaa gaaatgcatg gcgcaacatt tattatcaat gtagacgcga     24120
     tgttgtcagc gggaatacca ctaaaagatt cactgattaa aatacggaac atgtctgatt     24180
     ctgattggtt gatagaaagg gtgaatggtg caatatcagg tttaactgag ggggaagaaa     24240
     atttagggct agcattagat atttctaact ttgaatttcc aagtgaagac gcaattatta     24300
     aaatgcagag cctttttgaa accgcgaata aagaaggttc attagagcgt tttggtgaac     24360
     gtcaacttga aaatacaata tcgagagtcg aaagaaaaac agcagtcatt aaagttgcaa     24420
     gtatggtttt tggtgccggt tgcaccgtag gaatcttctt tgtcatgtac agtttaattc     24480
     aacaagtctt tggcatttaa ataggaatat aaatagatga aaattttaaa gaaaggtctt     24540
     aacgctatta ctgatgaaac gattgctaaa gtcgttggct ttctattcct ggcaggtgtg     24600
     gttgttgccg gtgttgttct aaatggtaaa ataggctcaa caacaatggt gaatgcaatg     24660
     agtacattac tcaatgaagc taaggggtta agaacgtcag cggggtacgg tacaggagat     24720
     ctaacgccag cgttgatacg ctcaaaatcc attcagaaag ggctaaaaat tgatggtgat     24780
     aaactttata acccaactaa cgggcctgtc actattacgg gatctggaat gacctttaca     24840
     ttagcaacca gtaaagtgaa agatgaagat tgtatgaaac tggcgacaac attaagtggt     24900
     gctgatattg agtcaatgaa gataaatagc ggctcaaccg taacaagtga aatgtcacaa     24960
     atagatgcgg ctaatcaatg caacgcagga aaagaaaata caatttcaat tacttcttac     25020
     taatatataa ggtctattgt gacagaatcc ttgctcaaag attctggctt tgttgattta     25080
     tatcttggtg atgattatac cgatataaaa ggcatgatag gggcaagcaa taggcttgcc     25140
     cctgcgccag aaatattaaa aaacgatatc gagagtttaa gacaacaatg tttgaatttt     25200
     tatcatgcag aaaaaaggaa tgaattctct attttttatg gtgaacggtt gtacagggta     25260
     acaacaacta ttgatgttta tcaaaatatt ggttttgtta tcagacaaac gccgaatgaa     25320
     ttattcactc tacaaaaagt aggtctatca tctgatctta taaagctcat cagccagaat     25380
     aataattctg gtttagtttt agtttcagga aaaatgggag cagggaagac aaccacggca     25440
     gcggctatga tttgccacag aattaaggag agcggaaacc ttggtgtttc aatagaagat     25500
     ccgatagaaa cattactcgg tggaaaacat ggtgatggtc gctgtattca actggaagtc     25560
     tctgataatg agggataccc gctagcgata aagcgggcct tgagaatggg ggccaataat     25620
     atcctcatag gggaaatacg agacgcgcag acagcccatg aagtcatgaa agcatctctg     25680
     aatggtgcat tcattgttgc tacgattcat gcgaataatt gtattgatgc aattgaacga     25740
     tattctattt tctgtaatga aataaacagt aaagcaaact cgataattgc aaaatcactt     25800
     tttattgtca ctaatcaagt gttaatgcca tctatatatg aaagtaatat aagaggttat     25860
     acatgtacag tgaatggtta cgatattcgc gcgagtacaa ctattcaggc aaaaatcaga     25920
     gacggaaatt tccaaacctt aaaagatgaa tttgacagca tcaatcaaaa gcaaatgcga     25980
     cattctctat aatatgaggt ggtaatgaaa aaatttaaaa aagggttggc ggcgatatca     26040
     gggcaaacaa tcgctttaat tgctggccta attgtactgg caacaattac cgtaccggca     26100
     gtgaatctgc ttcaacgtga ccagtcatac agcgtggcgg cgagtcacgc taatcgtgta     26160
     gagaaagccg ttaataaata tattcttgaa caatccgcta ttgttggtgc gggatctaca     26220
     gccagtagtc cttatactat tgatgttccg ttgttaatca gtaaagggta tttgcctagt     26280
     ggctttgccg cacaaaataa tttctcaagt acctataaaa cgctagtttt ccaaccttcg     26340
     acgcaaaaat tccatagcat gacctttctt gatgggggaa ctcagctaag catgagcgct     26400
     gccaggaagt ttgcgacacg aattggtgat agtggtggcg tcattgaaaa cggggttgcc     26460
     aatggcgtac agggcttatg gagcgaaaac ctatcagcat tcggggggtt taatccaggc     26520
     gatggccatg tcgtgatcgc ggggttcttc tcaaatggct ctgtggtaaa cgagtatttg     26580
     taccgtaaag ccgtgcctgg tcatccagag cttaatacta tgagtacagc gctaaatatg     26640
     ggcgcaaatg atatcaacgc cgttcgtgat ctcaatgcgg caggtaatgc cgtggttcaa     26700
     ggcaatatta cagcagggaa caccgttacg gccaccggta cagttaaagc cgctaccacg     26760
     gacacaagcg gagagacgta taccggcggc tggtttcgaa caaggggtga tacaggttgg     26820
     tactctgaaa agtggggcgg cggttggcat atgaccgatg gaacttggct aagagcgtat     26880
     ggcggtaaat caatctatac cgcaggtatt gtgcaagcgg caacgttcca gcctgggcag     26940
     gtaagtgttg ttaacacagc atgtcctgaa agcgggcgta taagtcgtga tgcgactgga     27000
     gccatactga gctgtcaatc cggtgtgtgg gccaccagtg ggaaagtagt ggttatcaac     27060
     ggctataacc ctacatgccc tgccaataaa attcccgtgg cgcgctattg gacacaggca     27120
     gggggaagta attacggcga ttattgctca ctacaaacag ggtgggcggg agtaacaaca     27180
     ccgagttgtg agtcgtgtgc aaattgggaa aagtgtcata tggtgtactc ccaaacttgg     27240
     tctgccacag cttgtagctg attagtccgt tatccgcacc gacacaacct gtgtcggtat     27300
     atattcctat tactcatcgc tttaaacgag attaaaggtg aacattcaat acctaatgac     27360
     tagggttaaa tatttagcta tagagttaat ccaacccaaa ttattagccc ccatcttatt     27420
     gattatgctt attctgatat ttactttatc aatttggata aacatgctat tagaataatt     27480
     ttcacgagga aataatgaaa tataaatcac tgccaaaaga attagaatta attgaatata     27540
     gcatatcaaa tgtcaatcta ggggaaagaa aagaaaatat tgaaaatggt tttaaacaac     27600
     tcttattagc atgtgatgga aaaggtgata gtgattttta tggtgaagct gttaaattaa     27660
     aatgcctact tattaaacag cgaaatactc tccgaatttc aggatgtgaa gaagattctt     27720
     tgcacaattt aaccgcagcc atcgaattta ttaaggattt atcttggagc tattttagaa     27780
     ctacacttca agcagaaagc attgctgata cgataagctt gtattttggc ccatgtttgt     27840
     ttgcactagt aataactaca ttttcctttg gagcttacat attaataacg aggtaatgcc     27900
     atgctaggaa caaataccat gatggttata ttgtttattt ttattggagc aattagctat     27960
     agagcagtaa atgaaaacaa cagacaagct acagtaatag cttatgatca agctgctgca     28020
     acaacatttt tcctttatgt tgaacagtta gatggatttt taagtgctaa tccaacattt     28080
     acagggagtg taactactca gattcaattt ccggcatggt taaatgaaaa taaagacata     28140
     atgatgtatg tagaaaatgg gcgtggttat gtttatatgt cagctaaatc gaacgtttat     28200
     gattcactcg tttctcgaac tgaaaactcg tcaatgattg gattaacaga cagtaacagc     28260
     ataataacca atttggggcc aattcctaaa ccgtccgtaa ttccacagaa ctatattgtg     28320
     tatatgattt gaggaatatt ctattggcta acatcctgtt ttttttagta tcaataatca     28380
     caacaacggc tattgcatat ttactaccag ctattgtttc aagagcagag caggaagtcc     28440
     tttcacagta tgacgaagtt aagttagcgt cacaatatcg aacagcggtt gaacctttgc     28500
     tggctctttt cctggcttgt gtggctcctg ttttttatgc ggtacaaagt gatatcactt     28560
     tgtctgtgtt tattggcttg ttagcgctag tgagttacat cgatataatg aggcaatggg     28620
     tgccagatat cttaatccat ttgctgagct ggtacagcct gagttgctta gcgcttggat     28680
     tcattacttc agatgtgctc tattcactgc tttccttact gctattgctg ctaccgttcc     28740
     ttgctatcaa tgcttacagt tggataaaga ataggagcta catctatgca tcgggtgata     28800
     tctacatttt actctctgtc ggcctatggc tagattatcg ttttgcttta tcagctgccg     28860
     cgctaagcat tttatccgca tcaatttacg caaaaatagc gggaaaagag aaagtaccgt     28920
     ttgttccctt tatcttattt tcgctacttg tattttctac tatataacca atttggaatg     28980
     cacagatgaa agatatagct cagggattta tattgatact aacgttatta gtgccactaa     29040
     gtagttatgc atattgcttt caagcagctg gtgacactta tcaaatagac cctttattgc     29100
     ttatatctat cgctgatgta gaaagtagta tgaattataa agctatcggg caaaataaaa     29160
     agaatggcgt agtgaagtca gaagaccttg ggctaatgca gataaataca tcttggctac     29220
     caaagctagg gaaatcattc ggtattactc gtgagcatct attaaataac ccctgtcaga     29280
     atgtttatgt cggggcttat gttttagcaa ataacatatc tagcaatggt gttaattggg     29340
     agtcaattgg tgcttataac gccggtttta aaagcgcgaa tgaagagttt aggcttaggt     29400
     atgctaaaaa agtatacagt aaatacataa atttattgcg tggcaataga gcgataatta     29460
     ttgccaaggc aagtcgaggc gaacgggtat aaagtcataa ataaaaggag tcacagatga     29520
     gcataaacaa taaagacatt gaattattaa aactaattct aattaataga gataaagata     29580
     tagttaaaat gaaaataaat atacgaaatc atgagaaaat ccgtgggaat atcaagatat     29640
     ctttagcggc atttataata atatttatag ggggttttat tgttgaattt aaaggtttta     29700
     cgttatttat actaattgca ttaggtgcat ccatacctat tcatctatat caactaaaaa     29760
     aacacactac atcaccagag gcgttaaaca tatcatcttt aaatgatgag atgatagcta     29820
     acattagcaa atctggaagt aaagaactta aagatgaact acataaactt gttgttgctc     29880
     atggttatat aacatattca gggataagtg gtatcttaaa cgaaaacaac aaggaagaga     29940
     acaaacaaag actaagtgaa cttattaata atgtaggcag tcaagtaata ttaaaaccgt     30000
     aagttattaa tataacaact tagagcgatg ttattatgaa aaaaatagtt attctacttt     30060
     tgtctctagc catttgtttt tcatctttac cggctaaagc tgctgatgct tgtgaagtag     30120
     ttatttgcat gtatggaaaa gtaacaggaa actcacagaa agaatgtagc ggggctgaag     30180
     gtgatttttt tggtttgaat ggatttaaaa agaaaggccg gtttgatccc acaaaaacag     30240
     ctgaaatgcg ccaatcattc ttagagcaat gctcaacagc tgatcccgcc aaagttagtc     30300
     agattataag tgtgtttggt cgtataaggg gttgataact catcaaaaaa acactcatta     30360
     cagagtaaca agctagacaa cacacagcaa aatgctatca taacaacaaa ttagctttta     30420
     attaattaaa gcaaatcaca gatatgaaag catatatgga gtgatgaatg ggccaactga     30480
     ccatccgtac aacaccagaa caagaagctt tgattgcaaa ggtacaagcg cttagtggag     30540
     aaaaaaccgc aagtaaaacg cttattgctg cgctttacga attcgaaccc aatagagcaa     30600
     agattaggga gttacagaaa aaaattgaag cattagagaa tgactttgat aatttaaaaa     30660
     gtgttgttgt caattaccaa aatagtcaga aagccctctt aaatatcaat atttaactct     30720
     tcttaccata gaaaatggcc cgataacttg ggcctttctt ctaaaagaca acctcaaata     30780
     taaacaagga atacttatgc aacagaataa tatttttgtt gggaatttag ctgcaccatt     30840
     ggaaatgaaa ggtgaaaatg acaagctaat ctgtaaattc acactgattg ctaatgaata     30900
     tataggaaaa gacctaagta caaatgagag taagtatagg gaggtttcaa ttcgcttcac     30960
     agggtttgga aaggtagcaa cgcgcttaga aaaagctctt ttggttggtg atcaagtaat     31020
     agctagtttt tcaatcagta ataacaatta cgaacgggaa gggaaaatgg tatatggcca     31080
     taattttatt gtgcaagact tccaacttgg agcaccaggt aaagcacgta aggaaagaac     31140
     ttagtttcta ttgatggcat ttttcagcat ccggagcagt accaggatag tgttatgctg     31200
     gcaatcggtg ctggccagct gcggcgtcag tttcaattat gatagcaatt accggttgca     31260
     acatttgcca gcaatttaat atcaggtaat cagctgaaga agatacaact gccagcatta     31320
     cggtgactca atgctcgctg ccggtcgcag aaatgccagc atttcgcctt aaagactttc     31380
     ctttggcgtg aaacactttt cctatggatc ataacctcag cataaaattt actaaattat     31440
     ttccagatta tgtcgataac accaacaact tcttaactat ctataataaa aggattttta     31500
     tgcacacagt tatcattatc tctcttgcaa tattatgtgt tgcgttatct ctatcctgct     31560
     ttcttctttt tttaaacgca aaaagaaaag atgaatatat taatgatcca aacgcatcat     31620
     ataagttact ctcaaatcta tgttccaatg ttcataaagg gagtgatctt gaaagattac     31680
     ttgctgagat gcacgctgcg gtagttcatt taaaatatcg cagagataac gaataaatat     31740
     tactaataat taagcccaaa ttcacagttc tggattcggg cttttttttt aaactaccac     31800
     gatttacttt cgcttttttt aaactcacct tttctaagac atttacttat tagctcttta     31860
     tatttatctt tatcttcaag atttattttt ttaatatcat tacaggatgt gatttcacta     31920
     gttggtgaaa aaatcttgta gcccgcgaat cccacaacaa atgtcacaga aaaaataatt     31980
     acaataagtt tcataaacac tccataaatt tatacttccc gacaaattta ctgattatct     32040
     tagaagtcaa cctgacacaa tcggtcaaaa atcgtactta gcgactagaa acgaaatgca     32100
     tagtaatgcc gccttacggc ggcgatttgt tattcatgct ttgcttatat tatcatcatt     32160
     caacaacatt ctacgggtaa tatcttcaac aataagcaaa agagatatga atgtagcctc     32220
     gttaggcgac caagaaccgt gcgtaactgc attttcggcg ttagtaacaa tcaagagttg     32280
     ttgtttttca accgccacaa ttagtccctc ttcttgtagt ttctccattt tttcttccaa     32340
     tgataatgtg ggatatattt ctaatatttc tgttatcctg tctaatatag tacgtaatcc     32400
     aatcgatgct gagatatata atttatgttc acaagctgaa taaacctcgc aaaatatatt     32460
     atacaactgc ctatcaatag ttaataagcc aaatagccac tccggacgaa cggcttgttg     32520
     tctcggcgag ggaaatgtca cagtgctttc cataggattt aatactgtat ttccgtgagg     32580
     gcaattatcg taatctatac cttcattact ggttaatatt tcatgataga aaatactctc     32640
     acaccccata cactccaata atttatgttc actttggact gacatataac cattatcatt     32700
     atcaatttca tagttttttt ctattttccc gtgaacttga cagttacgaa ctccatcaca     32760
     agtggggcaa tgagctttaa atacttccgc agctgacatt ttagtctcca tttagatttt     32820
     atcattgatt ggataatgta tattttcata ggcttcaatc gcgccagcca acttttctat     32880
     ttcaacatct tccggtgtat ttagagcggg gttaagtttc atgagctgct ccaagcgcat     32940
     aagttgcgct tcatgctgtt ctggtgtttc aatttttatc atcttttact cctccacttc     33000
     cgctgaattc tctatcttat gcatgacggg gctttaatgt cgtttggtgt caggtatatc     33060
     agtttggcag ttattgatga tgatctctgc ctgttcacgc gagaatccaa agggtgtcaa     33120
     tgcatgatgc aaagtttccg catcaaggct ctggctattg tccctgaccc tgagttgata     33180
     atgcattttt gcagtacggt ttacgttgat gctgctttcc ccctgcctct tgggtttacg     33240
     cgaagagtgc caaccatgta gaatttatcc ccttaaccta atatttgaga gtgaacggtg     33300
     gattaatttg gtaagattat aaactgataa aatttatttt ttagatatta cgcaacaaaa     33360
     acatcaatgg agtagtcatg tttatatgtg atgagaaaaa aaacctcagt gtctctaaca     33420
     ccaagtacat taacttagcc tttaaagaaa cagagtttgt ggctgataat gattatatga     33480
     aaaatcaggc agagttattg gcgagtcgct ttactgatga aacatccaga acagatatta     33540
     taatgtatgt aattgatgtg attgaatgtg cggaaaaaaa taatttcgac gtgacggata     33600
     tgctccgtgt tttccacttt cttgctgaca ggttcgggtt tggttatcaa gtaaatacgt     33660
     ttggtacaga gcaacaagtt actgcatata agtatgcctc cagttgttac aatgagattg     33720
     tcgttgtccc aatatcgaga atcaaatatg taaaacaaca cgatagagtt attaagaaaa     33780
     acggcctgtc actttgtcga gtatccattg tcactactga taatgaagaa tttaaattgc     33840
     atatcgacga tcaaattata tccagcttga aatgtgacgt tattttaaaa tgtgccgtaa     33900
     aatttatcga ccaggcttta taattccgca atacgaatgc cgcatttgga taaaaaaagt     33960
     gtacagccgg tattcaccgg ctggcattcg ctagccgcct ttccctgctc tgctctttcc     34020
     taatgacttt gggtttaccc gcagactgcc aaatctgatt aaatcctagt atactagacg     34080
     ttattgactg gtaacataat gggagtatac tagacaaata tgtccagtag aagagagttg     34140
     gtgacggcac tacaggccat agcaaacagt aaaggatgga cgtttgagac gttggctgtt     34200
     cgatgttaga aagaagaaaa atttctacac agaagtgaac tgatagttta ttagtaatcc     34260
     gtatattcga aatggtataa cattacgcca tgtataatga caagaatact gaattagagg     34320
     ctcaatgtga gaagtttcag ccagcgctta gacagcatat taatcataac gtgataagga     34380
     gccgttgatg caaaaaaatg aaccgtatga tctagcaata gcgtttattt tggaaaatga     34440
     aagaacttgt aatttaagcg attccgatcc agaaaaaaca gataaaaatg aatgtttttt     34500
     atttgtggct ggctatatca aagcgttaag tgacttcaaa ttaataaaca aagagcaatc     34560
     gattgatctg agaaataaaa tgggatattt tggttcaata ccgtctgttt tcttggtggc     34620
     aaaaccaact gatttagaag gccgctatgg tgatattttc cgccagaacc ctataataga     34680
     ttgatggaaa tttctctttt tctgagaatg atttaatgaa cgcctcgtta atcggggctt     34740
     ttttacgtct gcgtactggc cttggcttta cccgaagagt accaaatatg attaaaaccc     34800
     tagtatacta gacattattg acgggtaaga aaacaggagt atactagaca aatatgacta     34860
     gcaagacaaa agtgattacg aaactacagg caatagtaaa cagcaaggga tggacgtttg     34920
     aagcattggc ggtacgttgg gaagtttcac cccgccagat gtccaggatt gcagccgcag     34980
     gtaagcagcg ggatatagac gccgctatgg gattgccaaa taaaggtgtg actcataatg     35040
     aaaattgaaa atcctcctga atcgtacata acaaatctaa aaagcatacc ggcttttgac     35100
     gactggctgt ggatgattaa taaaaatgat aggctcccga gaggtcagta tttcaaagcg     35160
     aggcagtatg caaaagagct tcttatgccg tcaaaaaatc aggtatttga ggtatttgac     35220
     ttaagaacag tcagagcctt tacgccgcca ataaccattt ctcaaagacg cgatgacttt     35280
     tatgagggca acatgcttaa agttttggat agtcagtcag ggaaaaaaca tgactaagta     35340
     tgtcttcgaa taaaaagtat caagacgacg ctgttaatgg cttgccggat atatcagaga     35400
     ggactgatga aaagaaaata cgttaatttg aaaaatatat tattatttgg tgccgttctt     35460
     tcctcgattt tttgcttgag cgcatatgcc aaggatctca actgtattac acgcgcagag     35520
     gctgattatg atgtacctgc ggggctattg aatgtcatgg cggcttatga agcgaaaaga     35580
     aatcagcctg ttgccaataa gttatatggc cctatgcagc tgcactctgt tgtaatacct     35640
     atggcggcgg aaggtattca ttctacggaa catgagatta aatataatga ctgccaaaat     35700
     taccgcgctg ccgcatggtt attaatgaat agttttggcg gcaatctata tagcgatatt     35760
     tttaacgccg ttaataatta ttactacggt tttggtaaac agagttatgg agtgatcacc     35820
     ttaaagataa aggatatgta ccagcacgaa aaacggtagc ccgaacaaac cgtgctggcg     35880
     ttcgcctgct actcacctct ccggccccgc gcctttctct cccgctggcc ggattggggt     35940
     ttaccctcag agtaccaaaa cacaaaaacc gcccaaaatg gcggctttac tgattaaaga     36000
     aagtaactta ttaattatgt gagagttacc ccaaccaagt gaaagtgacg gccattatcg     36060
     atgccagtga atgaagtagt acgggtagca gcaatccccc acttcgcatc cttgcccaag     36120
     taaagataat ggacatcgat gtaatcagaa caaacgtgct tatgttctca tattggttat     36180
     gaatgagaga aaatagcagc gcgataatga ctgcacctag ccacattgtc caggcatgag     36240
     aagaccgaaa aacgttcaaa atcacgccac gaaacacaat ttcttcgttg aaaggtgcca     36300
     caagtaaaat agttaaaaat acccctgaaa gctgtgcaaa aggctgatta agcaaattct     36360
     gaacaaattt ttcgggtgcg gcaccagtca atttaccgta actgtattca gcaaagtaaa     36420
     ccagaaccac agctaaaatt ggcaataatg aggacttttg caatactttt ccaaacccta     36480
     atggggaaac ccaccgatga taaggaacaa gcactgcgag aataaatatc ataccggcca     36540
     tatgcgatat taatagatga taattcccaa atccgttgac cgctgcccag tagcttgaat     36600
     aaattaatat agagaaccac ccctttgcaa taacgattgc ggcaatgagt acaatggtgc     36660
     tttttaatat tttattttta gtattgaaca ctttttttac ttctccaatt cgctaaccct     36720
     ctccccaaag agagtttatt tgggggttgg aaattttagt tttccaaatc cttattcatc     36780
     tgcttttcct catgatattt tatcgcctcg ctgatcatgt ctttcatctc ggtcaaaaat     36840
     atttttgttg tatcaaatgc ttcaagaaca gcgttataat caaattttat tgaatcattt     36900
     ccctcgcggg tctttccgtt tcgatgaaca atgtcgtttc ttaatgttgt cagtacatca     36960
     attttagtcg tatcaatatt tttgtatttt tttatttgga gtattgctct atacgttctt     37020
     tccacaatgg ggatgtcatg atatgtaatc cctgttaaat actcctgcac cgatttacca     37080
     acgacatcct ctttatcaat taaataaacc agatttattt cttttttgcg taaatgttca     37140
     atctgataaa cagcataatt tctgtatcgg ttatctgata agacaatgct tttaatcatg     37200
     tcgcccaggc agctttccat gatggtgacg caataagcta tttgcatttt ataaaaagtt     37260
     tcactggtat gctctttccc ttcgtcaaga atttcatcca gtaaggatat cgaggataca     37320
     taaatatcag tgtggggatt atttttcagc cattgctgct cttcatattc ctcgcgagcc     37380
     atgtcctcca taaaatcctt ataattatca tactcttcct ctagctcctg ccactcgtct     37440
     gaatcatttc ccaggtcagg atcagataat cttgcacgta tccacgcttc acggcggttt     37500
     tcctcttcat cctcaaacca ttgcttggta ctgctcattt agtgctcctt atattgtgtc     37560
     tgttataaag tcgttttctt taatagtttt aataaacagc ttatagttct ctatcataac     37620
     cgccgatgtt tcacacattt cactctggta ctttctatat gtcttttcac ttttagggtt     37680
     atttctccag tcataaggca ggtcaagtct taagggttct ctttctggat ggtctaccgt     37740
     caaaaatggt gtaagactgt tatagaaagc agtgattgcg ataataaagt tatctttcac     37800
     ttcattaaca gcgtaattat ataacctata attttcatcc ctgtattttc ctgcctcatc     37860
     taaattacgg gcaaattgat atgtcatgcc gacaatagaa ctttgctcgg cttcattaag     37920
     ggtggcttca taaggcagga gcgtaagtat ttcttcaatg atatttaaat catgcgcttt     37980
     ctttttttct tcaatacccg attctgtttt tgcatgggaa atatgattga tcgtagtgat     38040
     gttcaggtca cgaccggcct gattgatatt gccattgtta tttttatttg tttgcctgag     38100
     tttatatttt ttgattattt tgggcgcacc tattatccct ataacagaaa tacccaatcc     38160
     aataatagaa ataccccatc cctgataggt cgcccaatca gtcccgatgt gtgtgttcag     38220
     ccagtgaagc atagtcattc ccgacgaaat aaagatgcct gtcatgatag cagaaaggcg     38280
     gcgttgcgac tcggtgtgtc accgctgccg catgacttgg ctttacgcgg agactgccaa     38340
     actcggacga gtcccctact cccgccctga atgtctgcta taatcctttc tgtctcaggg     38400
     gcttgcatac cgccagagac agacaatcgg ggcgtgtcgg gcgcgttacg ctccgattgt     38460
     cacccttttt tacttggctt ttccccccta tagcgaaaac tcccaaccgt tccgattttt     38520
     atcgggtatt tattgtgatc gtacatcgac ctgaattgcg tcaaaatagt ctcattgagt     38580
     gcaaattgcg gataatgaaa tgtcgagcat catccctcac gatttggggc agatttcacg     38640
     tagcgcgatc cgcgcaccgg ccccgctgtt tagttacggt catgccctgg cactgcgtga     38700
     aaaagtgctg gcctccggtg atgcggaatt gccgctctat ctgctggccc ccgaagtcac     38760
     agtgttactt tcctatctgc ctgacttgcg gcaacggctg ctgatcgaaa ccttgtggaa     38820
     caccggcgca cgattaaatg aagcgctggc cctgacgcca gcctgttttc acatcgaggg     38880
     cgactcgccg tttgtggtac tgaagacact gaagcaacgg caaaaaggac ggggccgccc     38940
     gaaagagggc cagacactga aacgcatcgt gccgctgctc gatgaaaact atgtgcgcct     39000
     ggtacacgaa tacctggcta cgtttcggcc caagaaatat gcaccgctgt gggtgaacga     39060
     gcacggcgac accatcagtg atgaaacccc gcgcacctgg ttacgtgctg ctgtgacacg     39120
     cgcaaaccgt gacagtgtaa cgtttagtct gccggtgatc accccgaaaa cctttcggca     39180
     ctcgttcgcc atgcatttag tgcaaagcgg tgtggccttt aaagtggtgc aaaccttcat     39240
     gggccacaag gacgccgcca gtaccgaagt gtatacgcga atatttgcgc tggatgtggg     39300
     ggcgcagtat ggggtgaagt tcagtatggc agcggctgat gcaatggcac tggtgcgccg     39360
     taggtcttga cggaatgttt acgccaagga aaaaactcta agaggtaatg ctggcatttc     39420
     tgcgaccgac aacgggcatt gagtcaccgt aatgctggca gttgtatctt cttcagttga     39480
     ttacctggta ttaaattgct ggcaaatgtt gcaaccggta attgctatca taattgaaac     39540
     tggcgccgca gctggccaac accgattgcc agcataacac tatcctggta ctgctccgga     39600
     tgctgaaaaa tgccatcaat aactcatata aaagcccgga aaaaccgggc ttgatactac     39660
     caatatatcg acagttaacg gctcattgag tgagtttctt tttgagcttt tttaacttgc     39720
     ctcacctgac ttttttgctt tgtgacttgt tgcgttaggc tttcaacaac acattttatt     39780
     tgccgttcaa cgcctcgctt ccccaactcg ctatttacgg ataagtcatt aaaatcactg     39840
     aatgctttag gattaccagc ttgttcacct ggagcgaaaa tcgggaatac ctctttgcct     39900
     ccaaccgctt gggctgcttc tttggcaaat actttgcctg ggtttcgccc cctggccaat     39960
     tcctcagctt gatcatcatc cccagcaatt atgataggtt tatcagggaa cttagcatgc     40020
     agggctatag caactgcttt tagatttcct gcgtcaaatg cagcaacggt acaaaaattc     40080
     aatgtttctg ccagtgtctt agctgtggca taaccctcac caatgataag aataggggca     40140
     gaagctaaag cgtccaaacc acctataggg tggaaacaac cttctttttt gctcccttta     40200
     gcaaagcgtt ttgttccatc ttcagagata tattgcattg accattgttt accattctca     40260
     tcaatagcag gtatatatgt cttttggccc tctttatccg taaaaacacc ctctgctggt     40320
     tgaatgcctt ttttagccag ataaggcgtt ggcgtggtta tcaccgttag ctttttgagt     40380
     tggctaacaa cacgattagc agcttgctct tgtgccttat tcctctcagt tgctctagcg     40440
     gctaaattag tcgcggcctc cgcttgcatt gcagcctttt gttcagggtc aagcgtataa     40500
     cctttgcttt tccactttaa ctcaatacca gagcggttgt tttttatata ccccgcaggg     40560
     tggccattac tatgagcgat ataaaaaccg gcagtttctt tatttttgtc accctctaca     40620
     gcaatccgct gttccgttcc atccataatc gggtgcttac ctgacactat gcatcccatg     40680
     ctgattaaag cattagaaaa ttcctcgtgt aaggaaagtg ctgggctttg ctcattagtg     40740
     atattttcaa gcttccattt ccctaatttt tcagtatctg cattagggcc gatataccat     40800
     gacttagccg ttttatccca caaagcgcca aagcttttgg cctctttatg ttcaccaaaa     40860
     ggaaccgcaa ggtagacttt actttcttcg gttttttccg ctgattctgg attagacggg     40920
     aaagagctag ggggatacat attttgtggc cagttagcat tttgcgggat ttctcttgga     40980
     ttacccgtta tagcttgctc ctgactaact gaccattttt caaatggatt aacatcgata     41040
     ccggcgggga cgtaccaaga ctgcttttgc ctatcccatt tagcaccaag atcttttgct     41100
     tcatcttttt cagcaaaggg gactttaata aatgtctttt cttgctttat atctttactt     41160
     tcttttttaa tcggttgatt aaattgctta agttcggact caaatataat acgataatcg     41220
     tcatcatcaa ttaaatactt tacgccttct tcgggaatat caagaagatg tggaacctga     41280
     tcatcctgtt gattttcaag catactttca tttttagatt gacaccaatc atctgcatta     41340
     acatagatat cggtatctct tatatcacca tcttttctaa taacagaata accaggtaaa     41400
     tcatgaaggt gctgctccat ataatcttcc ttacctagtt gataatgttt tttaagctct     41460
     gctgcaatgc tattggccag ctcttctgtt tcacaatcag caacccaaag atgaagccct     41520
     tcttcatttt ctgcgtatat accaaaaaat tcaggttcgc gattttctgc tgaagcttct     41580
     acaacagata actcaccatt ttcatcaagg agttctacac atccccttac ctgcgtatta     41640
     cctgtccatt gagaaggtaa tagataagtt tcttcttggc caagggtgat ggttattccc     41700
     tggtgttgtt cttgggtttg ctctttttgc tgctcctgga tcagtgataa accaaagata     41760
     tattcctgaa ttttctctgc atctgccgca gctctgaata tttccaatgg atcattttgg     41820
     agagccttta tccatgaacc tacatatgca acatgctgtt ccggatcgtg gcctatgcct     41880
     aactcatccc ccattatcat gcttgctatt tcagctcgta actcctcttt agcgtacata     41940
     tcactaccga atggatgccc taaatcacga tctaaacgtt gttgatgtcc tgtccagtgg     42000
     cctagctcat gtaatgctgt tgcgtaatat ttatcagcac ttgagaactg ttctttgcta     42060
     ggtaattgga tactgtctgt ggatagccga tagaatgccc tatccccttc ctgatgtgag     42120
     attagagcac ctgagttttc taaaattttt tcggcttgtt ctatagcttt ccatagatct     42180
     tctttttctt ctttcggagg tagcggagga agaccatcta tttgctcagc attaaatacc     42240
     gaggcaaaaa aaacgcgagg acgttctaac tgaacgatta cctttattgg ctggccatct     42300
     ttatctaata caggctttcc aagctgatca agcttgtctt gttcctcagt aaacttccaa     42360
     tactgaatag atgtgccttt ttcgccttga cgaacatgcg cccctgcttg tgtcgcttgc     42420
     ttgtaagtca tccaccgccg atcagagtgg ccttgtgata tcagttgtat cgcgttaatc     42480
     cccttatagc gcttaccact tgttgggttt atcggtaaaa aaccagagga acctgctttc     42540
     caaggacgtt gccagggagc cgtgccttgc ttcaattgct cgataagctt ttctgcaact     42600
     tgctcatgaa acggtttctt caaagtatca gccatgtttg ttccccttat ctgagtcaat     42660
     taggtcaaca acactttcag tagcatcacc ctcactcagt gcatcttcta caaatgcacc     42720
     aacttcaacc gcctcttcag ggtcaaaatc agcttgaaat cctggcgtat aagcatcatt     42780
     taacttttca tttaatacag aggatgaatc cttttcatta ttaaaaaccg caacatctgg     42840
     atagtttgtt ttttggttca taacgattac tccttacctt tggtatagtt aggctttcct     42900
     tttgcatcag ggtaggactg attacattcg ggataaccac tgcatgacca ccacaaccct     42960
     ttttttccgg ttctgtgaac aagccctttt ccgcaagatt tgcatttatg aatggtcgat     43020
     attttggcaa cctgtttagc gccagaaact ttggctacgc cattacctgc tttttctact     43080
     tggtcagtaa taaacttgat ttgtttttct agaaaatcat ctattcccga tggttctttt     43140
     tgtatatcaa taaatacacg ctcatttaat gctgttaaaa ctgcgctttt catcacttca     43200
     ggataaatat ctatgatact tctgcctaaa gtagtgctaa ttaattgctt accttttaac     43260
     tccaaataac ctttattttt caactcttca ataataaatg gccttgtggc aacagtacca     43320
     ataccatcac catctctcag taattttttt aattctgaat caggaacata tttatgaata     43380
     ttttccattg cagcaatcaa agaaccatca ttaaatctag gtggtgcttt agtttttgaa     43440
     tctactaatg aagattttaa gcaagtgaca gtatctcctt ttttcattac cacaaaagtt     43500
     tgcactgcat ttttttcatc gtcctcttca ctttctgtat aaatactctt ccatccggcg     43560
     tgtgtaactg tattaccctc agctttaaaa gtttcagtat caatatcaat tgacacggtt     43620
     gttttaagaa attcatgtac aggataaaac tgagccaaat acgacctgac tattaaatcg     43680
     tatatgttct tctcttttac atttaatcta tccgcagaac ccatatgcat agttggaata     43740
     attgcatgat gagcactcac ttcattatca ttccatatcc ttgattttat tttaatatca     43800
     acagcatcaa ctaaatcagc cttatctgga ttaacatgct taattgcaga taggacagca     43860
     tgagcatccg caaattgtgt ttcaggcaaa aatttacaat ctgaacgggg atagctagtt     43920
     agtttatgag tttcatataa tgattgacat atttccaaaa catcagcaga gctataacca     43980
     aatttatttg aagcaactac agtaagactt gataaagaaa atccaaaagg gtggagcttt     44040
     ttctgtggag tcttcttata ttcttttatt tctcccgttt tttcatttaa cttatctgcc     44100
     aattttgaag ctatatttct atcgaccaaa cggccttcac tgtctaaccc ctcctggtct     44160
     tccttggcga tccaatcagt tacaaatgcg ctatcattgc atttaacagc ggctttgatt     44220
     ttataaaaag gaataggctt aaaagcttct atttctctat ccctccctac aactagcgat     44280
     aaaacaggag tttggactcg tccaactgac agtaaaacag catagccacc gcgcttagcc     44340
     cgtaacgtat atgctcggct caaattcata ccaattaacc agtcacaccg tccgcgagct     44400
     aaggctgcta caccataccc ataaaattgc ttattatctt tcagatcggc taaaccacgt     44460
     ttaacagcaa cagagtcttg agatgaaacc caataacgct taactggtag attacaatta     44520
     taatattcta acaattcatc aaccaatagc tgcccttcgc gatcaggatc acctgcatta     44580
     acaatcaagt cggcttcttt caagaaacct gaaatcactt tcaattgaga ttcggcatct     44640
     tctcttggtt taattatcca ttcttcagga attattggta actcattctc tcgccaaatt     44700
     ttatttcctt taggggttct tggtacatca tcaggtgtat attcatcagg ttcagcttgt     44760
     tcaaacatat gcccaaaaca ccatgttatg gtatccgaac cacattttat ataaccattc     44820
     cctttacctg taattcctag ttcagcggca atcgctcttg ctacgtttgg tttttcagca     44880
     ataaataacc gttttatatc actcatatat ttaaaatcct ttaaagtaaa tatctaacat     44940
     gttacttcca acttaatatt ggacgaataa cactgtgtat ttgttgttta tcaataaaac     45000
     cgaaatatcg cgaatcaaaa gaactattac tttggtcagt cattaaaaga agctctgatt     45060
     cttgcaatgt atgattgagt atattaatgc taggcagtgg gttccctgac aaatcaacag     45120
     agagaggctt gctatagggt attttaatat tattaacaat cacaccatta ctattaatag     45180
     aaacaacatc tcctttagcg gctaaaattc tcttcatcat ataaccatag ttacctgagc     45240
     agaaaccaga gttgatataa cctcgacttc tagctttatc aaaatcactt gtcggtggag     45300
     gacaaaaaac aacatactct cctttagaga taggtgacgg tgtcattaaa tataatccta     45360
     cgggaatact ttcacttgtg ttaactcgaa taccagagat ataaataatt gtagatatca     45420
     aagctattcc gctaactaca aaagccaacg agtgtgactg tttcataaag cgataacctc     45480
     cccttctgta aggagtaagt ttcctctaat cttgtcacta aattttggtt caggtacggc     45540
     agctcgggca gtaaaaatag ggtctttgaa ataaagaggc tgctttccat aaatagtggg     45600
     ataaccagcc acatagacca ccatatcccc cgcatctgta atttgcccct cagcgtcttt     45660
     cttcggccca ggcatccgta aacactcatc tacagtcagt aatggccgct gtacttcctg     45720
     tattgtcctt gatacctgcc ctaacattgc actcgctctt ctaccactgg tagtaatctg     45780
     ctcttttaca acagtggctt ggccagttaa tttagatagg tgttccgctg tttcaactcg     45840
     gtttggtggg taggcatttt gtacatgaca gttagaagtg atcgtttcat cagggccata     45900
     acctgtttca cggcttttta attggttaat gtcttggcaa ataagatata gcttaatccc     45960
     ataacctgcg acaaatgcca acgactcttg caaaatttca agcttaccca agctaggaaa     46020
     ctcatcaatc attcccaata gccggtgctt atatgttttt ttagaacgaa tgtatgatag     46080
     agcgggttgt ttgaaaccaa attttgccaa aatctgacgc cagcgaggaa ccttttgttg     46140
     tactctctca aactccattt tgtctgctaa cagtctaaag atcatattag tcatgacacg     46200
     gacaagtggc ctgagacggg ccttatcgtt tggttgggta acaatataaa ggctgactgg     46260
     atcatcgtga ttcattaagt ctttgatgca gaaatcagat gaacttacat tacgggcaac     46320
     cactggatca cgataaagag atagatatga cttggccgaa gatagtaccg aaccggcttc     46380
     atcatcgggc ctatccatca tatcccgagc cgatgaaccc actacagggt gattttcgcc     46440
     atttacatgc ccatactgag acatttccat ccatagctca gcaatgtcct tattagggtc     46500
     tgatagcatt cgatcaatgt atggcaaggt ggccggtgta ccctcctctt tggctttata     46560
     aagagcatgg agtatcaaac ctacaatcag agcttgggat gttttctgcc agtggtcatt     46620
     cagaccttta ccatcaggat ctacaatcaa tgtcgatagg ttttgtacat ccccgacttc     46680
     atattccgtt gctatacgta tttcatctaa cgggttccat cgagcagagc cgtttaacgt     46740
     tgcaggttcg aaacggatag ttttattttt ggcgtactct tttcgccatc cggcagtcat     46800
     ggcccataat tcccccttta aatcagtgat aactgcactg tgtggccatg ataataaggt     46860
     tgggacaacc agaccgacgc ctttacctga acgtgtaggg gcgtaagtaa ggatatgttc     46920
     tggcccgttg tgacgaagat aatgcagctt ccctttatcg tcctcccaag ccccaacata     46980
     aacaccttca ttgttcccta ataatccggc ctctaatatg tccttctttt ctgcataacg     47040
     tgccgaacca tgtaaatgct cattcgcttt tgaagaatga gaagaaatca tttttatcaa     47100
     agcgcatcca attagccctg cggctccaac catcgttcct acgctgccag cggtagtaaa     47160
     ataagtggga tatatgtcat gccacttatc ccaccatgta taaatggccc agggtggata     47220
     tatttgattg aggttggaac ctaaaacact ttggtaatta aatgcgtaag cgaaatactg     47280
     agttgctgcc tgtacccctg cggccaatga agttatagcc agcataggaa ccaacttact     47340
     ttttttggtt cgactggctt tagtctgagg gccaacagca ctattagatt ttgttgtcat     47400
     ctgctacgtc ctttcgtttt gatcacaccc ttttcagtaa caatcacttc atcaccaata     47460
     gacaggcgct ttaagcgacg aacagttgca gcctcaaccg gcataactat tacgtgatcg     47520
     tcgcatttca aaagagctaa gctttcgcta tcaatttgac gaatcccagc gaaactcgcg     47580
     ccccctttat aatcattata tcgataatgt ttcactatat cgaatccttt accacgtttt     47640
     gcctctcgct cattgacata tttatcagcg gcaacctgac cagtactaag agttgatata     47700
     accttttggg gaataaaatc agcaagtggt gatttattta ctggaggctg aatcttttta     47760
     accccttggg ccaactccac ttttcgcaat tcagacaaac tgcgtaaacg gttttggctt     47820
     agaggcggtg gggtagtacc tactcgggca accagtgggc gtattgcttt tagatcaagt     47880
     tctaaattat ttaactgaga taagtgtctc catttgtttt ggctgttagg gggcggtgct     47940
     tttccaacac gcgccacctg tggccgtata tctcgacttt tatcatcgat agaacgtctt     48000
     ttatgtatta ctcctcttgc cctacgtaca ccccatcgca tcccgtcatt tgatttggtt     48060
     ccttgttgct ccacgttact agaaacataa ctcggcaata gcacttcact tctgttggtg     48120
     tgctgaacca tatcgagttc agacaggttt cgcaggttgt gggttttttc gggcggcggt     48180
     gttcttccaa cgcttctagt gtagggcttg atatctctgg cgtttcttcc tcctgattct     48240
     ctttttcgaa ttgaggctcc tcttgttccc cttgttgcaa ttgttctaat gctgcttcta     48300
     tttgttgttc tgctgtcagt tctactgtca tgtgtttgct ccttagtggc ttgttgggac     48360
     ataacaaatt gacgacgcag ctctaaatct gtgtcgtcaa atttgatatt cagttttgct     48420
     ttaacggcgg cttgaactat tttttcttta aattcatcac tgccatttac agaaatattt     48480
     tccccgtagc gctttatggc catatgtaaa gcggcttcca gaccatcctg agaagcccct     48540
     cgggaaactt tgagagaatc accatcatct ctaatcgcag agtcaccaac acgatagata     48600
     acggttccag ttttagtaat gttatctggg gtaatatctg aaatgggggt cgaattattt     48660
     ttgtcggctt gtttgccagt aactgtatta ccctttaatt tttgacgaga ttcacgagat     48720
     ctcaacgcag acaatgcttc tttgttaccc tcggttgcat tcgacttaag ccagtcagcc     48780
     caggcttgtc gtctacattt ttcatatata actttgcgtt cttttagata ttcggcttta     48840
     gctttctcta catctatctt taccgttctg ctcgttaatg aatacagagc ttttttattt     48900
     acaccctttc catttaatag ctttattgcg gcccttttta atcttccagt ccgtttagcg     48960
     gcttctatag ctctattttt tttatttctc gcagcaaccc attgagctgt tctaatagca     49020
     gatacgttgc tctgttcagc tttatatttg gcgtacaact ccgttgtatt cgctttcatt     49080
     cgtataggct ctttcttata tcgtggccca ttatcgatat ctattgagtc aatatttcct     49140
     aagcgatgaa aacgatgcct actgcgtggc ggtggctgtt ggcctacttt tccaaccctt     49200
     ggccttttac tatgcccaat gttgtttttt ggtgatcttt tattctgtgg ttgtggcttt     49260
     tcaaacttac caagttttac ctctaatttt cctttagaaa tatctctgga taccgagctt     49320
     gctttgacag cgattccttg ctggtcagtt atgatcaagc cattaccact ctcacgcagt     49380
     tctagcccat tattttgaat tacttggtgt agctcccccc aacttttact attgcgtata     49440
     gattccaaac attcacgctt aacccaactg agcaagcttt caacccctgc gtgatgctcc     49500
     atatcatggg cgcggttttc tgctccaact ttctttgcag tatgattagt ttgctgcaag     49560
     ccatgttcta tttctaactt tccagcgata tcaccaaatg ttgaataggc tctataaggc     49620
     tcatgtaatg tatgttttga tgggtggatt ttattaatag atatgtggat atgaagatta     49680
     tcagtatcgt gatgaacagc gctgacacgc tgatgctcac catagccaat tgaactacaa     49740
     accctggctt caatatcttt aagaatatct gctgaagggc tttcacctgc cggaaatgaa     49800
     ataaacaaat gataagtttt atctccggtc gcgcgtgtgt ttaatttctg cgttgcctga     49860
     atctcattta tagcccaatc aacatcctcg ctattacagt tagtgatatt gatatcacca     49920
     actctttcct gctttccttg ctcattcgtt atgtattttg ttagacctga atagctgctt     49980
     cgcttgacag atttcatcgg aatatggcga atgatcacgc tacaccccct aaaattttag     50040
     ccgctaaaaa aaaggtcata gctttttcac tacttcaaac atggcagatt gtgtgtcact     50100
     aatacggcat aaaagaactt ctatagcttt tgaatccaag cgaactaagc gctcatcatt     50160
     tgttagccag agctttaata accccccaag cctacctaaa tcggcattaa tctttgaaag     50220
     ctcgatcact tgatgctggt caataacacc ataaatggtg tgacctaaag caagtcgcct     50280
     taaatattca gcaatgctta aaccggcagc agcagcattc gctttgatta aaatttcctc     50340
     atcaggtaac accggcactc tcaagtgtcg cccgtgtttt cttgttattt tttttcctac     50400
     ggtgtcgatc atttaccccc taactcccat tgaattaagc actaaggcgg cggtagccag     50460
     ccagcctcgc agagcaagat tcccattgag tgccggaggc gcgaataagg gagagtgaag     50520
     atagataacc ggcttgccgg ttagctaact tcacctatct tgccctgttt taaccccgtt     50580
     taacgccaag agagtattac acgaaaccaa gaaaatacta agatttttca ttatatccgt     50640
     tgcaagacca cctaaaacca agcaaaatcg ggtctacggt tatttattct tgaatgtgtc     50700
     ttgaattcat cttgatttgg aaattggaat attcggtaag gacatatggc aaagagcctt     50760
     tcacagcgta tagctgagcg gcaaaagctt ctttcacccc taggtagggg gggagctaat     50820
     agggctgagt ttctagcaca aagagaggac attgctgatg cattacagga tgggtggtct     50880
     atcaagcaaa tatgggacac gctttatgac gagggaaaaa ttacctttag ctatgaccct     50940
     tttaccaaat acgtaaaaaa tatcatccga tcaaacaaac aactccccgt cttatcagga     51000
     gtgcagcaag ggcaaatacc agagcaaaaa cctaaagatg ctcaatctca aacaccaaaa     51060
     tcaattttca gcactggctt accaaagttt caacataatc caggcgcgga caacgacaac     51120
     taggaattaa catcgtggct aatattcata tggttttaca aggtaagggt ggtgttggta     51180
     aatctttcat ctcatccctg attgctcaat atatggcaag tagtggccag cttcctttat     51240
     gcgtcgatac agatcccgtt aacgcttcat ttttaggata caaggcgttg aaagtacgga     51300
     ggcttgaaat catggaagga gatgaagtaa acacgcgaaa cttcgatgag ttagtggaat     51360
     ggatagcaga aacaaaagtg gatatggtta tcgataatgg ggccagctca tttattccat     51420
     tatcatcata tttagttagt aatgctgttc ctggcttatt gcaagaaatg agtcaccaat     51480
     taattatcca ttcagtggta acaggagggc aagccttgcc agaaactttg gcaggtcttg     51540
     agtcacttgt taaatggttc cctgatgaaa ctatatttat agtgtggcta aatccatatt     51600
     gggggccaat tatcgataac ggtaaaacct ttgaggaaat gcctgtctac gaaaaatata     51660
     aagaacgcat ttccgcgatt attcatcttc cagagttgaa agaggaaaca tacgggaaag     51720
     acttaacgga tatgcttcaa gctagactta cgtttgatca agcattgaaa atgaaagatt     51780
     tatctatcat gactcgccaa cgacttaaaa tgattcagaa gttagtttac aaccagcttg     51840
     atttgttggc gaaagcctca tgacagatga aatagacgaa ttaataaaag atattgcatt     51900
     aaagaacggg gtagctattg accgtgacga tccaataatg attttgcaaa ctatgcaatt     51960
     gcgatttttg gctggtaata aaaaagcaca ggtagaaatg cttgatgagt tcaaagagga     52020
     gttagaagga gtggcttctc gttgggggct tgagtcaaaa tccttggctg aaaaaatact     52080
     taataactca cttaaagcca gtaaagaaac aatggctatt cagttacaag aaagtgtcca     52140
     ggcgacatcc agggctgtag gaagtgaaat tgaaattaaa ttggcttgct tgaatgaacc     52200
     ggttcaatgg gccaaaaaga tagctatcta taatttaatt gcttcacttg tgacgttttt     52260
     aactgcatgt atgattattg tttttttctt attcaaataa tcttagtttc ttgactatca     52320
     atcatattct ccttaaaggg taattagcct gtgccaatta ccctttttat ttaattcaca     52380
     catatacgcg gaggtagtaa aagcggcgcg gatgcaagac cgcagcaagc gccccgtaca     52440
     caaaagtata cggggcaaat attttacaaa gaagaggatg attccatgtt ttgattaagc     52500
     gttcgacctt tacttcttgc caagtcctgc tttctgtctt gttctttttt tctcagcatt     52560
     gcttcatgac ggcgttgtgc ttctctcatt tcatcccaat cctgcgtcaa ctcaggattt     52620
     tctatcctca tctttcttgt ggccatttct tcaattctag gtgaatgtaa tcccatgctt     52680
     tcttttattt cacgaacggt ttcaagccgt ccgtgtaaac gctgtaaaga actctgctct     52740
     tgatgcaata aagattgaaa cttagctttt ttccctggta aagcaaacaa tcctggttgg     52800
     cgatttgtgg cttgttgaat acgtgttgat tgttgttcta tcaacacctc taatcggtct     52860
     tcaatacgtt caacttgacc atgcttctga tctatataag aggccaacat agccccgtac     52920
     tgtacttcca gtgacgatga ttcaagtaat gcttgttgtt cactatgaat tatttcggct     52980
     tcttttaaca agccatcatc aacagtttgc tcttctttca acctgtgttc tttttccgca     53040
     gtaaaaatag tatgtttttc atcagtaatt cccataggga tagctccttt ttagcggcta     53100
     aaattctatc gggatatact tctacctatt ttctgcgcca cgctcacttc ggcccgacct     53160
     tgctcgttgc tataagtaat agttttttca ctcccgataa ctggtacttt atcgaaattc     53220
     gagctattat gcttcacaaa gtttttcccg atttgctgat aaacattctc tttatcttta     53280
     tgaacgatag tacccgtata actctttgat ttatcggctt gattggctaa atagatgttg     53340
     tacattcctg gtttcaaatc accagcttta tctactttgt cgttttgcca atcccctgct     53400
     gctttttcgg tttgaacaat tcgttgacca ttcataacaa gaagacgctg tttcattagg     53460
     ggtgactcct cacaccgata cacatttttt aatccaactt ttaattttat cttaagcagc     53520
     ctatttttat cagttatttt tcaacataga tgacgttaga tttttttccc gttctattgc     53580
     ctcactaatt taaaacatca caaaagcgca attaatgcgc ttaaagcata ttatttaatt     53640
     gctaaatagg cgaaattcgc ctattataat tatacggggg caagagaaag ccgctcgttc     53700
     ctgagatggc tatgccaccg ataaggacga cgattgaaac tttcagatgt tgctaccatc     53760
     aagacgaatt acccagaagc ggatttttgg ataactcgac gaggctcttt aaaaacctgt     53820
     ggtcaaccta cctatgactt caattctgaa catataggga tcagagtaga aagaaccgat     53880
     attttgctcg cacgatatct cttctactgt atggagaact tgcataagaa cgggaattgg     53940
     gaaaggttgg ctacaggtag ccttgaattg gtgaacatcc gagtatcaga cgttagagca     54000
     atcggtctga aactgcgctg aagataagga gggggttaac cccctcccta cagcctgata     54060
     aacgttacag cgcttatcag gtagcgtcca actactatga ggatagagat atgacgcaga     54120
     acgtaagtat tgcattcgtg aggcatttgg taaagcgtaa tgccaaacgt aaacaagtta     54180
     gaattagggc aatgactggt attgagttag atacgttctt acgaactcta gaacgcactc     54240
     atgggtacgc catctaacta acccctcccc cgtccctgtg gcggggcttt gaccataaag     54300
     agataattat gaacattgac ctgcctaata ttgaagaaca acggaaaatg ctgtttgcag     54360
     ataatgtcga aaaaagttgt gctgcactaa gaaacaatct taacgcacct catttctctg     54420
     ctacgtctgg tgttgaagta caaacttatg gtgataaaca tttacgaaca gagcaacagg     54480
     gctgggaagt ccctgcacca gagcttatat atgcctggtt cgaacaattc aaagaggtat     54540
     ttcctgaata taattcggat aaaaagctag ccgctttatt aggcttacac acaagtggag     54600
     atcgccgcat acgttcattt aaaaacggtg aacaaaaaat tccatatggt gtttggcgaa     54660
     aatttttagt tctaacaggg cgggttaatc aagagataat tccggtcatg ggttttttta     54720
     atgattaata aagcgcatat tttgcgctta aggttatttt atgaatggat atgaactaag     54780
     actttggcgt aaagggcttt cctgggagca agaacgcgca gctgaagaat tgggtgtatc     54840
     acgtagagcc taccaatatt atgaaaaaaa tgggccgcct atggtcgtta ttttagcaac     54900
     aagagcactt agcctaaaaa tgatgtggcc agagataagt aaaactcaac ccttaacaga     54960
     agaactgcgt cttatatcta ccctggtacc tagagtttaa atcgctatca aaatagcgac     55020
     cggctagcag ctgcaccact caagaagcgc taaaaaaaag acggacaaac agagtatagg     55080
     taaagaatca gccaagtgtc gttattcgcg cggggtcagt accagatgag cggatcaaca     55140
     ataaaacttg gagccgacca tctggttcgc cgcgcgaaac aagatcagcc ccaaacggtt     55200
     ttatgatggc aaacacacca ggtgcaacat cgtggcactt attgatttgt ggcctatttc     55260
     caatcgtttc atgcagtagg ttcaacaggt gctgacgatc ccagcgcatc ggaaacggtg     55320
     ttccatatgg tagcgccctt agatgggcaa gagccgtatc aatgtcagtt tcactgatca     55380
     ccaatttttg cttctgacgt cccaacatat cgttccaggc tccgttactc cccaaacccc     55440
     aaatactggc ataaaattat aatctcctac ataacaaaga actcccaaaa gggagttctt     55500
     tgtttaggct aggaaaaata gttagccctc aataattgct accagagtga cactacttaa     55560
     ttcagcttca aactcctcac cgttatcttc acacttgaac caagcaagtc cttttagaga     55620
     aggtctacga tcaagcatta ttctggctgc tcgttcatca acgataactt ctacaaaaga     55680
     ctttttcaat tttgacttat cttcagattt tgattttttt gaattagact catctgaatc     55740
     atcaccacca ttatcagtat tatcttcccc attattatct tcagaactac catcgaattc     55800
     agggctgtta taaatatctc tttcatcttc agagactaaa tcagtgtcag aagaaatatt     55860
     gctattagaa tcatcatttt tattatcaat gaattctcgc agcaacttta ccgaaccacg     55920
     actaatttct tgatcctcat cctcaagcca acttgtaaca gctttagcgt tctttttaaa     55980
     tgcagtcacc agctcattta taacggtcac atcttttatg cggccagaat taaaagcttt     56040
     agctattgca tcaggtaaat ctagcagagt tacgtgctga gaaacaaaag cagctgatac     56100
     accaagttct ttagcaatca cgcctttctt cttcccctta gccaactcgc gacctataaa     56160
     atcggcaatt tcacgggctg ttaattcatt gcgttgcagg ttttcaataa cctgatcaat     56220
     ttcgttataa tcgttgtcta taaaccctgg aatcgttttt ttctgtgcta tttttgatgc     56280
     gcgcatacgc ctagcaccat gatttatcaa ataacgccct ggactatctg gattgtcacg     56340
     tactgaaata ggtgttttaa caccgcgctg gcggatagtt tcagcaagct catttaagct     56400
     ctggatagaa aagcctgggt tttcttctgt tcgaggttga tttggatctt cgtcgattag     56460
     gttcatatca aggtcaatag ggcttgttgg tgatggccct ttacctgcta ataggctaga     56520
     cagatcacca attgcatcca gtcctagcga tgattttttt tcttttgagg tcattctgca     56580
     atctccatct tttcaaaaat atatttagct aactcacgaa cttcttttgc tgcttttcta     56640
     gcagccgttt ttttgatttt ccaaacaggg acacctgttg ctagagcatc agcaatgcta     56700
     ctgcgtagac cgatagctgc ggggatcatc aattgaggat aggcttcttt cagttcagct     56760
     aaatgttggc cgtgacgtgg gttacgtcca tcaactttac ttggcaccat tcctagaaag     56820
     tttaatgatg ggttaaattg tcgcacgttg atgatcgtag taaccatttt ccctatacct     56880
     tgaatactgt aagcctctaa ctcaataggg gacacaacat aatcagaggc atacaaagcg     56940
     gttgcaaggc tgacaccaag ggaaggagca gtatcgataa gaacaacatc aaaaccgcaa     57000
     tcagacagtg cagctatttt agctttgaaa ttagcaacaa catcagcaac cggcttactc     57060
     tccatattgg caagaacagg gtctgacttt atcaaactta ataatggccc atcaggtaat     57120
     tggctaaata ctgagtgaaa gtctttagtt gattcctcaa acatctgact tgctaagtat     57180
     ccgctttcat actctttaag tgtgaaactt gcgttaccct gagtatctaa atcgattaca     57240
     gcaactttta aaccacgttc aaaaaagtca taagcgatat gaactaatgt tgaagtttta     57300
     ccaaccccgc ctttttgttg agcaacaacc aatgttttca ttttttgcca tccagttttt     57360
     ttgctgtttc ctcggcccat ttcttgacta tgaatgcttt tggttccgga agtatcgctg     57420
     taaccctctc gtatccctcc ggcagatttt tctcctgatg tgctatccag acacgattca     57480
     ctgcttgaga tacagcccct cgggaaagcc ctaacatcgc tacaaacgtt gcttgcggcg     57540
     tcccctcgac caagacacca tttgctatat cgatggtttg ttggcccaca tccaagtctt     57600
     ttatggctgc ctggaactcg gctttcgaga gccgtttttt catggacatt acccatatat     57660
     ttctccgcgc ctgaaattaa aatagcggtg acagccgcta acgatgcagt aagtttagct     57720
     aaactaagtg cctaattcaa tcattttagc cgctaaaatt ttcttgccgc actaatttac     57780
     tattgtttag gtaaaaaaaa acccgccgaa gcgggaattc taaaaattta gcactaatca     57840
     tctagttttc atttttttag gtttaaaatt gttcacaaaa aaagtgagaa cgactaatac     57900
     agagaaatga atcaggaatg tccatcctgc ataagttccc tgagtgttcc agtgccatag     57960
     catacgtgaa aactgaaaag ctacgtcaat ggcgagtatc catcgagcga caggccaaca     58020
     aatcacagtt aaaagccata tgattttgac aatactatca acaaatgaat tttgcttttt     58080
     ggctaatacg ttattgattg gcgtcgtatt cttatcagtt tgttccgtcg ctggaaattt     58140
     ataaatatta gacataactt gaccccttat gctgtagcat gttcaataca tcctacaagc     58200
     tttgacgcac tccgcgccta agtttgggct tggatgtgac agcattcagg ccaaacgccc     58260
     tggttaactc cagggcgttc ccttcaacaa ctctcacact ccgacttaaa tctatcattt     58320
     tttagccgct aaaatttaat caacatctct atctaataga ttaccacaat aagtgtaaaa     58380
     aacaatcgac catgattaaa atgaggccaa aaaataaatt ttttgagtat taaaaacaag     58440
     aaatgatggc aaaaatgata ttgaaataaa aaaatcagta ttaattataa gcaatgacac     58500
     tatattgata ttaaccttct attttggcgt aaaacatcaa ttttcttttt tatgcgcgta     58560
     gcgcatggaa ggaggcaaag atagtttcat atgctcgggg aagttaattg cctccgaaac     58620
     ctagcgttag atcatatccc ctaaaacccc ccttcctgca aagcgtgttt ttgcgaagc      58679
//

If you have problems or comments...

PBIL Back to PBIL home page