(data stored in ACNUC7421 zone)

EMBL: CP000721

ID   CP000721; SV 1; circular; genomic DNA; STD; PRO; 6000632 BP.
XX
AC   CP000721; AALO01000000-AALO01000089;
XX
PR   Project:PRJNA12637;
XX
DT   28-JUN-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Clostridium beijerinckii NCIMB 8052, complete genome.
XX
KW   .
XX
OS   Clostridium beijerinckii NCIMB 8052
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-6000632
RX   DOI; 10.1186/1471-2164-12-479.
RX   PUBMED; 21962126.
RA   Wang Y., Li X., Mao Y., Blaschek H.P.;
RT   "Single-nucleotide resolution analysis of the transcriptome structure of
RT   Clostridium beijerinckii NCIMB 8052 using RNA-Seq";
RL   BMC Genomics 12:479-479(2011).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-6000632
RX   DOI; 10.1186/1471-2164-13-102.
RX   PUBMED; 22433311.
RA   Wang Y., Li X., Mao Y., Blaschek H.P.;
RT   "Genome-wide dynamic transcriptional profiling in clostridium beijerinckii
RT   NCIMB 8052 using single-nucleotide resolution RNA-Seq";
RL   BMC Genomics 13:102-102(2012).
XX
RN   [3]
RP   1-6000632
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Tapia R., Brainard J., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Bennet G.,
RA   Cann I., Chen J.-S., Contreras A.L., Jones D., Kashket E., Mitchell W.,
RA   Stoddard S., Schwarz W., Qureshi N., Young M., Shi Z., Ezeji T., White B.,
RA   Blaschek H., Richardson P.;
RT   "Complete sequence of Clostridium beijerinckii NCIMB 8052";
RL   Unpublished.
XX
RN   [4]
RP   1-6000632
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Tapia R., Brainard J., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Bennet G.,
RA   Cann I., Chen J.-S., Contreras A.L., Jones D., Kashket E., Mitchell W.,
RA   Stoddard S., Schwarz W., Qureshi N., Young M., Shi Z., Ezeji T., White B.,
RA   Blaschek H., Richardson P.;
RT   ;
RL   Submitted (06-JUN-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 646465cd97a9ce4166bd90a6eef70361.
DR   BioSample; SAMN02598276.
DR   CABRI; NCIMB 8052.
DR   EnsemblGenomes-Gn; Cbei_R0001.
DR   EnsemblGenomes-Gn; Cbei_R0002.
DR   EnsemblGenomes-Gn; Cbei_R0003.
DR   EnsemblGenomes-Gn; Cbei_R0004.
DR   EnsemblGenomes-Gn; Cbei_R0005.
DR   EnsemblGenomes-Gn; Cbei_R0006.
DR   EnsemblGenomes-Gn; Cbei_R0007.
DR   EnsemblGenomes-Gn; Cbei_R0008.
DR   EnsemblGenomes-Gn; Cbei_R0009.
DR   EnsemblGenomes-Gn; Cbei_R0010.
DR   EnsemblGenomes-Gn; Cbei_R0011.
DR   EnsemblGenomes-Gn; Cbei_R0012.
DR   EnsemblGenomes-Gn; Cbei_R0013.
DR   EnsemblGenomes-Gn; Cbei_R0014.
DR   EnsemblGenomes-Gn; Cbei_R0015.
DR   EnsemblGenomes-Gn; Cbei_R0016.
DR   EnsemblGenomes-Gn; Cbei_R0017.
DR   EnsemblGenomes-Gn; Cbei_R0018.
DR   EnsemblGenomes-Gn; Cbei_R0019.
DR   EnsemblGenomes-Gn; Cbei_R0020.
DR   EnsemblGenomes-Gn; Cbei_R0021.
DR   EnsemblGenomes-Gn; Cbei_R0022.
DR   EnsemblGenomes-Gn; Cbei_R0023.
DR   EnsemblGenomes-Gn; Cbei_R0024.
DR   EnsemblGenomes-Gn; Cbei_R0025.
DR   EnsemblGenomes-Gn; Cbei_R0026.
DR   EnsemblGenomes-Gn; Cbei_R0027.
DR   EnsemblGenomes-Gn; Cbei_R0028.
DR   EnsemblGenomes-Gn; Cbei_R0029.
DR   EnsemblGenomes-Gn; Cbei_R0030.
DR   EnsemblGenomes-Gn; Cbei_R0031.
DR   EnsemblGenomes-Gn; Cbei_R0032.
DR   EnsemblGenomes-Gn; Cbei_R0033.
DR   EnsemblGenomes-Gn; Cbei_R0034.
DR   EnsemblGenomes-Gn; Cbei_R0035.
DR   EnsemblGenomes-Gn; Cbei_R0036.
DR   EnsemblGenomes-Gn; Cbei_R0037.
DR   EnsemblGenomes-Gn; Cbei_R0038.
DR   EnsemblGenomes-Gn; Cbei_R0039.
DR   EnsemblGenomes-Gn; Cbei_R0040.
DR   EnsemblGenomes-Gn; Cbei_R0041.
DR   EnsemblGenomes-Gn; Cbei_R0042.
DR   EnsemblGenomes-Gn; Cbei_R0043.
DR   EnsemblGenomes-Gn; Cbei_R0044.
DR   EnsemblGenomes-Gn; Cbei_R0045.
DR   EnsemblGenomes-Gn; Cbei_R0046.
DR   EnsemblGenomes-Gn; Cbei_R0047.
DR   EnsemblGenomes-Gn; Cbei_R0048.
DR   EnsemblGenomes-Gn; Cbei_R0049.
DR   EnsemblGenomes-Gn; Cbei_R0050.
DR   EnsemblGenomes-Gn; Cbei_R0051.
DR   EnsemblGenomes-Gn; Cbei_R0052.
DR   EnsemblGenomes-Gn; Cbei_R0053.
DR   EnsemblGenomes-Gn; Cbei_R0054.
DR   EnsemblGenomes-Gn; Cbei_R0055.
DR   EnsemblGenomes-Gn; Cbei_R0056.
DR   EnsemblGenomes-Gn; Cbei_R0057.
DR   EnsemblGenomes-Gn; Cbei_R0058.
DR   EnsemblGenomes-Gn; Cbei_R0059.
DR   EnsemblGenomes-Gn; Cbei_R0060.
DR   EnsemblGenomes-Gn; Cbei_R0061.
DR   EnsemblGenomes-Gn; Cbei_R0062.
DR   EnsemblGenomes-Gn; Cbei_R0063.
DR   EnsemblGenomes-Gn; Cbei_R0064.
DR   EnsemblGenomes-Gn; Cbei_R0065.
DR   EnsemblGenomes-Gn; Cbei_R0066.
DR   EnsemblGenomes-Gn; Cbei_R0067.
DR   EnsemblGenomes-Gn; Cbei_R0068.
DR   EnsemblGenomes-Gn; Cbei_R0069.
DR   EnsemblGenomes-Gn; Cbei_R0070.
DR   EnsemblGenomes-Gn; Cbei_R0071.
DR   EnsemblGenomes-Gn; Cbei_R0073.
DR   EnsemblGenomes-Gn; Cbei_R0074.
DR   EnsemblGenomes-Gn; Cbei_R0075.
DR   EnsemblGenomes-Gn; Cbei_R0076.
DR   EnsemblGenomes-Gn; Cbei_R0077.
DR   EnsemblGenomes-Gn; Cbei_R0078.
DR   EnsemblGenomes-Gn; Cbei_R0079.
DR   EnsemblGenomes-Gn; Cbei_R0081.
DR   EnsemblGenomes-Gn; Cbei_R0082.
DR   EnsemblGenomes-Gn; Cbei_R0083.
DR   EnsemblGenomes-Gn; Cbei_R0084.
DR   EnsemblGenomes-Gn; Cbei_R0085.
DR   EnsemblGenomes-Gn; Cbei_R0086.
DR   EnsemblGenomes-Gn; Cbei_R0087.
DR   EnsemblGenomes-Gn; Cbei_R0088.
DR   EnsemblGenomes-Gn; Cbei_R0089.
DR   EnsemblGenomes-Gn; Cbei_R0090.
DR   EnsemblGenomes-Gn; Cbei_R0091.
DR   EnsemblGenomes-Gn; Cbei_R0092.
DR   EnsemblGenomes-Gn; Cbei_R0093.
DR   EnsemblGenomes-Gn; Cbei_R0094.
DR   EnsemblGenomes-Gn; Cbei_R0095.
DR   EnsemblGenomes-Gn; Cbei_R0096.
DR   EnsemblGenomes-Gn; Cbei_R0097.
DR   EnsemblGenomes-Gn; Cbei_R0098.
DR   EnsemblGenomes-Gn; Cbei_R0099.
DR   EnsemblGenomes-Gn; Cbei_R0100.
DR   EnsemblGenomes-Gn; Cbei_R0101.
DR   EnsemblGenomes-Gn; Cbei_R0102.
DR   EnsemblGenomes-Gn; Cbei_R0103.
DR   EnsemblGenomes-Gn; Cbei_R0104.
DR   EnsemblGenomes-Gn; Cbei_R0105.
DR   EnsemblGenomes-Gn; Cbei_R0106.
DR   EnsemblGenomes-Gn; Cbei_R0107.
DR   EnsemblGenomes-Gn; Cbei_R0108.
DR   EnsemblGenomes-Gn; Cbei_R0109.
DR   EnsemblGenomes-Gn; Cbei_R0110.
DR   EnsemblGenomes-Gn; Cbei_R0111.
DR   EnsemblGenomes-Gn; Cbei_R0112.
DR   EnsemblGenomes-Gn; Cbei_R0113.
DR   EnsemblGenomes-Gn; Cbei_R0114.
DR   EnsemblGenomes-Gn; Cbei_R0115.
DR   EnsemblGenomes-Gn; Cbei_R0116.
DR   EnsemblGenomes-Gn; Cbei_R0117.
DR   EnsemblGenomes-Gn; Cbei_R0118.
DR   EnsemblGenomes-Gn; Cbei_R0119.
DR   EnsemblGenomes-Gn; Cbei_R0120.
DR   EnsemblGenomes-Gn; Cbei_R0121.
DR   EnsemblGenomes-Gn; Cbei_R0122.
DR   EnsemblGenomes-Gn; Cbei_R0123.
DR   EnsemblGenomes-Gn; Cbei_R0124.
DR   EnsemblGenomes-Gn; Cbei_R0126.
DR   EnsemblGenomes-Gn; Cbei_R0127.
DR   EnsemblGenomes-Gn; Cbei_R0128.
DR   EnsemblGenomes-Gn; Cbei_R0129.
DR   EnsemblGenomes-Gn; Cbei_R0130.
DR   EnsemblGenomes-Gn; Cbei_R0131.
DR   EnsemblGenomes-Gn; Cbei_R0132.
DR   EnsemblGenomes-Gn; Cbei_R0133.
DR   EnsemblGenomes-Gn; Cbei_R0134.
DR   EnsemblGenomes-Gn; Cbei_R0135.
DR   EnsemblGenomes-Gn; Cbei_R0136.
DR   EnsemblGenomes-Gn; Cbei_R0137.
DR   EnsemblGenomes-Gn; Cbei_R0138.
DR   EnsemblGenomes-Gn; Cbei_R0139.
DR   EnsemblGenomes-Gn; Cbei_R0140.
DR   EnsemblGenomes-Gn; Cbei_R0141.
DR   EnsemblGenomes-Gn; EBG00001099865.
DR   EnsemblGenomes-Gn; EBG00001099866.
DR   EnsemblGenomes-Gn; EBG00001099867.
DR   EnsemblGenomes-Gn; EBG00001099868.
DR   EnsemblGenomes-Gn; EBG00001099869.
DR   EnsemblGenomes-Gn; EBG00001099870.
DR   EnsemblGenomes-Gn; EBG00001099871.
DR   EnsemblGenomes-Gn; EBG00001099872.
DR   EnsemblGenomes-Gn; EBG00001099873.
DR   EnsemblGenomes-Gn; EBG00001099874.
DR   EnsemblGenomes-Gn; EBG00001099875.
DR   EnsemblGenomes-Gn; EBG00001099876.
DR   EnsemblGenomes-Gn; EBG00001099877.
DR   EnsemblGenomes-Gn; EBG00001099878.
DR   EnsemblGenomes-Gn; EBG00001099879.
DR   EnsemblGenomes-Gn; EBG00001099880.
DR   EnsemblGenomes-Gn; EBG00001099881.
DR   EnsemblGenomes-Gn; EBG00001099882.
DR   EnsemblGenomes-Gn; EBG00001099883.
DR   EnsemblGenomes-Gn; EBG00001099884.
DR   EnsemblGenomes-Gn; EBG00001099885.
DR   EnsemblGenomes-Gn; EBG00001099886.
DR   EnsemblGenomes-Gn; EBG00001099887.
DR   EnsemblGenomes-Gn; EBG00001099888.
DR   EnsemblGenomes-Gn; EBG00001099889.
DR   EnsemblGenomes-Gn; EBG00001099890.
DR   EnsemblGenomes-Gn; EBG00001099891.
DR   EnsemblGenomes-Gn; EBG00001099892.
DR   EnsemblGenomes-Gn; EBG00001099893.
DR   EnsemblGenomes-Gn; EBG00001099894.
DR   EnsemblGenomes-Gn; EBG00001099895.
DR   EnsemblGenomes-Gn; EBG00001099896.
DR   EnsemblGenomes-Gn; EBG00001099897.
DR   EnsemblGenomes-Gn; EBG00001099898.
DR   EnsemblGenomes-Gn; EBG00001099899.
DR   EnsemblGenomes-Gn; EBG00001099900.
DR   EnsemblGenomes-Gn; EBG00001099901.
DR   EnsemblGenomes-Gn; EBG00001099902.
DR   EnsemblGenomes-Gn; EBG00001099903.
DR   EnsemblGenomes-Gn; EBG00001099904.
DR   EnsemblGenomes-Gn; EBG00001099905.
DR   EnsemblGenomes-Gn; EBG00001099906.
DR   EnsemblGenomes-Gn; EBG00001099907.
DR   EnsemblGenomes-Gn; EBG00001099908.
DR   EnsemblGenomes-Gn; EBG00001099909.
DR   EnsemblGenomes-Gn; EBG00001099910.
DR   EnsemblGenomes-Gn; EBG00001099911.
DR   EnsemblGenomes-Gn; EBG00001099912.
DR   EnsemblGenomes-Gn; EBG00001099913.
DR   EnsemblGenomes-Gn; EBG00001099914.
DR   EnsemblGenomes-Gn; EBG00001099915.
DR   EnsemblGenomes-Gn; EBG00001099916.
DR   EnsemblGenomes-Gn; EBG00001099917.
DR   EnsemblGenomes-Gn; EBG00001099918.
DR   EnsemblGenomes-Gn; EBG00001099919.
DR   EnsemblGenomes-Gn; EBG00001099920.
DR   EnsemblGenomes-Gn; EBG00001099921.
DR   EnsemblGenomes-Gn; EBG00001099922.
DR   EnsemblGenomes-Gn; EBG00001099923.
DR   EnsemblGenomes-Gn; EBG00001099924.
DR   EnsemblGenomes-Gn; EBG00001099925.
DR   EnsemblGenomes-Gn; EBG00001099926.
DR   EnsemblGenomes-Gn; EBG00001099927.
DR   EnsemblGenomes-Gn; EBG00001099928.
DR   EnsemblGenomes-Gn; EBG00001099929.
DR   EnsemblGenomes-Gn; EBG00001099930.
DR   EnsemblGenomes-Gn; EBG00001099931.
DR   EnsemblGenomes-Gn; EBG00001099932.
DR   EnsemblGenomes-Gn; EBG00001099933.
DR   EnsemblGenomes-Gn; EBG00001099934.
DR   EnsemblGenomes-Gn; EBG00001099935.
DR   EnsemblGenomes-Gn; EBG00001099936.
DR   EnsemblGenomes-Gn; EBG00001099937.
DR   EnsemblGenomes-Gn; EBG00001099938.
DR   EnsemblGenomes-Gn; EBG00001099939.
DR   EnsemblGenomes-Gn; EBG00001099940.
DR   EnsemblGenomes-Gn; EBG00001099941.
DR   EnsemblGenomes-Gn; EBG00001099942.
DR   EnsemblGenomes-Gn; EBG00001099943.
DR   EnsemblGenomes-Gn; EBG00001099944.
DR   EnsemblGenomes-Gn; EBG00001099945.
DR   EnsemblGenomes-Gn; EBG00001099946.
DR   EnsemblGenomes-Gn; EBG00001099947.
DR   EnsemblGenomes-Gn; EBG00001099948.
DR   EnsemblGenomes-Gn; EBG00001099949.
DR   EnsemblGenomes-Gn; EBG00001099950.
DR   EnsemblGenomes-Gn; EBG00001099951.
DR   EnsemblGenomes-Gn; EBG00001099952.
DR   EnsemblGenomes-Gn; EBG00001099953.
DR   EnsemblGenomes-Gn; EBG00001099954.
DR   EnsemblGenomes-Gn; EBG00001099955.
DR   EnsemblGenomes-Gn; EBG00001099956.
DR   EnsemblGenomes-Gn; EBG00001099957.
DR   EnsemblGenomes-Gn; EBG00001099958.
DR   EnsemblGenomes-Gn; EBG00001099959.
DR   EnsemblGenomes-Gn; EBG00001099960.
DR   EnsemblGenomes-Gn; EBG00001099961.
DR   EnsemblGenomes-Gn; EBG00001099962.
DR   EnsemblGenomes-Gn; EBG00001099963.
DR   EnsemblGenomes-Gn; EBG00001099964.
DR   EnsemblGenomes-Gn; EBG00001099965.
DR   EnsemblGenomes-Gn; EBG00001099966.
DR   EnsemblGenomes-Gn; EBG00001099967.
DR   EnsemblGenomes-Gn; EBG00001099968.
DR   EnsemblGenomes-Gn; EBG00001099969.
DR   EnsemblGenomes-Gn; EBG00001099970.
DR   EnsemblGenomes-Gn; EBG00001099971.
DR   EnsemblGenomes-Gn; EBG00001099972.
DR   EnsemblGenomes-Gn; EBG00001099973.
DR   EnsemblGenomes-Gn; EBG00001099974.
DR   EnsemblGenomes-Gn; EBG00001099975.
DR   EnsemblGenomes-Gn; EBG00001099976.
DR   EnsemblGenomes-Gn; EBG00001099977.
DR   EnsemblGenomes-Gn; EBG00001099978.
DR   EnsemblGenomes-Gn; EBG00001099979.
DR   EnsemblGenomes-Gn; EBG00001099980.
DR   EnsemblGenomes-Gn; EBG00001099981.
DR   EnsemblGenomes-Gn; EBG00001099982.
DR   EnsemblGenomes-Gn; EBG00001099983.
DR   EnsemblGenomes-Gn; EBG00001099984.
DR   EnsemblGenomes-Gn; EBG00001099985.
DR   EnsemblGenomes-Gn; EBG00001099986.
DR   EnsemblGenomes-Gn; EBG00001099987.
DR   EnsemblGenomes-Gn; EBG00001099988.
DR   EnsemblGenomes-Gn; EBG00001099989.
DR   EnsemblGenomes-Gn; EBG00001099990.
DR   EnsemblGenomes-Gn; EBG00001099991.
DR   EnsemblGenomes-Gn; EBG00001099992.
DR   EnsemblGenomes-Gn; EBG00001099993.
DR   EnsemblGenomes-Gn; EBG00001099994.
DR   EnsemblGenomes-Gn; EBG00001099995.
DR   EnsemblGenomes-Gn; EBG00001099996.
DR   EnsemblGenomes-Gn; EBG00001099997.
DR   EnsemblGenomes-Gn; EBG00001099998.
DR   EnsemblGenomes-Gn; EBG00001099999.
DR   EnsemblGenomes-Gn; EBG00001100000.
DR   EnsemblGenomes-Gn; EBG00001100001.
DR   EnsemblGenomes-Gn; EBG00001100002.
DR   EnsemblGenomes-Gn; EBG00001100003.
DR   EnsemblGenomes-Gn; EBG00001100004.
DR   EnsemblGenomes-Gn; EBG00001100005.
DR   EnsemblGenomes-Gn; EBG00001100006.
DR   EnsemblGenomes-Gn; EBG00001100007.
DR   EnsemblGenomes-Gn; EBG00001100008.
DR   EnsemblGenomes-Gn; EBG00001100009.
DR   EnsemblGenomes-Gn; EBG00001100010.
DR   EnsemblGenomes-Gn; EBG00001100011.
DR   EnsemblGenomes-Gn; EBG00001100012.
DR   EnsemblGenomes-Gn; EBG00001100013.
DR   EnsemblGenomes-Gn; EBG00001100014.
DR   EnsemblGenomes-Gn; EBG00001100015.
DR   EnsemblGenomes-Gn; EBG00001100016.
DR   EnsemblGenomes-Gn; EBG00001100017.
DR   EnsemblGenomes-Gn; EBG00001100018.
DR   EnsemblGenomes-Gn; EBG00001100019.
DR   EnsemblGenomes-Gn; EBG00001100020.
DR   EnsemblGenomes-Gn; EBG00001100021.
DR   EnsemblGenomes-Gn; EBG00001100022.
DR   EnsemblGenomes-Gn; EBG00001100023.
DR   EnsemblGenomes-Gn; EBG00001100024.
DR   EnsemblGenomes-Gn; EBG00001100025.
DR   EnsemblGenomes-Gn; EBG00001100026.
DR   EnsemblGenomes-Gn; EBG00001100027.
DR   EnsemblGenomes-Gn; EBG00001100028.
DR   EnsemblGenomes-Gn; EBG00001100029.
DR   EnsemblGenomes-Gn; EBG00001100030.
DR   EnsemblGenomes-Gn; EBG00001100031.
DR   EnsemblGenomes-Gn; EBG00001100032.
DR   EnsemblGenomes-Gn; EBG00001100033.
DR   EnsemblGenomes-Gn; EBG00001100034.
DR   EnsemblGenomes-Gn; EBG00001100035.
DR   EnsemblGenomes-Gn; EBG00001100036.
DR   EnsemblGenomes-Gn; EBG00001100037.
DR   EnsemblGenomes-Gn; EBG00001100038.
DR   EnsemblGenomes-Tr; Cbei_R0001-1.
DR   EnsemblGenomes-Tr; Cbei_R0002-1.
DR   EnsemblGenomes-Tr; Cbei_R0003-1.
DR   EnsemblGenomes-Tr; Cbei_R0004-1.
DR   EnsemblGenomes-Tr; Cbei_R0005-1.
DR   EnsemblGenomes-Tr; Cbei_R0006-1.
DR   EnsemblGenomes-Tr; Cbei_R0007-1.
DR   EnsemblGenomes-Tr; Cbei_R0008-1.
DR   EnsemblGenomes-Tr; Cbei_R0009-1.
DR   EnsemblGenomes-Tr; Cbei_R0010-1.
DR   EnsemblGenomes-Tr; Cbei_R0011-1.
DR   EnsemblGenomes-Tr; Cbei_R0012-1.
DR   EnsemblGenomes-Tr; Cbei_R0013-1.
DR   EnsemblGenomes-Tr; Cbei_R0014-1.
DR   EnsemblGenomes-Tr; Cbei_R0015-1.
DR   EnsemblGenomes-Tr; Cbei_R0016-1.
DR   EnsemblGenomes-Tr; Cbei_R0017-1.
DR   EnsemblGenomes-Tr; Cbei_R0018-1.
DR   EnsemblGenomes-Tr; Cbei_R0019-1.
DR   EnsemblGenomes-Tr; Cbei_R0020-1.
DR   EnsemblGenomes-Tr; Cbei_R0021-1.
DR   EnsemblGenomes-Tr; Cbei_R0022-1.
DR   EnsemblGenomes-Tr; Cbei_R0023-1.
DR   EnsemblGenomes-Tr; Cbei_R0024-1.
DR   EnsemblGenomes-Tr; Cbei_R0025-1.
DR   EnsemblGenomes-Tr; Cbei_R0026-1.
DR   EnsemblGenomes-Tr; Cbei_R0027-1.
DR   EnsemblGenomes-Tr; Cbei_R0028-1.
DR   EnsemblGenomes-Tr; Cbei_R0029-1.
DR   EnsemblGenomes-Tr; Cbei_R0030-1.
DR   EnsemblGenomes-Tr; Cbei_R0031-1.
DR   EnsemblGenomes-Tr; Cbei_R0032-1.
DR   EnsemblGenomes-Tr; Cbei_R0033-1.
DR   EnsemblGenomes-Tr; Cbei_R0034-1.
DR   EnsemblGenomes-Tr; Cbei_R0035-1.
DR   EnsemblGenomes-Tr; Cbei_R0036-1.
DR   EnsemblGenomes-Tr; Cbei_R0037-1.
DR   EnsemblGenomes-Tr; Cbei_R0038-1.
DR   EnsemblGenomes-Tr; Cbei_R0039-1.
DR   EnsemblGenomes-Tr; Cbei_R0040-1.
DR   EnsemblGenomes-Tr; Cbei_R0041-1.
DR   EnsemblGenomes-Tr; Cbei_R0042-1.
DR   EnsemblGenomes-Tr; Cbei_R0043-1.
DR   EnsemblGenomes-Tr; Cbei_R0044-1.
DR   EnsemblGenomes-Tr; Cbei_R0045-1.
DR   EnsemblGenomes-Tr; Cbei_R0046-1.
DR   EnsemblGenomes-Tr; Cbei_R0047-1.
DR   EnsemblGenomes-Tr; Cbei_R0048-1.
DR   EnsemblGenomes-Tr; Cbei_R0049-1.
DR   EnsemblGenomes-Tr; Cbei_R0050-1.
DR   EnsemblGenomes-Tr; Cbei_R0051-1.
DR   EnsemblGenomes-Tr; Cbei_R0052-1.
DR   EnsemblGenomes-Tr; Cbei_R0053-1.
DR   EnsemblGenomes-Tr; Cbei_R0054-1.
DR   EnsemblGenomes-Tr; Cbei_R0055-1.
DR   EnsemblGenomes-Tr; Cbei_R0056-1.
DR   EnsemblGenomes-Tr; Cbei_R0057-1.
DR   EnsemblGenomes-Tr; Cbei_R0058-1.
DR   EnsemblGenomes-Tr; Cbei_R0059-1.
DR   EnsemblGenomes-Tr; Cbei_R0060-1.
DR   EnsemblGenomes-Tr; Cbei_R0061-1.
DR   EnsemblGenomes-Tr; Cbei_R0062-1.
DR   EnsemblGenomes-Tr; Cbei_R0063-1.
DR   EnsemblGenomes-Tr; Cbei_R0064-1.
DR   EnsemblGenomes-Tr; Cbei_R0065-1.
DR   EnsemblGenomes-Tr; Cbei_R0066-1.
DR   EnsemblGenomes-Tr; Cbei_R0067-1.
DR   EnsemblGenomes-Tr; Cbei_R0068-1.
DR   EnsemblGenomes-Tr; Cbei_R0069-1.
DR   EnsemblGenomes-Tr; Cbei_R0070-1.
DR   EnsemblGenomes-Tr; Cbei_R0071-1.
DR   EnsemblGenomes-Tr; Cbei_R0073-1.
DR   EnsemblGenomes-Tr; Cbei_R0074-1.
DR   EnsemblGenomes-Tr; Cbei_R0075-1.
DR   EnsemblGenomes-Tr; Cbei_R0076-1.
DR   EnsemblGenomes-Tr; Cbei_R0077-1.
DR   EnsemblGenomes-Tr; Cbei_R0078-1.
DR   EnsemblGenomes-Tr; Cbei_R0079-1.
DR   EnsemblGenomes-Tr; Cbei_R0081-1.
DR   EnsemblGenomes-Tr; Cbei_R0082-1.
DR   EnsemblGenomes-Tr; Cbei_R0083-1.
DR   EnsemblGenomes-Tr; Cbei_R0084-1.
DR   EnsemblGenomes-Tr; Cbei_R0085-1.
DR   EnsemblGenomes-Tr; Cbei_R0086-1.
DR   EnsemblGenomes-Tr; Cbei_R0087-1.
DR   EnsemblGenomes-Tr; Cbei_R0088-1.
DR   EnsemblGenomes-Tr; Cbei_R0089-1.
DR   EnsemblGenomes-Tr; Cbei_R0090-1.
DR   EnsemblGenomes-Tr; Cbei_R0091-1.
DR   EnsemblGenomes-Tr; Cbei_R0092-1.
DR   EnsemblGenomes-Tr; Cbei_R0093-1.
DR   EnsemblGenomes-Tr; Cbei_R0094-1.
DR   EnsemblGenomes-Tr; Cbei_R0095-1.
DR   EnsemblGenomes-Tr; Cbei_R0096-1.
DR   EnsemblGenomes-Tr; Cbei_R0097-1.
DR   EnsemblGenomes-Tr; Cbei_R0098-1.
DR   EnsemblGenomes-Tr; Cbei_R0099-1.
DR   EnsemblGenomes-Tr; Cbei_R0100-1.
DR   EnsemblGenomes-Tr; Cbei_R0101-1.
DR   EnsemblGenomes-Tr; Cbei_R0102-1.
DR   EnsemblGenomes-Tr; Cbei_R0103-1.
DR   EnsemblGenomes-Tr; Cbei_R0104-1.
DR   EnsemblGenomes-Tr; Cbei_R0105-1.
DR   EnsemblGenomes-Tr; Cbei_R0106-1.
DR   EnsemblGenomes-Tr; Cbei_R0107-1.
DR   EnsemblGenomes-Tr; Cbei_R0108-1.
DR   EnsemblGenomes-Tr; Cbei_R0109-1.
DR   EnsemblGenomes-Tr; Cbei_R0110-1.
DR   EnsemblGenomes-Tr; Cbei_R0111-1.
DR   EnsemblGenomes-Tr; Cbei_R0112-1.
DR   EnsemblGenomes-Tr; Cbei_R0113-1.
DR   EnsemblGenomes-Tr; Cbei_R0114-1.
DR   EnsemblGenomes-Tr; Cbei_R0115-1.
DR   EnsemblGenomes-Tr; Cbei_R0116-1.
DR   EnsemblGenomes-Tr; Cbei_R0117-1.
DR   EnsemblGenomes-Tr; Cbei_R0118-1.
DR   EnsemblGenomes-Tr; Cbei_R0119-1.
DR   EnsemblGenomes-Tr; Cbei_R0120-1.
DR   EnsemblGenomes-Tr; Cbei_R0121-1.
DR   EnsemblGenomes-Tr; Cbei_R0122-1.
DR   EnsemblGenomes-Tr; Cbei_R0123-1.
DR   EnsemblGenomes-Tr; Cbei_R0124-1.
DR   EnsemblGenomes-Tr; Cbei_R0126-1.
DR   EnsemblGenomes-Tr; Cbei_R0127-1.
DR   EnsemblGenomes-Tr; Cbei_R0128-1.
DR   EnsemblGenomes-Tr; Cbei_R0129-1.
DR   EnsemblGenomes-Tr; Cbei_R0130-1.
DR   EnsemblGenomes-Tr; Cbei_R0131-1.
DR   EnsemblGenomes-Tr; Cbei_R0132-1.
DR   EnsemblGenomes-Tr; Cbei_R0133-1.
DR   EnsemblGenomes-Tr; Cbei_R0134-1.
DR   EnsemblGenomes-Tr; Cbei_R0135-1.
DR   EnsemblGenomes-Tr; Cbei_R0136-1.
DR   EnsemblGenomes-Tr; Cbei_R0137-1.
DR   EnsemblGenomes-Tr; Cbei_R0138-1.
DR   EnsemblGenomes-Tr; Cbei_R0139-1.
DR   EnsemblGenomes-Tr; Cbei_R0140-1.
DR   EnsemblGenomes-Tr; Cbei_R0141-1.
DR   EnsemblGenomes-Tr; EBT00001554521.
DR   EnsemblGenomes-Tr; EBT00001554522.
DR   EnsemblGenomes-Tr; EBT00001554523.
DR   EnsemblGenomes-Tr; EBT00001554524.
DR   EnsemblGenomes-Tr; EBT00001554525.
DR   EnsemblGenomes-Tr; EBT00001554526.
DR   EnsemblGenomes-Tr; EBT00001554527.
DR   EnsemblGenomes-Tr; EBT00001554528.
DR   EnsemblGenomes-Tr; EBT00001554529.
DR   EnsemblGenomes-Tr; EBT00001554530.
DR   EnsemblGenomes-Tr; EBT00001554531.
DR   EnsemblGenomes-Tr; EBT00001554532.
DR   EnsemblGenomes-Tr; EBT00001554534.
DR   EnsemblGenomes-Tr; EBT00001554535.
DR   EnsemblGenomes-Tr; EBT00001554536.
DR   EnsemblGenomes-Tr; EBT00001554537.
DR   EnsemblGenomes-Tr; EBT00001554538.
DR   EnsemblGenomes-Tr; EBT00001554539.
DR   EnsemblGenomes-Tr; EBT00001554540.
DR   EnsemblGenomes-Tr; EBT00001554541.
DR   EnsemblGenomes-Tr; EBT00001554542.
DR   EnsemblGenomes-Tr; EBT00001554543.
DR   EnsemblGenomes-Tr; EBT00001554544.
DR   EnsemblGenomes-Tr; EBT00001554545.
DR   EnsemblGenomes-Tr; EBT00001554546.
DR   EnsemblGenomes-Tr; EBT00001554547.
DR   EnsemblGenomes-Tr; EBT00001554548.
DR   EnsemblGenomes-Tr; EBT00001554549.
DR   EnsemblGenomes-Tr; EBT00001554551.
DR   EnsemblGenomes-Tr; EBT00001554552.
DR   EnsemblGenomes-Tr; EBT00001554553.
DR   EnsemblGenomes-Tr; EBT00001554554.
DR   EnsemblGenomes-Tr; EBT00001554555.
DR   EnsemblGenomes-Tr; EBT00001554557.
DR   EnsemblGenomes-Tr; EBT00001554559.
DR   EnsemblGenomes-Tr; EBT00001554562.
DR   EnsemblGenomes-Tr; EBT00001554563.
DR   EnsemblGenomes-Tr; EBT00001554564.
DR   EnsemblGenomes-Tr; EBT00001554565.
DR   EnsemblGenomes-Tr; EBT00001554566.
DR   EnsemblGenomes-Tr; EBT00001554567.
DR   EnsemblGenomes-Tr; EBT00001554568.
DR   EnsemblGenomes-Tr; EBT00001554569.
DR   EnsemblGenomes-Tr; EBT00001554570.
DR   EnsemblGenomes-Tr; EBT00001554571.
DR   EnsemblGenomes-Tr; EBT00001554572.
DR   EnsemblGenomes-Tr; EBT00001554573.
DR   EnsemblGenomes-Tr; EBT00001554574.
DR   EnsemblGenomes-Tr; EBT00001554575.
DR   EnsemblGenomes-Tr; EBT00001554576.
DR   EnsemblGenomes-Tr; EBT00001554577.
DR   EnsemblGenomes-Tr; EBT00001554578.
DR   EnsemblGenomes-Tr; EBT00001554579.
DR   EnsemblGenomes-Tr; EBT00001554580.
DR   EnsemblGenomes-Tr; EBT00001554581.
DR   EnsemblGenomes-Tr; EBT00001554582.
DR   EnsemblGenomes-Tr; EBT00001554583.
DR   EnsemblGenomes-Tr; EBT00001554584.
DR   EnsemblGenomes-Tr; EBT00001554585.
DR   EnsemblGenomes-Tr; EBT00001554586.
DR   EnsemblGenomes-Tr; EBT00001554587.
DR   EnsemblGenomes-Tr; EBT00001554588.
DR   EnsemblGenomes-Tr; EBT00001554589.
DR   EnsemblGenomes-Tr; EBT00001554590.
DR   EnsemblGenomes-Tr; EBT00001554591.
DR   EnsemblGenomes-Tr; EBT00001554592.
DR   EnsemblGenomes-Tr; EBT00001554593.
DR   EnsemblGenomes-Tr; EBT00001554594.
DR   EnsemblGenomes-Tr; EBT00001554595.
DR   EnsemblGenomes-Tr; EBT00001554596.
DR   EnsemblGenomes-Tr; EBT00001554597.
DR   EnsemblGenomes-Tr; EBT00001554598.
DR   EnsemblGenomes-Tr; EBT00001554599.
DR   EnsemblGenomes-Tr; EBT00001554600.
DR   EnsemblGenomes-Tr; EBT00001554601.
DR   EnsemblGenomes-Tr; EBT00001554602.
DR   EnsemblGenomes-Tr; EBT00001554603.
DR   EnsemblGenomes-Tr; EBT00001554604.
DR   EnsemblGenomes-Tr; EBT00001554606.
DR   EnsemblGenomes-Tr; EBT00001554607.
DR   EnsemblGenomes-Tr; EBT00001554608.
DR   EnsemblGenomes-Tr; EBT00001554609.
DR   EnsemblGenomes-Tr; EBT00001554610.
DR   EnsemblGenomes-Tr; EBT00001554611.
DR   EnsemblGenomes-Tr; EBT00001554612.
DR   EnsemblGenomes-Tr; EBT00001554613.
DR   EnsemblGenomes-Tr; EBT00001554614.
DR   EnsemblGenomes-Tr; EBT00001554615.
DR   EnsemblGenomes-Tr; EBT00001554616.
DR   EnsemblGenomes-Tr; EBT00001554617.
DR   EnsemblGenomes-Tr; EBT00001554618.
DR   EnsemblGenomes-Tr; EBT00001554619.
DR   EnsemblGenomes-Tr; EBT00001554620.
DR   EnsemblGenomes-Tr; EBT00001554621.
DR   EnsemblGenomes-Tr; EBT00001554622.
DR   EnsemblGenomes-Tr; EBT00001554623.
DR   EnsemblGenomes-Tr; EBT00001554624.
DR   EnsemblGenomes-Tr; EBT00001554625.
DR   EnsemblGenomes-Tr; EBT00001554626.
DR   EnsemblGenomes-Tr; EBT00001554627.
DR   EnsemblGenomes-Tr; EBT00001554628.
DR   EnsemblGenomes-Tr; EBT00001554629.
DR   EnsemblGenomes-Tr; EBT00001554630.
DR   EnsemblGenomes-Tr; EBT00001554631.
DR   EnsemblGenomes-Tr; EBT00001554632.
DR   EnsemblGenomes-Tr; EBT00001554633.
DR   EnsemblGenomes-Tr; EBT00001554634.
DR   EnsemblGenomes-Tr; EBT00001554635.
DR   EnsemblGenomes-Tr; EBT00001554636.
DR   EnsemblGenomes-Tr; EBT00001554637.
DR   EnsemblGenomes-Tr; EBT00001554638.
DR   EnsemblGenomes-Tr; EBT00001554639.
DR   EnsemblGenomes-Tr; EBT00001554640.
DR   EnsemblGenomes-Tr; EBT00001554641.
DR   EnsemblGenomes-Tr; EBT00001554642.
DR   EnsemblGenomes-Tr; EBT00001554643.
DR   EnsemblGenomes-Tr; EBT00001554644.
DR   EnsemblGenomes-Tr; EBT00001554645.
DR   EnsemblGenomes-Tr; EBT00001554646.
DR   EnsemblGenomes-Tr; EBT00001554647.
DR   EnsemblGenomes-Tr; EBT00001554648.
DR   EnsemblGenomes-Tr; EBT00001554649.
DR   EnsemblGenomes-Tr; EBT00001554650.
DR   EnsemblGenomes-Tr; EBT00001554651.
DR   EnsemblGenomes-Tr; EBT00001554652.
DR   EnsemblGenomes-Tr; EBT00001554653.
DR   EnsemblGenomes-Tr; EBT00001554654.
DR   EnsemblGenomes-Tr; EBT00001554655.
DR   EnsemblGenomes-Tr; EBT00001554656.
DR   EnsemblGenomes-Tr; EBT00001554657.
DR   EnsemblGenomes-Tr; EBT00001554658.
DR   EnsemblGenomes-Tr; EBT00001554659.
DR   EnsemblGenomes-Tr; EBT00001554660.
DR   EnsemblGenomes-Tr; EBT00001554661.
DR   EnsemblGenomes-Tr; EBT00001554662.
DR   EnsemblGenomes-Tr; EBT00001554663.
DR   EnsemblGenomes-Tr; EBT00001554664.
DR   EnsemblGenomes-Tr; EBT00001554665.
DR   EnsemblGenomes-Tr; EBT00001554666.
DR   EnsemblGenomes-Tr; EBT00001554667.
DR   EnsemblGenomes-Tr; EBT00001554668.
DR   EnsemblGenomes-Tr; EBT00001554669.
DR   EnsemblGenomes-Tr; EBT00001554670.
DR   EnsemblGenomes-Tr; EBT00001554671.
DR   EnsemblGenomes-Tr; EBT00001554672.
DR   EnsemblGenomes-Tr; EBT00001554673.
DR   EnsemblGenomes-Tr; EBT00001554674.
DR   EnsemblGenomes-Tr; EBT00001554675.
DR   EnsemblGenomes-Tr; EBT00001554676.
DR   EnsemblGenomes-Tr; EBT00001554677.
DR   EnsemblGenomes-Tr; EBT00001554678.
DR   EnsemblGenomes-Tr; EBT00001554679.
DR   EnsemblGenomes-Tr; EBT00001554680.
DR   EnsemblGenomes-Tr; EBT00001554681.
DR   EnsemblGenomes-Tr; EBT00001554682.
DR   EnsemblGenomes-Tr; EBT00001554683.
DR   EnsemblGenomes-Tr; EBT00001554684.
DR   EnsemblGenomes-Tr; EBT00001554685.
DR   EnsemblGenomes-Tr; EBT00001554686.
DR   EnsemblGenomes-Tr; EBT00001554687.
DR   EnsemblGenomes-Tr; EBT00001554688.
DR   EnsemblGenomes-Tr; EBT00001554689.
DR   EnsemblGenomes-Tr; EBT00001554690.
DR   EnsemblGenomes-Tr; EBT00001554691.
DR   EnsemblGenomes-Tr; EBT00001554692.
DR   EnsemblGenomes-Tr; EBT00001554693.
DR   EnsemblGenomes-Tr; EBT00001554694.
DR   EnsemblGenomes-Tr; EBT00001554695.
DR   EnsemblGenomes-Tr; EBT00001554696.
DR   EnsemblGenomes-Tr; EBT00001554697.
DR   EnsemblGenomes-Tr; EBT00001554698.
DR   EnsemblGenomes-Tr; EBT00001554699.
DR   EnsemblGenomes-Tr; EBT00001554700.
DR   EnsemblGenomes-Tr; EBT00001554701.
DR   EuropePMC; PMC2758330; 19725515.
DR   EuropePMC; PMC3063597; 20679207.
DR   EuropePMC; PMC4313276; 25232167.
DR   EuropePMC; PMC5069857; 27777622.
DR   EuropePMC; PMC5073890; 27769168.
DR   EuropePMC; PMC5630571; 28986542.
DR   EuropePMC; PMC5767839; 29348922.
DR   EuropePMC; PMC5938282; 29740597.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP000721.
DR   SILVA-SSU; CP000721.
DR   StrainInfo; 125257; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  3634512
CC   Source DNA and bacteria available from Hans Blaschek
CC   (blaschek@uiuc.edu)
CC   Bacteria available from NCIMB: NCIMB 8052
CC   Contacts: Hans Blaschek (blaschek@uiuc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6000632
FT                   /organism="Clostridium beijerinckii NCIMB 8052"
FT                   /strain="NCIMB 8052"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290402"
FT   gene            280..1629
FT                   /locus_tag="Cbei_0001"
FT   CDS_pept        280..1629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase; KEGG: cpf:CPF_0001 chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32191"
FT                   /db_xref="GOA:A6LPB1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPB1"
FT                   /protein_id="ABR32191.1"
FT                   /translation="MDADLKNLWDKTLDIIKSELSEVSFNTWIKSCEPLSISSNTLKIS
FT                   VPNSFTQDILDKRYKDLVANSIKAVCSKLYTIEFIIMSEIYEKEEIKSSSNQKSKAIVV
FT                   NDEMSSTLNPKYTFNSFVIGNSNRFAHAASLAVAESPAKAYNPLFIYGGVGLGKTHLMH
FT                   AIGHYILDGNPNAKVVYVSSEKFTNELINAIKDDKNEEFRNKYRNVDILLIDDIQFIAG
FT                   KERTQEEFFHTFNALHDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQVPDFET
FT                   RMAILKKKADVENLNVANEVMGYIATKIKSNIRELEGALIRIIAYSSLTNREVTVDLAT
FT                   EALKDIISKKQGKHVTIDLIQDVVSSYFNLRVEDLKSQRRTRNVAYPRQIAMYLSRKLT
FT                   DMSLPKIGEEFGGRDHTTVIHAYEKISENLKTDDSLQSTVNDITKKLTQN"
FT   gene            1891..2991
FT                   /locus_tag="Cbei_0002"
FT   CDS_pept        1891..2991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain; KEGG: cpr:CPR_0002 DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32192"
FT                   /db_xref="GOA:A6LPB2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPB2"
FT                   /protein_id="ABR32192.1"
FT                   /translation="MIFTCEKQKILEGISIVQKAITGKSTMPILEGIYINANNSTITLI
FT                   GSDMDVSIQTLVDATIMEEGSIVIDAKIFGEIIRKLPNSTIRIETMENQLIKITCEKSI
FT                   FDVVYMNTNEFPELPEINENLKISVNQNILKNMIKGTSFAIAQDETRPILQGILFEVRN
FT                   KNLNLVALDGYRLAIKSEFLDTDIDIEVVIPGKTLNEVSKILEDIDEIVDITFTNNHIL
FT                   FNLKRTKIISRLLEGKFINYKSLLPQEHKLFVNVNRQELQNAIERASLMAKDGNTNLIK
FT                   LDLHQDNLVITSNSQLGKVRDEISIKLQGDEIEIAFNSKYLLDVLKNMEDNEVVMKMTS
FT                   GISPCVIEEHNNENAKYLVLPVRLMR"
FT   gene            3022..3234
FT                   /locus_tag="Cbei_0003"
FT   CDS_pept        3022..3234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0003"
FT                   /product="S4 region, YaaA"
FT                   /note="TIGRFAM: S4 region, YaaA; PFAM: RNA-binding S4
FT                   domain protein; KEGG: cpr:CPR_0003 S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32193"
FT                   /db_xref="GOA:A6LPB3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPB3"
FT                   /protein_id="ABR32193.1"
FT                   /translation="MKMNKIKIDTEIIKLDAFLKWASIASSGSEAKIYVQDRMIKVNGE
FT                   VCTQRGKKLRIGDVVNFEGSDFEII"
FT   gene            3283..4386
FT                   /locus_tag="Cbei_0004"
FT   CDS_pept        3283..4386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: cpr:CPR_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32194"
FT                   /db_xref="GOA:A6LPB4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPB4"
FT                   /protein_id="ABR32194.1"
FT                   /translation="MYVKNINLLNYRNYKKLSVELTENVNVFVGDNAQGKTNILESVYY
FT                   CAFAKSHRTSKDKELINWENSTAYISLLIGKNRLDKKIDINILRDGKKAIKVNNIKVNK
FT                   IGELFGIFNVVMFSPEDLKVIKEAPSLRRRLLDMELSQVNPNYYFNLVQYNKVLGERNI
FT                   LLKSRSFSEDILDVYDIQLSKYADYIISKRLEYINKINFYGDIIHREITSGKEEINFKY
FT                   NCTVNLENGKFKDNYLKKLKDNIQKDREKGLTSVGPHRDDFSVFINNIDTKIFGSQGQQ
FT                   RTSILTMKFASLKIIREITGEYPVLLLDDVLSELDLNRKKYILRSIKDIQTIITCAGIE
FT                   DLNDYLDDKVKIFNVSNGQILNQGRNI"
FT   gene            4386..4646
FT                   /locus_tag="Cbei_0005"
FT   CDS_pept        4386..4646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32195"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPB5"
FT                   /protein_id="ABR32195.1"
FT                   /translation="MFLHLGENVVVPIKDIIGIFDLQNTMYSSDTIQFLRLAEEDGFVE
FT                   RITEEKPKSFIIAEVDNKSKIYLSPISSTTLTKRTDIEYSS"
FT   gene            4701..6608
FT                   /locus_tag="Cbei_0006"
FT   CDS_pept        4701..6608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: cpr:CPR_0006 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32196"
FT                   /db_xref="GOA:A6LPB6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPB6"
FT                   /protein_id="ABR32196.1"
FT                   /translation="MEQNNRKYDENQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEI
FT                   VDNSIDEALAGYCNKIEVYINEDNSITVNDDGRGMPVGIHPKMGKSTVEVIMTILHAGG
FT                   KFGGGGYKVSGGLHGVGASVVNALSEECTVTVNRDGHIWQQKYSKGKVLNELTKVGDSD
FT                   QTGTQTYFKPDAEIFDEIVFDFEILSQRLRELAFLNKGIYIRLVDKRDEKEEVFHYEGG
FT                   IKSFVSYLNRNKVPLHEEPIYIEGVKDNISVEVALQYNDGYTENIFSFANNIDTVEGGT
FT                   HLVGFKTALTRVFNDYAKKFGHIKENDKNFTGDDIREGLTGVISIKIEEPQFEGQTKTK
FT                   LGNSEVRGIVDSIVGENIGIFLEENPNIGKMIVDKALMAARARDAARKARELTRKSVLE
FT                   RSTLPGKLADCSSKDPRECEIYIVEGDSAGGSAKQGRNRKFQAILPLRGKILNVEKQRL
FT                   DRILNADTIRSMITAFGAGIGNDFDVEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYM
FT                   RNLIDDGHVYIAQPPLYKVSKSKKEYYAYSDPELESVLSELGGKDNSTDIQRYKGLGEM
FT                   NASQLWDTTMDPEKRILLKVNIEDAMAADEIFTILMGEKVEPRKEFIQQNARNVVNLDI
FT                   "
FT   gene            6632..9118
FT                   /locus_tag="Cbei_0007"
FT   CDS_pept        6632..9118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: cpr:CPR_0007 DNA gyrase, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32197"
FT                   /db_xref="GOA:A6LPB7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPB7"
FT                   /protein_id="ABR32197.1"
FT                   /translation="MDFNEGKVIPVDIKNEMKKCYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYSLQELGLTPEKGYRKCARIVGDVLGKYHPHGDSSVYDALVRMAQDFSMRYMLVD
FT                   GHGNFGSVDGDSAAAMRYTEAKMNKIAVEMLRDINKNTVDFMPNFDGEEQEPVVLPSRF
FT                   PNLLVNGSSGIAVGMATNIPPHNLAEIIDGTIMLIDNPESTVLELMTKITGPDFPTGAT
FT                   IMGKAGIRAAYETGKGKIIVRANAEIEEENGRHSIIVTEIPYQVNKAKLVENIADLVKD
FT                   KKITGISDLRDESDRDGMRIVIELKRDANPSVVLNLLYKHTKLQDTFGIIMLALVNNEP
FT                   KVLNLKQILENYVEFQKEVITRRTIFDLNKAEARAHILEGLKIALDNIDEVISIIRNSN
FT                   TTEIAKNTLMERFELSEKQSQAILEMRLRRLTGLERGKIEEEYNELMKQIEYLKSILAS
FT                   EEKLLDVIKEELLEIKNRYSDERKSKIEKIVNEIDIEDLIQEEDVVITLTHSGYIKRIS
FT                   ADTYSSQRRGGKGIQAMSTKEDDFVEHLMITSTHSDVLFFTNKGRVYKLRAYEVHDAGR
FT                   QAKGTNLINLIAIEPDEKIQTVLTVTDEKKEGFLFMGTKQGIVKKTPLSEFKNLRKNGL
FT                   IAISLKDGDELLKVKNTYGDANIMVVTQNGYAVKFNERDVRSMGRTASGVKAINLKEDD
FT                   IAVCMDIAVDGEELLVISENGYGKRTPIAEYKLQNRGGVGLITYKISEKTGKLAGATIC
FT                   KVDDELMLINSSGVAIRINVADISVTSRSAMGVTLMRTNEDEKVVAIAKILSSDDQETE
FT                   SGDEAESESEINNIEE"
FT   gene            9623..11127
FT                   /locus_tag="Cbei_R0001"
FT   rRNA            9623..11127
FT                   /locus_tag="Cbei_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            11348..14256
FT                   /locus_tag="Cbei_R0002"
FT   rRNA            11348..14256
FT                   /locus_tag="Cbei_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            14369..14484
FT                   /locus_tag="Cbei_R0003"
FT   rRNA            14369..14484
FT                   /locus_tag="Cbei_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            14528..14604
FT                   /locus_tag="Cbei_R0004"
FT                   /note="tRNA-Met1"
FT   tRNA            14528..14604
FT                   /locus_tag="Cbei_R0004"
FT                   /product="tRNA-Met"
FT   gene            14606..14681
FT                   /locus_tag="Cbei_R0005"
FT                   /note="tRNA-Ala1"
FT   tRNA            14606..14681
FT                   /locus_tag="Cbei_R0005"
FT                   /product="tRNA-Ala"
FT   gene            14767..15282
FT                   /locus_tag="Cbei_0008"
FT   CDS_pept        14767..15282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0008"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="KEGG: cno:NT01CX_0854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32198"
FT                   /db_xref="GOA:A6LPB8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPB8"
FT                   /protein_id="ABR32198.1"
FT                   /translation="MFLYRIKQFYWAIESIFIKEDMEMLKKYLSISELNLFMKLTKSER
FT                   QHSIRVCRTAIKYIDDNNIVDIDKKRMSKCALLHDIGKLESELNIFYKCIIVFLNSITR
FT                   GKFLKYNKNKKIISYYNHPEIGARLIESINNDECLEVINSIKYHHNKGDIDSKNIYLKV
FT                   LSISDDCN"
FT   gene            15297..15818
FT                   /locus_tag="Cbei_0009"
FT   CDS_pept        15297..15818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0009"
FT                   /product="3H domain protein"
FT                   /note="PFAM: 3H domain protein; Helix-turn-helix, type 11
FT                   domain protein; KEGG: cac:CAC0009 uncharacterized conserved
FT                   protein, ortholog of YrxA B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32199"
FT                   /db_xref="GOA:A6LPB9"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPB9"
FT                   /protein_id="ABR32199.1"
FT                   /translation="MNSIERREDIIKLLLESNEPLKGSFIAKRYSVTRQVIVKDIAILR
FT                   AKGKNIIATPDGYIINANNNKAKAIIAVSHTEDEMIEELSIVIKYGGMIEDVVVEHPLY
FT                   GEIKGMLMIKNYNELNKFIEKYNEQKAKLLSALTNGVHLHTIAAETQDDIDLIILELKK
FT                   NNFIVSDLED"
FT   gene            15821..17206
FT                   /locus_tag="Cbei_0010"
FT   CDS_pept        15821..17206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0010"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG: cpr:CPR_0012
FT                   BFD-like 2Fe-2S binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32200"
FT                   /db_xref="GOA:A6LPC0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPC0"
FT                   /protein_id="ABR32200.1"
FT                   /translation="MDYDVLILGGGIIGCAVAYELSKYNINIALIEKGYDVANDISFAN
FT                   TAVVYDGSESSSSKMALLEKRGIDIIRKHCKKFNVRYNKIGSLRLFLDESSELLNKVYS
FT                   DSRDRGIDGVSIIDSDELYNVEPSLNLKANKAIYSDNTSIISPYNLAVSYAEIAVDNGV
FT                   NFRLEEEVIDIKTISKGFRVTTNKNKFTCKLVINTIPNESFNDMCSNVKSKMKNEKVRC
FT                   IIVKKSIGDNLKKIIIEDIDEENSMIKVPISENENLIGIKISDNFSAKSELPERILKNI
FT                   KKESIVNIFTEVYSENDMLIDDSNLEDGYIKVIGNHYAKISVAPAIAQDIEKKVKVSMN
FT                   ITKKKDYIDKKRETYIFREMTKDQINRIISLDKRYGNIICNCNNISEGEIIDSIRRPLG
FT                   ARTVEGVKRRTGIGLGNCNGSSCNIKIIKILAREMDKSVLDIVDDSMDSQILVGRIKEF
FT                   NEI"
FT   gene            17223..17450
FT                   /locus_tag="Cbei_0011"
FT   CDS_pept        17223..17450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0011"
FT                   /product="protein of unknown function DUF1667"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   cpr:CPR_0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32201"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPC1"
FT                   /protein_id="ABR32201.1"
FT                   /translation="MPNKDVFTSLVRVKGNINYKVVSVKSNKSVEKHLWKEFSKVLSRI
FT                   YVSTPTNIGDNICKNILNTGVDIICTRKIK"
FT   gene            17570..17660
FT                   /locus_tag="Cbei_R0006"
FT                   /note="tRNA-Ser1"
FT   tRNA            17570..17660
FT                   /locus_tag="Cbei_R0006"
FT                   /product="tRNA-Ser"
FT   gene            17691..17781
FT                   /locus_tag="Cbei_R0007"
FT                   /note="tRNA-Ser2"
FT   tRNA            17691..17781
FT                   /locus_tag="Cbei_R0007"
FT                   /product="tRNA-Ser"
FT   gene            18025..18115
FT                   /locus_tag="Cbei_R0008"
FT                   /note="tRNA-Ser3"
FT   tRNA            18025..18115
FT                   /locus_tag="Cbei_R0008"
FT                   /product="tRNA-Ser"
FT   gene            18134..18224
FT                   /locus_tag="Cbei_R0009"
FT                   /note="tRNA-Ser4"
FT   tRNA            18134..18224
FT                   /locus_tag="Cbei_R0009"
FT                   /product="tRNA-Ser"
FT   gene            18350..18865
FT                   /locus_tag="Cbei_0012"
FT   CDS_pept        18350..18865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0012"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dsy:DSY1661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32202"
FT                   /db_xref="GOA:A6LPC2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPC2"
FT                   /protein_id="ABR32202.1"
FT                   /translation="MLSGSKVYLRVLKKEDISILFKLHSEEKVKKYNIIIDSMDNKVDL
FT                   RKALSIINEDDNLIGFVTYKEQGHYSRIYCIGITIGSEYWGRSYGVDSIKILLRYLFKK
FT                   LNAIKVELYVASYNMRAINCYKKCGFIEEDIKRYSSYIDREYIDIIIMGIIRERYNSYL
FT                   KCEDGKYV"
FT   gene            18862..22341
FT                   /locus_tag="Cbei_0013"
FT   CDS_pept        18862..22341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0013"
FT                   /product="ATP-dependent nuclease subunit AddB"
FT                   /note="TIGRFAM: ATP-dependent nuclease subunit AddB; KEGG:
FT                   cpe:CPE0020 ATP-dependent deoxyribonuclease chain B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32203"
FT                   /db_xref="GOA:A6LPC3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPC3"
FT                   /protein_id="ABR32203.1"
FT                   /translation="MSIRFVYGRSGTGKSKFCIDEIKNNIDKKLDFNKLILLVPEQYTF
FT                   MTENKILHEIGENAFFRTEVLSFKKMAHNIFEEYGGRVKEIIKESGRNMLIHRVINENI
FT                   EFLDYFNRMSREQGFNEIISEVISEFKKYNISIDSIRAIDEKINDAELYQKVKELMIIY
FT                   EAFNLKMHENYIDGDDELTLLDKKLLESSAYVDSEVWIDEFTSFTPQQLDIIKVLAKRC
FT                   RRVNITFCIDNKSLNNNSEDITDVFNIIKSTENKILKIMKENNIAYDKPVNLNNAIPYR
FT                   FKGNLELDHIEKYFFSYPFNEYDKNPESITLYKASNIYDEIERVSKSITSLVRENGYRY
FT                   RDISVVCRNIDDYEKIISVIFKDYNIPYFLDKKIQLLSNPLIVLISSAFEILLKNWSYE
FT                   SVFKYLKSGLTGIDNSYIDRLENFILEYGVKGYKWTSKEIVNEKWFRGNGELTDDKVLI
FT                   AEIMEEIRYPLMTFHNKVNGKHKVKDICSAIYEFLVDVKVFDRINEWIKNFEELGLEDK
FT                   VKEYSQVESIVIDIIDQAVDVIGEERLEYSEFFRILSSGFANEEIGIIPVALDQVNIGD
FT                   IARIKGRDVKVLYIVGINDGVLPASKKEEGLLSDRDRTTLGEVGINLSSTTRNKVFEEQ
FT                   YLLYMALTISSEYLMLSYPMADFEGKSLRPSIVISRIKKIFPNLIEESAIYDLKILENK
FT                   FGKIIAPIPTFNELIISMRKDFDKEYIEPYWSEVYEWFKNNDEFRDKVKNIFKGLSYSN
FT                   IGDKVSKNKLRKLYQNDLEKLVFSVSKLEKYAECPFSYFVQYGLKAKNRKVYEFTPPDL
FT                   GSFVHEMLDSFTNKVREDGVLWSDLSNEKCKEIISNLIDKKLMDESNSILNSTKKFKYL
FT                   AQRFKRVISKSVSVIASQIGKGEFEVFKTEFDFGSYSSGEAITLDLNDNEKVYLQGRID
FT                   RIDKLDLDGETYIRIIDYKTGAKKFDLNEIYYGLQVQLLVYLDALIKNSKYILDKQVKP
FT                   GAILYFKIDDPIIKSKKEMTDEEVEKEVLSALKMKGLVLKDARVVKAMDKDIEGYSLVI
FT                   PASFKADGGFKATSDVVTEEEFRILREYVNRKMIEICEEMLSGDIKIQPTKNSNIAHCE
FT                   YCDFSSICQFDTEIKDNKYKIIINKSTNDIWNNIKKEIDNSNKLIKVENEEV"
FT   gene            22434..26171
FT                   /locus_tag="Cbei_0014"
FT   CDS_pept        22434..26171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0014"
FT                   /product="Recombination helicase AddA"
FT                   /note="TIGRFAM: Recombination helicase AddA; PFAM: UvrD/REP
FT                   helicase; KEGG: cpf:CPF_0025 ATP-dependent nuclease,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32204"
FT                   /db_xref="GOA:A6LPC4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPC4"
FT                   /protein_id="ABR32204.1"
FT                   /translation="MGNTKWTDEQLSAIETRNCNLLVAAAAGSGKTAVLVERIIRIITN
FT                   EENPVDIDKLLVVTFTNAAAAEMRERIADAISKELENNPRSKNLQRQLTLLNRANITTM
FT                   HSFCLDVIKNNYHRIDLDPSFRIGDQTEGILIKSEVIEELFEDKYEEEDIGFTNLVEIF
FT                   SSYKNDNNLKNLVLDLYNFTMSGPWPEKWLINSAEAFNIKQLDELDRTNWVRVLAQSVK
FT                   IELDGYVKMLEKAIEVTSKTDGLEPYMDNLLMELSYIKKAYESTDNGLEAMFNSLSSVQ
FT                   FSRLKSIKKDKVSDELSQNTVKKIRDDVKKGISELLNNAYSVNPQQMLRNIQGSYPYIK
FT                   KLIELVLEFSARFSKRKRERNILDFNDLEHLCLKILSDYDDENNIIPSSIAMNFKEYFD
FT                   EVLVDEYQDSNNVQETIINLVSRKNDDNPNVFMVGDVKQSIYRFRQAKPELFIEKYNTY
FT                   DSSNGVNRKIQLYKNFRSRREIIDGVNYIFKEVMSEVVGELEYTDEEALNLGADFKENK
FT                   FKDTIVGGPIEVNIIDKSHNETVVEDNEEQEEINNVILEGRIVAKRIKELMSKSEDEQI
FT                   FKVLDKESGEYRPLKYRDIVILLRATKNWSEPLLDELSAEGIPVYADTGSGYFESIEIR
FT                   TIISLLKVVDNPMQDIPVISVMRSPIMGFSAEEISDIRLVKKDNYFYENIKYISEEAYN
FT                   SINESYSDVLIAKCKYFINSVDKWRNKSIYMAIDEFIWYLYMDTAYYGYVGAMPNGVLR
FT                   QANLKILFQRARQFEKTSFKGLFNFINFINKLIKSSGDMGSAQVLGENEDVVRIMSIHK
FT                   SKGLEFPVVFLCGLGKNFNLMDLNKSILYHDELGLGPDFIDIGKRFSIGTLAKESIKKK
FT                   MKFETLSEEMRILYVACTRAKEKLIMTGTVGNLEKSAEKWLGSASLDYNRISPSEVLKG
FT                   KSYLDWICMSLCQHRDGSVLSESFGTENLILKDDNSRWKVSFWNKGDLIDKTKTEVLEQ
FT                   GEGYELTIINNKPYDNYLYEEVDKILSYKYPFKASTTIKSNISVSDLKRRHAEEDYDTE
FT                   QLYREKVKVVPKFLQEKKGLTPSEKGTAVHFVMKKIDFNRVSSTEEIKEQLHELFEKEF
FT                   LLSEELKVINPTKILSFFRSDLGKKILDLNCRGEKIYREIPFYTEISSLEVDKTLDNIY
FT                   KDEKIRLQGIIDCFFEYKGDIILIDYKTDYIMEGHEDEFKEKYRKQLDYYSDAIFKLTG
FT                   KKVKYKYLYSFYLEKEIKII"
FT   gene            complement(26242..27423)
FT                   /locus_tag="Cbei_0015"
FT   CDS_pept        complement(26242..27423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0015"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   cpf:CPF_0028 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32205"
FT                   /db_xref="GOA:A6LPC5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPC5"
FT                   /protein_id="ABR32205.1"
FT                   /translation="MSINTFYYKKLKTKKLPKRIIYVLALLITLSSSCFYELYSYNKLL
FT                   NNFKSDFDNYKFSEANNLLITKQNFNPFKLSMISHDVSKYLRTKINTLSDEIQDKKISS
FT                   EDALIQVKEIKRYNLVNDDDLHNASDSIDLIQDSIKNYNSGINSFNNEQYSEAISFFKK
FT                   VSALDLNYTDSLIYLDESKSKLKEDLFAYCDNLISNDYYSEAMSKISDNNDLLGDDIDV
FT                   KEKIADIKEKQQEYLDKNSAIAEASSRALTTNITSKNINTLNIESTTPYLINVNIQDQK
FT                   TYVYKGKADKWHLVKAFPCSTGISGEDTPPGSFTIKERGDWFFSEEYKEGGKYWTQITG
FT                   DILFHSVPFAKDKTTVLDYTMNKPSSHGCIRLSIDDAKWIFTNIPRESKVIIK"
FT   sig_peptide     complement(27307..27423)
FT                   /locus_tag="Cbei_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.512 at
FT                   residue 39"
FT   gene            27639..28121
FT                   /locus_tag="Cbei_0016"
FT   CDS_pept        27639..28121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32206"
FT                   /db_xref="GOA:A6LPC6"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPC6"
FT                   /protein_id="ABR32206.1"
FT                   /translation="MTNKTNFFIKLITSIYDIKVFSKYAKEGILRSISYAIFLSFLLGG
FT                   LKSAFVQYKNYNLDIISLVDQTVAYFSIILFNLLLNSLIVSIVAALFAVFLRMVVKYIA
FT                   LYSLTLYAATLPLIIQIILEIANPNISFDTIFIVGTLTYVILILKYIKDEIIRNYT"
FT   gene            28292..29239
FT                   /locus_tag="Cbei_0017"
FT   CDS_pept        28292..29239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0017"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: cno:NT01CX_0224 sensory transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32207"
FT                   /db_xref="GOA:A6LPC7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPC7"
FT                   /protein_id="ABR32207.1"
FT                   /translation="MVKKVKKITKGDLKMVEVNILKDNQIDRENILNKNDLIKLSKDEL
FT                   VSKLINLSESKKNQEDFILNISHDLRSPLNIILSVLQCYKDDYKDIKRYGKCQDHMDVI
FT                   KRNSYKILKLVNNLIDTTKLEKNHYSIKRENLDVINLIEWNISSIDKYAKQKEISLVFD
FT                   TNVEECIMAVDPEAIDRIIMNLISNAIKFSPKGSNIYINAWKSINQLTISVRDEGIGIP
FT                   KEEQNTIFNRFVQSSRNKKSENSGSGIGLDLVRYLTQAHNGSIELKSEENSGCEFIIKL
FT                   PIERLQDDENNRDKCLNIKSKVEVLEVEFSDIYL"
FT   gene            29427..29501
FT                   /locus_tag="Cbei_R0010"
FT                   /note="tRNA-Arg1"
FT   tRNA            29427..29501
FT                   /locus_tag="Cbei_R0010"
FT                   /product="tRNA-Arg"
FT   gene            complement(29536..30426)
FT                   /locus_tag="Cbei_0018"
FT   CDS_pept        complement(29536..30426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0018"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related; KEGG: cac:CAC0031
FT                   phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32208"
FT                   /db_xref="GOA:A6LPC8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPC8"
FT                   /protein_id="ABR32208.1"
FT                   /translation="MIQVYNRTTKSYEEELIAGKKYIEWTYESPVGKTITELIAKKKLF
FT                   SKLYGKYCDTKLSKSKISPFVDSFNIDMAMSKKKINEFKSFNDFFTRELNFDARPINSD
FT                   NNILISPGDGRITAYEDIDLDNIIQIKGLTYSLKELINDDNVASKYKNGICVVLRLCPT
FT                   DYHRFHFIDSGIPYENHPIKGHYYSVNPIALKSVPKLFCENKREWSLFKSDNFKDVLHI
FT                   EVGATCVGSIIQTYSPRVRVNKGDEKGYFKFGGSTTILFFEQGSIEIDADIIEQSKLGF
FT                   ECKVIFGENIGTKVL"
FT   gene            30808..31392
FT                   /locus_tag="Cbei_0019"
FT   CDS_pept        30808..31392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0019"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: ctc:CTC00079
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32209"
FT                   /db_xref="GOA:A6LPC9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPC9"
FT                   /protein_id="ABR32209.1"
FT                   /translation="MNKTKNLIFESAIKIFSESGYRGATMDDIAANAGLVKGTLYYHFK
FT                   SKEEIFNFIVEEGLQILQNQVIEVQNINIGPIEKLIKICRIQLTFLYGYTDFFKIVMSQ
FT                   LWGTEHRQNELRHKIRKYINEIEINIRTAMEIGEIKKGDVELIAFQFFGSLCSSAIYES
FT                   IHIEKINLEDIIESTIKFTLNGLGIDINRYI"
FT   gene            31554..32342
FT                   /locus_tag="Cbei_0020"
FT   CDS_pept        31554..32342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0020"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: sucrose-6F-phosphate phosphohydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase, type 3; KEGG:
FT                   cpf:CPF_1058 putative Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32210"
FT                   /db_xref="GOA:A6LPD0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPD0"
FT                   /protein_id="ABR32210.1"
FT                   /translation="MKFLASDLDGTLFRDNKISEKDLDALRRLKAFGNKIIISTGRSLK
FT                   GVNSILKEYPFEYDYLVMCNGGVIMDNRNNIIHEKSIPNKIQNRIIADFYDIGDSLIYY
FT                   DDGNDTYMIENKLVDVSAVDADFFNHFSNRVTLEEALSSVSDSQIMSVFNVSQSIEKSE
FT                   LVREKLINEYDEYIEAFRNQVFVDIVAKNCSKGNAIMMILEDENKGVDSLYTVGDSMND
FT                   ISMFKITNNSYTFNSVEELIKPYADNLVDHVFEVIEDMLR"
FT   gene            complement(32490..34085)
FT                   /locus_tag="Cbei_0021"
FT   CDS_pept        complement(32490..34085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0021"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cpf:CPF_1757 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32211"
FT                   /db_xref="GOA:A6LPD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPD1"
FT                   /protein_id="ABR32211.1"
FT                   /translation="MINVSNVSLRFGGRKLFEDVNLKFTPGNCYGVIGANGAGKSTFLK
FT                   ILSGEIEPNTGEVTIAPNLRMSVLKQEHYKYDNFQVLETVIMGNERLYQIMKEKDEIYA
FT                   KPDFSDEDGIKASELEGEFAELNGWEAESEASSLLQGLGIGTDLHLKNVSELTGGEKIK
FT                   VLLAQALFGNPGILILDEPTNGLDLKAVNWLEDFLGNFDGTVIVVSHDRHFLNSVCTQM
FT                   ADVDFGKIKIYVGNYDFWYESSQLALQMSKDQNKKKEEKIKELQDFIARFSANASKSKQ
FT                   ATSRKKLLDKITLDDIQPSSRKYPFVGFKPEREVGNDILMVKDLSKTVDGVKVLDNVNF
FT                   IVNKGDKIALIGNEIAVTTLFKILSGEMEPDSGEYKWGITITNAYFPADNSKYFDDCNL
FT                   SLVDWLRQYSEEKSESYIRGFLGRMLFSGEEALKEANVLSGGEKVRCMLSKMMLSNANV
FT                   LMLDQPTNHLDLESITAVNNGLKDYNSNILFASHDHQFVQTIANRIIDIKDDGSIVDRT
FT                   MTFDEYLEFSNSNK"
FT   gene            complement(34318..34911)
FT                   /locus_tag="Cbei_0022"
FT   CDS_pept        complement(34318..34911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0022"
FT                   /product="Domain of unknown function DUF1836"
FT                   /note="PFAM: Domain of unknown function DUF1836; KEGG:
FT                   cpf:CPF_1724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32212"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPD2"
FT                   /protein_id="ABR32212.1"
FT                   /translation="MNDFNIDAYINSQKSSNNINLNDFPEIDLYMDQVMQLFESKLSYT
FT                   KRNDDDKVLTKTMINNYAKGNLLMKIKNKKYTKSHLILMGLIYNLKGALSLTDIKTILS
FT                   PIINAFEKEEEYPLHDIYQSFLDIYDSNLDDLKSSSTKIYDNITNLISNEDNSLGDYEE
FT                   KLLLICAYVSMSNLYRRMSEKIIDECFGSAKNYK"
FT   gene            35133..35780
FT                   /locus_tag="Cbei_0023"
FT   CDS_pept        35133..35780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0023"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: bca:BCE_5590 channel
FT                   protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32213"
FT                   /db_xref="GOA:A6LPD3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPD3"
FT                   /protein_id="ABR32213.1"
FT                   /translation="MEKYLREPINGLTHFIGAVLSLFALIAMLVKVYTRGSSTITFVSV
FT                   LFFGISMILLYSASATYHSVIANDKVIKILKRLDHSMIFILIAGSYAPFCLVALNGKVG
FT                   INLFLAVTICAVIGIAFKLCWVTCPRWLSSSMYIGIGWFAVFAIYPMSQVLSSFGLSWL
FT                   VLGGIMYTIGGIIYALKSDKIKVWLFGRHEIFHIFIMLGTLCHFICVFVYII"
FT   gene            36010..36813
FT                   /locus_tag="Cbei_0024"
FT   CDS_pept        36010..36813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0024"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: cpf:CPF_2904
FT                   glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32214"
FT                   /db_xref="GOA:A6LPD4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPD4"
FT                   /protein_id="ABR32214.1"
FT                   /translation="MGFRQRLKDASRIVVKVGSSTLTYDNGNINLSRIEKLTRVLSDVV
FT                   NSGKQVTLVTSGAVAVGVNKLKLKEKPESIREKQAVAAVGQCELMHIYSKFFGEYSHVV
FT                   GQVLLTRDVVEDDHIRENVCNTFETLLDNNIIPIVNENDTVSIDEIENIVRFGDNDNLS
FT                   AIVASLINADLLIILSDIDGFYDSDPRNNESAKLLNEVREITPELEECAGGAGSNLGTG
FT                   GMITKLSAAKTSTKAGVDMILANGSEPDIIIDILKGEEIGTLFVS"
FT   gene            36839..38083
FT                   /locus_tag="Cbei_0025"
FT   CDS_pept        36839..38083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0025"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: cpe:CPE2578 gamma-glutamyl
FT                   phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32215"
FT                   /db_xref="GOA:A6LPD5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPD5"
FT                   /protein_id="ABR32215.1"
FT                   /translation="MSELIIKGQNAKNASYDLGIASTKQKDDALMIMAEELIKAKGDII
FT                   SANKIDLDAAVLKGTSKAMLDRLALTDERIESMAAGLKDVIKLQDPIGEVISMWQRPNG
FT                   LQIGQKRVPLGVIGIIYEARPNVTCDAAGLCIKTGNAVILRGGSEAINSNKAIVKALTK
FT                   GIERSGLPKASVQLVEDTSREVATEMMRLNEFIDVLIPRGGAGLIQAVLKNATVPVIET
FT                   GTGNCHIYVDKDCDFEMAKNIVINAKASRPSVCNAAEKLLINEKIVEDFLPIVVKALRE
FT                   NGVAVKGDEVSQSIINDIEKAAEEDWGKEYLDYIIAVKVVKDVDEAISHINKYGTGHSE
FT                   AIITESYKNSQKFLQRVDAAAVYVNASTRFTDGSEFGFGAEIGISTQKLHARGPMGLKE
FT                   LTTIKYIIYGNGQIR"
FT   gene            38358..38717
FT                   /locus_tag="Cbei_0026"
FT   CDS_pept        38358..38717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0026"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="TIGRFAM: methylglyoxal synthase; PFAM: MGS domain
FT                   protein; KEGG: oih:OB1767 methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32216"
FT                   /db_xref="GOA:A6LPD6"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPD6"
FT                   /protein_id="ABR32216.1"
FT                   /translation="MKIALIAHDKKKEDIIEFSKKYKDVLAKYELVATGTTGTKISEAT
FT                   GLEVKRYLSGPYGGDQQLGGRIAEGKIDLVIFFTDPLTAQPHEPDVSALLRVCNVHNVA
FT                   VVTNIKTAELIIKQF"
FT   gene            38976..39755
FT                   /locus_tag="Cbei_0027"
FT   CDS_pept        38976..39755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0027"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   cno:NT01CX_0219 probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32217"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPD7"
FT                   /protein_id="ABR32217.1"
FT                   /translation="MTDLNRYTLITGGSDGIGFELAKIYAKNKDNLIIIAKDEIKLRNA
FT                   KSRLEDQYGVIVEIIQCDLSVDKGYKKIIEVVEEKNLIVDNLINNAGIGCFGFFHDLEE
FT                   GLEEKIININITALTMLTKYFSKKMVERRHGGILNVASTAAFISGPKMSIYYSSKAYVL
FT                   SLTEAIHDELKDLGIRVSCLCPGPVRTSFQEKAGIKKSQRSKRYLMNASDIAKYAYREF
FT                   SMGRTIIIPGYKNKLLILGNKLIPRALGRRIILKNNS"
FT   gene            40396..41445
FT                   /locus_tag="Cbei_0028"
FT   CDS_pept        40396..41445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0028"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain; KEGG:
FT                   cpf:CPF_2898 carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32218"
FT                   /db_xref="GOA:A6LPD8"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPD8"
FT                   /protein_id="ABR32218.1"
FT                   /translation="MKAKLILENGMIFEGKAFGYLKESVGEVVFTTGMTGYQEVLTDPS
FT                   YYGQIVTMTYPLIGNYGINLEDMESDSIKVRGFIVREKCNMPSNFRCELELEDFLKQGK
FT                   VIGLEGIDTRALTKVLRNSGTMRGLIALEDVDDEYVKEKIAGFSTKEAVKTVTTSKFYV
FT                   VEGTGKHIAVMDFGIKTNIIRNFKKRGCKLTIFPATATAEEVLNINPDLIFLSNGPGDP
FT                   EDLDFAIENIKKLVGKKPITGICLGHQLLGLALGGKTTKLKFGHRGCNHPVKDLEANIV
FT                   HITSQNHGYVVEKLPDDMEVTHVNINDGTVEGMKHKTLPIYSVQFHPEASAGPKDSEYI
FT                   FDKFLEYAL"
FT   gene            41460..44669
FT                   /locus_tag="Cbei_0029"
FT   CDS_pept        41460..44669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0029"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; MGS domain protein; KEGG: cpe:CPE2572
FT                   carbamoyl-phosphate synthetase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32219"
FT                   /db_xref="GOA:A6LPD9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPD9"
FT                   /protein_id="ABR32219.1"
FT                   /translation="MPLNKDIKKVLVIGSGPIVIGQAAEFDYSGTQACEALKSEGIEVV
FT                   LVNSNPATIMTDKEVADKVYLEPLTLEFVEKVIAKERPDSLLAGMGGQTGLNLAVELHD
FT                   SGILEKYNVKVIGTSIASIKEGEDRELFRDMMNRIGEPVIKSEIVTDLTAGLEFANKIG
FT                   YPVIVRPAYTLGGSGGGIADDEEQLRTILESGLQLSTIGQVLLEKSVKGWKEVEYEVMR
FT                   DSYGNCITVCNMENIDPVGIHTGDSIVVAPSQTLSDKEYQMLRTASINIINAVGIEGGC
FT                   NVQFSLNPNSFEYAVIEINPRVSRSSALASKATGYPIAKLAAKIALGYGLDEIKNAVTQ
FT                   KTYACFEPTLDYVVVKIPKWPFDKFFGADRELGTKMMATGEIMAIGANFEQAFLKGIRS
FT                   LEIGKYSLDHNKFKEYSISKLKSIVMKPDDERIFALAEMIRRDYMIDRINKITGIDMFF
FT                   LEKIKWIVEEEQRLKLSKIEDLDKEWLHHLKKKGFSDKAIADMLKVSPDDVYRLRDIWS
FT                   IKPSYKMVDTCGGEFEALSPYYYSTYEQYDEVEVSNNKKVIVIGSGPIRIGQGIEFDYA
FT                   SVHCVKALKKLGIETIIVNNNPETVSTDFDVSDKLYFEPLTEEDVLNIIEKEKPDGVIL
FT                   QFGGQTAIKLANFLKEQNIVTLGTTADQIDMAEDREKFDELLERLGISRPKGKGIWSLE
FT                   EGLEEAKRLKFPVLVRPSYVIGGQGMEITHDEEELTYYLENAFAKDSKNPILIDKYLMG
FT                   REIEVDAISDGENILIPGIMEHLERAGVHSGDSVTMYPSQNISDKIKADVLEYTKKLAL
FT                   AIGIKGMINIQFIEFEGELYVIEVNPRASRTVPYISKVSGVPIVDLATQVMLGAKLKEL
FT                   GYGIDVYKEPELVSVKVPVFSTQKLPNVEVSLGPEMRSTGEVLGVGRNIKEALYKGFVG
FT                   AYMYPSKEKGKILATINKHDKAEFLPIAKDLASVGYKFIATSGTCALLKEAGIEVEEIR
FT                   KIDEEEPNILDIVKNREVDLVVNTPTKGNDSKRDGFLIRRAAVERNLGVITALDTLRAI
FT                   ADVELEKFDENKDLEVFNIAK"
FT   gene            44864..45097
FT                   /locus_tag="Cbei_0030"
FT   CDS_pept        44864..45097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32220"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE0"
FT                   /protein_id="ABR32220.1"
FT                   /translation="MNELGNFFVKLNCKSIDNIRSLIIDKQGNYIKQQEKYIMCAGKYD
FT                   KNGWTLVFRAKSFKEAEALANLNPFLNRRSIN"
FT   gene            complement(45219..46328)
FT                   /locus_tag="Cbei_0031"
FT   CDS_pept        complement(45219..46328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0031"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: cac:CAC0277 HD-GYP hydrolase domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32221"
FT                   /db_xref="GOA:A6LPE1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE1"
FT                   /protein_id="ABR32221.1"
FT                   /translation="MRLIPIECVRENSLLGKDIYTPDGRCLLRAGILLNDTMLQKIKEY
FT                   KIFSLYIIDDYSSAEIEDVIKPELRQKSISVIKETFSDIERIASVHKFEKRSISEYTKQ
FT                   EQQYFNSITNIAEELLDNVLSNKNILISLVDIKSMDNYTYAHCVNVAVISLILGISLNL
FT                   SKRNLTYLCIGALIHDIGKSFIPSEILQKPGKLTPEEFEVIKNHSLYGYKFLNNFFSLS
FT                   SHIKLIVLQHHERFDGLGYPNSISGNKISYLARIVSIADVYDALTSDRPYKRAMCPSDA
FT                   LEYLMSNAGTLFDHDMLNVFCKIVIPFPQGTIVSLSNGDVGVVEETMPNFPLRPTIKIL
FT                   KSDYPNKIGSKVNLIENLSIVISDIKYEI"
FT   gene            46730..47584
FT                   /locus_tag="Cbei_0032"
FT   CDS_pept        46730..47584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0032"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: cac:CAC3250 possible glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32222"
FT                   /db_xref="GOA:A6LPE2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE2"
FT                   /protein_id="ABR32222.1"
FT                   /translation="MKCGFIYLISYLRRPKYLKKWSEDVLNIKTDPIGFFDSGVGGLSV
FT                   MREAISIMPNENFIYFGDSKNAPYGIKKVIEVRDLTIDAVEFLLSKNVKAVVIACNTAT
FT                   SAAIEEIRSKYKQISIIGIEPALKPAVKLNRKGQIIIMATPMTLREKKFKLLMDKYKNE
FT                   ADIISLPCAGLVEFIEQGIVEGEDLEYYLKEKFKGYLDNDISSIVLGCTHYPFIKKALS
FT                   NVIGKEIPLIDGGFGTAQELKRKLIESGLLNDSKEKGNIEICNSINDDKVIDFCYSLIN
FT                   FKI"
FT   gene            47690..48214
FT                   /locus_tag="Cbei_0033"
FT   CDS_pept        47690..48214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0033"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: cno:NT01CX_0653 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32223"
FT                   /db_xref="GOA:A6LPE3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE3"
FT                   /protein_id="ABR32223.1"
FT                   /translation="MKNPIITMTMENGGVIKAELYPEAAPNTVRNFVDLINRGFYDGLI
FT                   FHRVIPNFMIQGGCPEGTGVGGPGYSIKGEFTGNGFKNTLKHTRGVLSMARAMHPDSAG
FT                   SQFFIMVADAPHLDGQYASFGKVIEGMEVADKIVAQKTDMSDRPYEDQVIKSVTVDMQG
FT                   EEIKEPKIIEE"
FT   gene            48267..48638
FT                   /locus_tag="Cbei_0034"
FT   CDS_pept        48267..48638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32224"
FT                   /db_xref="InterPro:IPR016621"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE4"
FT                   /protein_id="ABR32224.1"
FT                   /translation="MATNNKCILAYGLKEDEIKKIESQNIKVIEINKNMTLMTLEDIIN
FT                   GNKNEDSYDEMQLSEKALIFNGFKDEQLKVTIRYIRSFIQGGVLAVSTAQNYKWTFKYL
FT                   LEHLIEEREWYKEQQKGRK"
FT   gene            48640..49308
FT                   /locus_tag="Cbei_0035"
FT   CDS_pept        48640..49308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0035"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   cpe:CPE2564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32225"
FT                   /db_xref="GOA:A6LPE5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE5"
FT                   /protein_id="ABR32225.1"
FT                   /translation="MSRVGENIKQAREKSGLTVKALAKKLGVAEKYLNEVEMGRKVAPE
FT                   SLIDKAGKVLKADLNDISMVVTDEVLMEERKTLKEIPKRNVESSEVWTDAFSSVLRSVP
FT                   IYDYSLSNKKGSKEMPIHSNKIENYPQDKVFYLEIEDDEMNGFRMLKGDVAFAHAVKDI
FT                   SNSGFFLIDYKGKRKVRQIKVLGNSKLLLVSNAGSLLTETMELKEVDVIAKLERLEITL
FT                   "
FT   gene            49461..52646
FT                   /locus_tag="Cbei_0036"
FT   CDS_pept        49461..52646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0036"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; Peptidoglycan-binding domain 1 protein; KEGG:
FT                   cac:CAC3245 subtilisin like protease (two fused domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32226"
FT                   /db_xref="GOA:A6LPE6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034045"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR041365"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE6"
FT                   /protein_id="ABR32226.1"
FT                   /translation="MPELETQISSKVDASIGLLANVPKAILDELGYKYQSQGNNVELTI
FT                   LYRDTQEQTKSFVEGLGGTFQDLGFNFAVVNIPRDKLEQLSMSNSIQYIELPKNLYEQD
FT                   QESNRASCILQLAPDFDVSGEGILVGFVDSGIDYTHPAFMDSTGTSTRIEYIYDLSTGG
FT                   NVYNKQMINEAIKSNNPFSVVPSIDNSGHGTHVAGIACGGGRINPMYRGVAPNSSIAMV
FT                   KAARGTAILSSQIMQGIKFLIDKGKELNMPLVISISLSTNDGAHDGSSLLEQYIRTISN
FT                   LERVSIVIAAGNEGDAGHHVGGQLVKTQRQIFNIASEEKSIVMNFYKTILPNISVNIIN
FT                   PTSQGTGNINIQEGYIQGTIGSDRYDIYVSGPKPFELNSEIRIILSARSGFLVEGVWTL
FT                   EINVTNEYLGAYSIWLPVLEGLNPATKFLEPNQYNTLGIPATVDNIIAVGSYNYRTNNL
FT                   SSFSGRGAQDQNIVRPDLVAPGEDIAGPVPNGGYDNKTGTSMATPQVSGICALMMQWGI
FT                   VKGNDPYLFGQRLKYYLLRGARRRRTDVTYPNPSWGYGEVCIFNSLRALQNDLNAILTR
FT                   GNINSRDIQVTNSVPNKYNILRKNIKREVMENTSSGNTSTNIGRLKIQCFRGEDYIPID
FT                   GARITVRTPQGAESVNSIQLVTDSVGLTQIIELTAPPLEYSLNPNSNQVPYSLYDITVE
FT                   RDGFNPIVIRGCQVFPTQVAYQICNLTSNSGRGMMRQEVINIQPNTLNGNFPPKIPEDP
FT                   EKQLPPPSSGVVLPQPIVPEYIIVHQGGPNDPSAPNYKVPFKDYIKNVASSEIYSTWNE
FT                   SAIRANVFCIVSFTLNRIYTEWYRGKGKNFDITSSTAYDHAFNYGRNIYDSISAIVDEI
FT                   FSTYIKRVGAKQPLLTQYCDGKSVTCPQWLSQWGSQQLAQQGMVPYDILKNYYGNDIEL
FT                   TTAEKVSGSPQSYPGEPLTIGSSGPAVRTIQNQLNRIARNYPLIPKVAEDGQFNQKTAD
FT                   AVKTFQQIFTLPQTGIVDYATWYRISDIYVGVSRIAELRDSSMLRSSLGMNEFIPPIIP
FT                   GLDNKRGIPKFYY"
FT   gene            complement(52779..53747)
FT                   /locus_tag="Cbei_0037"
FT   CDS_pept        complement(52779..53747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0037"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: cpf:CPF_1251
FT                   radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32227"
FT                   /db_xref="GOA:A6LPE7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE7"
FT                   /protein_id="ABR32227.1"
FT                   /translation="MNYLDLLNECTLCNRDCKVNRNNGEIGYCKASNNIKVAKASLHLW
FT                   EEPPISQGNGSGTVFFSHCNLKCVFCQNYNISQGISVNLSSSDFNKNSIKNTSVVGAEI
FT                   SIERLSEIFLELQKKGANNINLVTPTHYVPQIIEALKIAKKNNLTIPILYNTNSYDSIE
FT                   TIKLLDGYIDVYLPDFKYFDNKYSLKYSRVNDYASNTIKIIDEMLRQVGTPKFDSKGNI
FT                   LNGVIVRHLMLPGLLFDSKKIIDILYNRYKNDIYISLMNQYIPMFNACDYPEINKKLNP
FT                   KHYDSLINYALDIGVVNGFIQDEGANISDFIPEFNLEGIEK"
FT   gene            complement(53805..54881)
FT                   /locus_tag="Cbei_0038"
FT   CDS_pept        complement(53805..54881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32228"
FT                   /db_xref="GOA:A6LPE8"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE8"
FT                   /protein_id="ABR32228.1"
FT                   /translation="MKKEMVKVFQVATVFIGTIVGAGLASGKEITEFFTQYGISSFIGI
FT                   IGCGIFYILISSIISRISINYNLSSYSDVMNIISPNIFGKITGFITTLFLISSASIILA
FT                   GSGALIHQFFGIPKIIGSLIMIAIAIFFLLRDTEGLIEVNSFIVPGLICTLTLITVLYF
FT                   AFCRNTVSLDNIASFPKQKTGIFISTVLYAGYNTLSASGVLVPLSTQMKKSKIMIAGIV
FT                   TGAIGLTILCLMINLLLTINQPYIYKYEIPLLFVANRFGNLIQALLLVIIWLEMFSTEV
FT                   SDIYSISKTLEQTFNIKFKKAIFIVISLALLISQFGFGTLITKLYPIFGLLSLIFIFQC
FT                   ILFFFKHKKDFSNTTQIK"
FT   sig_peptide     complement(54798..54881)
FT                   /locus_tag="Cbei_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.811 at
FT                   residue 28"
FT   gene            55000..55929
FT                   /locus_tag="Cbei_0039"
FT   CDS_pept        55000..55929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0039"
FT                   /product="conserved hypothetical radical SAM protein"
FT                   /note="TIGRFAM: conserved hypothetical radical SAM protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: cno:NT01CX_1004 radical SAM protein,
FT                   TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32229"
FT                   /db_xref="GOA:A6LPE9"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPE9"
FT                   /protein_id="ABR32229.1"
FT                   /translation="MNSFWDGKRYHSLNYFLRNKFGEKVFKISLDGGFSCPNRDGKISN
FT                   GGCLFCSERGSGDYAGDRELSISKQFHDIKDMMSQKWKSGKYIAYFQAYTNTYAPIDEL
FT                   KRKYEEALNQEGVVAIAIATRPDCLDDDVLELLDNINNKIYLWIELGLQTSNDDTAKRI
FT                   NRGYKLDVFENAMRKLEERNIDVVVHDILGLPGETKEDMLETINYIAHSGAKGIKLHLL
FT                   HLMKQTPMVKLYEAGDLKFLSQDDYIDLVTHGITLLPKDMVVHRLTGDAPRDLLIGPMW
FT                   SLKKWEVLNSIDKTLEDNNLWQGKNFRE"
FT   gene            55970..56686
FT                   /locus_tag="Cbei_0040"
FT   CDS_pept        55970..56686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0040"
FT                   /product="2-phosphosulfolactate phosphatase"
FT                   /EC_number="3.1.3.71"
FT                   /note="PFAM: 2-phosphosulfolactate phosphatase; KEGG:
FT                   cno:NT01CX_0616 probable 2-phosphosulfolactate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32230"
FT                   /db_xref="GOA:A6LPF0"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPF0"
FT                   /protein_id="ABR32230.1"
FT                   /translation="MKIDIIISADDIVESRVRNKIAVIIDIFRATSVIITALDNGAREV
FT                   IPYLTIEETLEYAKKLSRDNYILGGERKAVKIEGFDLSNSPLEYIKEKVEDKTVLMTTT
FT                   NGTRALTKSMEAKRVFIGAMINGESVAKKLININDDVVIINAGTNGNFSMDDFICSGYI
FT                   INRILDVNRNIELTDIAKTACMIYKENINILSYVREASHYSVMKSLGLNNDIDYCIKKS
FT                   IIDIVPEYKDGKITCE"
FT   gene            complement(56788..57006)
FT                   /locus_tag="Cbei_0041"
FT   CDS_pept        complement(56788..57006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0041"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: cac:CAC0669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32231"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF1"
FT                   /protein_id="ABR32231.1"
FT                   /translation="MENNLNEAILDKLTKTCTCKAIPRSKIKEAIKNGASTIKEVQKAT
FT                   GAGSGSCGGRNCSPRINDLLKQSRENI"
FT   gene            57280..57963
FT                   /locus_tag="Cbei_0042"
FT   CDS_pept        57280..57963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0042"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cpf:CPF_1139 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32232"
FT                   /db_xref="GOA:A6LPF2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF2"
FT                   /protein_id="ABR32232.1"
FT                   /translation="MIKVLLVEDNIEISQNIVEYFRDELEIKAVYNGSDAMECLSIYNY
FT                   DIVILDLMLPEVSGMSVLSHISKNCLNTGVIILTAKEELGDKLKAFNLGANDYLTKPFF
FT                   MEELKARINSILKSMGKVKRANLLEFKDMKIDMKVKKVYIGTNELELNEKLYKLLEYMV
FT                   INKGVLLFKEQIFDNVCGYNSDAATEIIEVYISRLRKQLGTFGYGKYLITKRGMGYLLD
FT                   ESIED"
FT   gene            57967..59316
FT                   /locus_tag="Cbei_0043"
FT   CDS_pept        57967..59316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0043"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: cpf:CPF_1140 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32233"
FT                   /db_xref="GOA:A6LPF3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF3"
FT                   /protein_id="ABR32233.1"
FT                   /translation="MKKDIFLSTKKKIIATSTIIVFGCLIVFAIITQVLYSSRVLDVID
FT                   HQLLEQKEILTKEQFNPNYYEYIFNEDRHNLDGDLHKDEFKNPDGGENPHRPENFDGKL
FT                   DSKPKRIPPNLIVIVYKNNEFETMSRNLYFSKDNLPTISNDAENEVVTIINNGYNFREI
FT                   AISSGEYKIQVIANIDSEVNSINRLRYSIAVSLIILIIIAIILSAYLSTKVIRPVREAY
FT                   EKQVYFVQDASHEMRTPLAVIKGKLELLAHSWGDTIDNHFEHISKMMSEVRGLEKLNSD
FT                   LLLLSKEDLDLSINITKFKLDDLINDISEFYFDLAEIKEKIFKVAKPEEEISVQWDYDK
FT                   IKRAIIILIENAFKYTGEDGKINLVIEDVNKHIRIMVVDNGIGIKKDEEKRIFDRFYRS
FT                   DIVRGQNINGTGIGLSLLKSISKNFGIKLKVNSEYGVGSEFILLIPKIIK"
FT   sig_peptide     57967..58056
FT                   /locus_tag="Cbei_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.791 at
FT                   residue 30"
FT   gene            complement(59470..59835)
FT                   /locus_tag="Cbei_0044"
FT   CDS_pept        complement(59470..59835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32234"
FT                   /db_xref="GOA:A6LPF4"
FT                   /db_xref="InterPro:IPR019206"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF4"
FT                   /protein_id="ABR32234.1"
FT                   /translation="MLNCKKVLNYMFFCHQLPERSFFFRGHQFPLCARCTGILLGYILG
FT                   LTYVILSKNIHIIIELLLMLPLLIDGFGQYLMYFKSTNTRRLITGILAGISTICLFRLA
FT                   IVLGLQSGHWFYNFIHI"
FT   gene            complement(59841..60143)
FT                   /locus_tag="Cbei_0045"
FT   CDS_pept        complement(59841..60143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32235"
FT                   /db_xref="GOA:A6LPF5"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF5"
FT                   /protein_id="ABR32235.1"
FT                   /translation="MFCKNCGQQIDDNAAVCIHCGVATGNNMSSKSNLDNPSHLAGIAS
FT                   CCFPVVGIILYFLWKDEKPQSASLVCKWMIGGIIIWIIFYVLAFVLGMLGSLSSY"
FT   gene            60737..63850
FT                   /locus_tag="Cbei_0046"
FT   CDS_pept        60737..63850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0046"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   cpf:CPF_2865 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32236"
FT                   /db_xref="GOA:A6LPF6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF6"
FT                   /protein_id="ABR32236.1"
FT                   /translation="MYNKVDSSKGTVKIEKDIAKLWTEKDIIKKSFDSNSDGEYFTFYD
FT                   GPPTANGKPHVGHILTRVMKDIIPRYKVMKGYKVLRKAGWDTHGLPVELEIEKKLGISG
FT                   KEQIEDFGVEKFVHECKDSVFSYVSLWKEMSEQIGFWVDMDDPYVTYHDNYIESEWWAL
FT                   KQMWNKGLLYKGHKVMPYCPRCGTALSSHEVAQGYKDVKDLTATVKFKVKGEENKYILA
FT                   WTTTPWTLPSNLALCINKSYTYAEVKVGEEIYILAKDLVGKVLGDTEYEIVKEFKGEEL
FT                   LGTEYEQLLPFAKVEGKAFVVIHGDYVTLSDGTGIVHIAPAYGEDDSLVSKKNGIAFIN
FT                   LVDTNGNFVEEVTPWAGKFVKKCDESIVKYLEERNQLFTAQKHTHSYPHCWRCDTPLLY
FT                   YPKDSWFVAMTKMRDKLLENNNKINWYPDNTRTGRMGKFLENVIDWGISRDRYWGTPLP
FT                   IWQCECDHQECIGSREELEEKATTDCKGIELHKPYVDGIKLKCPHCGKEMKRTHEVIDC
FT                   WFDSGSMPFAQWHYPFENKETFEKNFPAQFISEAVDQTRGWFYTLLAISTCLFDTNSFE
FT                   NCIVLGHVLDKKGLKMSKHKGNVVDPFEVLNSQGADATRWHFYTASAPWLPTRFSIDDV
FT                   AEAQRKFLGTLWNVYSFYVLYAEIDKFDSTKYSDFVSDNIMDKWIISKLNTLIETVDDG
FT                   LNTYKITQAALAIEDFTDELSNWYVRRNRSRYWSQELTNDKIGAYVTLYKVLTNLVKVA
FT                   SPFVPFMTEEIYQNLVVNLDKNAPESIHLCTWPEVDKSAINKELEKEMDLAYTLVKLGR
FT                   SARNAANVKNRQPLSELLISTKSLPDYYGDIVKEELNIKKVDLGADLSKYVNFEIKPNL
FT                   PVIGKLYGKLIPQIRKAISEKNQMELAQKIQNGGSETIIVNDTEIVLTNENLLVTMQGL
FT                   EGYAFAGEGELGVVLDTTVTPELQEEGHVREVISKIQNMRKDKGFEVADRINLYVSNND
FT                   MLIDVIKKFEQTIKKETLTCEVLYNQESNYSETVINSETLNMNVEVVR"
FT   gene            64112..65110
FT                   /locus_tag="Cbei_0047"
FT   CDS_pept        64112..65110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0047"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: cpr:CPR_2548
FT                   catabolite control protein A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32237"
FT                   /db_xref="GOA:A6LPF7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF7"
FT                   /protein_id="ABR32237.1"
FT                   /translation="MATSIKDVAKEAGVSIATVSRVLNDIDVVNEDTKKKVLDAIKKLG
FT                   YRPNIVARSLKTQRTKTIGILLPDISNQFYPEIVRGAEDVSNIYDYNIILCNSDLDIEK
FT                   EKEYLRVLREKMVDGVIYMSSSLNEEILELINELDIKTVLVETKDKEGVLPSVTIDNVK
FT                   ASYDSTKLLIEKGIKEIAFIGAEKESKNAWGDRYVGYENAMKESGIEIDPELVHLSSMK
FT                   VKSGYEGIQKFIKQNKKFRGVVCASDDIAMGAINALRDNNLDIPKDVSVIGFNDNFAAS
FT                   IFYPKITTISQPTYDMGSVAMRMLIKLLNKKELDEPHYVLEHQLVERESTV"
FT   gene            65349..65792
FT                   /locus_tag="Cbei_0048"
FT   CDS_pept        65349..65792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0048"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: regulatory protein, MarR; transcriptional
FT                   regulator TrmB; KEGG: dsy:DSY1453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32238"
FT                   /db_xref="GOA:A6LPF8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF8"
FT                   /protein_id="ABR32238.1"
FT                   /translation="MGCYQHIGKYIGEIHRSSYMYFGKRFSKFGIGAGQYLFLLNLYEN
FT                   DGITQEELTKKVRLDKATTARAIKKLEDEGYVRRIKKESDKRAYRLELTEKAEQIKDDV
FT                   YSIMNEWESEIRMCFTDEESQELMNLLNKLSKSSLINKEDIHE"
FT   gene            65785..67158
FT                   /locus_tag="Cbei_0049"
FT   CDS_pept        65785..67158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0049"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: cno:NT01CX_1214
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32239"
FT                   /db_xref="GOA:A6LPF9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPF9"
FT                   /protein_id="ABR32239.1"
FT                   /translation="MNKQNRLGEMGVGKLLLEFSIPAIIGMLVNTLYNIIDRIFIGHIE
FT                   GIGELAMAGVGITMPIMFIILAFGMLIGIGTATKVSIKLGEHDKEGAERLLGNAFTLII
FT                   IIGVLLTLFGHIFANPLLKAFGASENIIGYGEDFIRVIISGCIFNLMSFGLNHSIRSDG
FT                   SPKIAMASMLMSAIINIILDPIFIFGLGLGVKGGALGTVVAQTISSIWILYYFTKGSSV
FT                   LKIRRKNLKLEKDAVLSIFAIGVSPFSMQLAQSAVQVITNNSLQSYGGDLAVGAMTIVN
FT                   SLAMIFLMPIFGLNQGLQPIIGYNFGARKYDRVKQAVKYGVIIATIIVVIGFIIIEGIP
FT                   ETLVKIFNNESSLIEVTAHGMRIFLIMLPFIGAQIIITNFFQSIGRVKISMFLSLLRQV
FT                   IILIPCLIIIPRFKGLDGVWIAGATSDILSVIITLIVFVKTSKDLMGNGKEQKVILEN"
FT   gene            complement(67214..67399)
FT                   /locus_tag="Cbei_0050"
FT   CDS_pept        complement(67214..67399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_2858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32240"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG0"
FT                   /protein_id="ABR32240.1"
FT                   /translation="MNDSNLKIAQQDVEEALKTVEDMEKVISNDEPSKEQLKEKFICLS
FT                   NRVQKLEDILKNEGIL"
FT   gene            67512..68087
FT                   /locus_tag="Cbei_0051"
FT   CDS_pept        67512..68087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0051"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ctc:CTC00238 spore maturation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32241"
FT                   /db_xref="GOA:A6LPG1"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG1"
FT                   /protein_id="ABR32241.1"
FT                   /translation="MINYIWFFLIFFGILVGLLTGNGELISKAIINSSGNTVTFIIELT
FT                   GIMCFWCGVMKVAENSGLTEKLSKLLKPILKRIFKEAAKDEKALGAIVMNLTANMMGLS
FT                   NAATPFGIKAMEEMDRLNSDKETASNDMALFLVLNATCIQLVPSTIISIRAACNSVNPG
FT                   IIILPTIASTATAAIVGVICCKILQKYF"
FT   gene            68141..68662
FT                   /locus_tag="Cbei_0052"
FT   CDS_pept        68141..68662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0052"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   cpf:CPF_2856 spore maturation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32242"
FT                   /db_xref="GOA:A6LPG2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG2"
FT                   /protein_id="ABR32242.1"
FT                   /translation="MFNYLSKSIIPIIFLLIITYGMFKGRKVYEWFIEGAKDGLMVTLR
FT                   IFPYLLAMIIAVQVFREAKLMDLLNNLIAPLANLIGLPKDLIPLLIIKPLSGSGAIGVF
FT                   TDIIKSLGPDTRTGLIASVVMGSTETIFYTITVYFGAIKVKKIRHTLWAAVFADATAII
FT                   MAIFMVNICF"
FT   gene            68779..70023
FT                   /locus_tag="Cbei_0053"
FT   CDS_pept        68779..70023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0053"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B, X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   cpr:CPR_2539 xaa-pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32243"
FT                   /db_xref="GOA:A6LPG3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG3"
FT                   /protein_id="ABR32243.1"
FT                   /translation="MNKDTYIENRSKLMNSVEDNSVMILFAGKPAKKTGDEFYQFTPDK
FT                   NFYYLTGIQEDGHLVVLSKYNNIVSEKLFLTDLDLDKEMWSGKTLRDFEGKEISGINDV
FT                   SYMKEFTSYLNVLIKGKEKVNLYLDLDREEFEESDSVSNRFAKEIISKYPHINIKNFTS
FT                   IIAPLRMVKSENEIKEMRKVIEITIEGVKSLMKNVKAGMKEYEIEAYFDFECKTRGVKD
FT                   YAFRTIAAAGKNATILHYVDNNSELKDGDLILFDLGAQWNLYNADITRAFPINGKFTQR
FT                   QKEVYEAVLRVNKAVIERIKPGVDSRELNVWAKDLIAQECIGLGLIKEKSEVNRYYWHK
FT                   IGHSLGLDTHDLGILGREFTFAEGMVFTVEPGIYIAEENIGIRIEDDILVTKDGCEVLT
FT                   KNMIKEIDEIEEFMK"
FT   gene            70131..71906
FT                   /locus_tag="Cbei_0054"
FT   CDS_pept        70131..71906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0054"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: cpf:CPF_0866
FT                   metallopeptidase, M24 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32244"
FT                   /db_xref="GOA:A6LPG4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG4"
FT                   /protein_id="ABR32244.1"
FT                   /translation="MRVSERIQKLREIMKKENIDYYIVPSEDFHQSEYVAECFKSRAYI
FT                   TGFTGSAGTALIGMEKAILWTDGRYFIQANEQLKDSGVELFKMRIPGWPTLEEWLMENM
FT                   MDGQTLGFDGRVLSVNQYKEILKIKENKNINIVMNKDLIEEVWENKPKMPKEKVFLHEV
FT                   KYCGKTANEKIQEVRNEMKKLCGKSYIISSLDDIAWIFNIRGNDVKYTPVTLAYALIDE
FT                   EKAVLYIDREKISSADEKTLTKEGIIIKNYEDIFEDIKEVQDSVILDPSKISAYIYNQI
FT                   NKRIKKIEEINITTKLKAIKNKKEIENLKNCQLKDGVAMVRFIKWIKEGLDKEDITEIT
FT                   LAEKLCDFRSQGDLFIEESFGTIAGYKEHAAMMHYSATEESAYKLEKEGILLVDSGGQY
FT                   FDGTTDITRSIVLGKLTEEEKRDFTLVLKAHINLMKAKFLKGTTGSNIDILSRRVLWEE
FT                   GIDYKCGTGHGVGFCLSVHEGPQTIRPVPNTIELEPGMILTNEPGIYREGKHGIRTENI
FT                   MLVVEDERNAEFGEFYKFETMSYCPIDLGGINVELLTEDEKEWLNNYHKETYDKLSPFL
FT                   SDSEKQFLKESTKEI"
FT   gene            72579..74516
FT                   /locus_tag="Cbei_0055"
FT   CDS_pept        72579..74516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0055"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; tRNA synthetase class I (M); KEGG: cpr:CPR_2533
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32245"
FT                   /db_xref="GOA:A6LPG5"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG5"
FT                   /protein_id="ABR32245.1"
FT                   /translation="MCADCKKTYYITTPIYYPSTKLHIGNTYTTVAADALARFKRLTGY
FT                   DVMFLTGTDEHGQKIQRIAEEKGITPKQHVDEVVAGIKDLWSMMNISYDKFIRTTDDYH
FT                   IKAVQDIFKKLYDQGDIYKSSYEGWYCTPCESFWTDTQLVNGNCPDCGRPVEKSKEEAY
FT                   FFKMSKYADKLIKYIEDHPEFIQPESRKNEMLNNFLRPGLQDLCVSRTSFNWGVPVTFD
FT                   ESHVVYVWIDALSNYITALGYGQENKDLYNKYWPADVHLIGKDILRFHTIYWPIMLMAL
FT                   DLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNEFGVDPVRYYLLKEIPFGADGLF
FT                   NNEIFIKKINSDLCNDLGNLLSRTVAMVEKYFGGEMPAQDEKEAIDDELINLALSAPAK
FT                   IEEAINELNIPQALEYVFELIRRANKYIDETTPWILAKDESKKARLGTVLYNLAESLRF
FT                   ASVMISAFLPETSKKINEQINTTEISWESLKSFDGIKAGTKVVKADNLFPRIDVDKKLE
FT                   ELEALKAAQTPAKREITPIKEEITIDDFEKVDLRVVKVLACEPIKGAKKLLKLKVDLGG
FT                   EERQVVSGISKFYKPEEIVGKNVVLVANLKPVKLRGELSQGMILCAATDDDSILKAVDP
FT                   GEIPTGSIVR"
FT   gene            74848..75660
FT                   /locus_tag="Cbei_0056"
FT   CDS_pept        74848..75660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0056"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: cpf:CPF_2843 hydrolase, TatD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32246"
FT                   /db_xref="GOA:A6LPG6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG6"
FT                   /protein_id="ABR32246.1"
FT                   /translation="MLIGKEYWFMNQKFKIIDSHAHYDDEAFNEDREPLLNEINQNGVI
FT                   GILNCASSYDSLKTTDKLTKDHNFIFGALGIHPENANEMKGDTLDEIKSYIKNNDKIVA
FT                   IGEIGLDYYWDENPPKDIQKDVFRSHMNLAKELNYPVVIHDRDAHKDTLEIIKEFPEVT
FT                   GVVHCFSGSVEFARECVKLGYYIGITGVVTFKNAKKVVEVVREIPLEKILVETDCPYMA
FT                   PEPNRGKRNKSDYIEYIITKIAEIKNIDPYEANLRFNENFFRLIRKEK"
FT   gene            75956..77008
FT                   /locus_tag="Cbei_0057"
FT   CDS_pept        75956..77008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0057"
FT                   /product="3D domain protein"
FT                   /note="PFAM: protein of unknown function DUF348; 3D domain
FT                   protein; G5 domain protein; KEGG: cpf:CPF_2842 3D/G5 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32247"
FT                   /db_xref="GOA:A6LPG7"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG7"
FT                   /protein_id="ABR32247.1"
FT                   /translation="MIEKLRQFIRQSFSNGPKAKIIIGTIAIAFVVVTAVTIMSIRKTL
FT                   VISIDGKEATFVTYKGTVKGVLQENGIEVSPKDKVQPSLESKVSEKETIKVKKAVPVDI
FT                   KAGGMEVQLQTAEDTVEDMLDAEKNTLKDQGIEFDKDVDEVSPSLESKLEGNESVQLVK
FT                   VETKDVTEKQPINFDTIVEKDENLDSSVQKVKSEGVNGEKQITYQIIYKDGVEISRNVK
FT                   STKTILEPQNEVVVKGTGQVYASRGGDRITYKKKINCTATAYSNHSTTATGRTPVRNQG
FT                   GMSTIAVDPSVIPLGSKVYVEGYGYAIASDTGGAIKGDRIDIYLNSSNECDSWGRRPVD
FT                   VLVVAYPGQW"
FT   gene            77171..77728
FT                   /locus_tag="Cbei_0058"
FT   CDS_pept        77171..77728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0058"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein;
FT                   KEGG: cpr:CPR_2527 primase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32248"
FT                   /db_xref="GOA:A6LPG8"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG8"
FT                   /protein_id="ABR32248.1"
FT                   /translation="MIKEVIVVEGRDDVDAVKKAIDAEIIAVGGFGINAKVIARIQEAQ
FT                   KRKGVIVLTDPDFAGEKIRRIIAKRVKGIKHAYIAKEDGLKNGDIGVENACPEVILKAL
FT                   EMAKITQEEKQSFFTMQDMFYFKLTGDNTSKIRRNMLGKLLGIGYGNAAQMVSRLNNYG
FT                   ITKEEFTNAIKEIEKQLEVGKK"
FT   gene            77729..78574
FT                   /locus_tag="Cbei_0059"
FT   CDS_pept        77729..78574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0059"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   cpr:CPR_2526 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32249"
FT                   /db_xref="GOA:A6LPG9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPG9"
FT                   /protein_id="ABR32249.1"
FT                   /translation="MDLKDIKTQELVKKYNFKFSKSLGQNFLVDDSVLDDIVNGAEVNN
FT                   EDFIIEIGPGVGTLTAQLLMKAKKVTSIELDNDLIPILEQELGEHKNFSLIHKDALKVD
FT                   FNELIGDEKSVKLVANLPYYVTTPIIVKLLKGGYNFKSLTIMIQKEVAERINAEPNCKE
FT                   YGALSVLVQYYCNTDIIRKVPPTCFIPRPKVESIVIRLDRLDEPRVKTKDINIMFEIVR
FT                   AGFNMRRKTLWNAAKTLKVDKEKLEEAFKKSGIDPKRRAETLTLEEFAALSDCIYDIRN
FT                   "
FT   gene            78744..80903
FT                   /locus_tag="Cbei_0060"
FT   CDS_pept        78744..80903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpe:CPE2516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32250"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH0"
FT                   /protein_id="ABR32250.1"
FT                   /translation="MAHNKLYRNFIILQEDERGYSQSNDKALSGYAKVEAKGDKCKISF
FT                   YAQNLRQEDNYSMVLICCKKDLKQLIDIGPLAINEVGKGDTSKEYYVNNIASLGISYEK
FT                   ISGAAICRVKDNETEFVMHGFMNGEESADNWRKFKIIKADSRKYVDKTTLQTKEKENLT
FT                   VSTLNKTITQSGTKEDELVKAPKLQDESVERKKDDIDLQPKANIESKVEDKQNRIPEDH
FT                   QNITETIDNLDEERNKNKESKKCEKDYKHDKCDKHDKEDKYDKCDKHDKCDKEDKYDKC
FT                   DKHDKCDKEEKYDKCDKHDKCDKEDKCDKHDKYDKADKYDKYDKYDKWDKDEKYNKCDK
FT                   YDKHDKYDYFEKEEDIDDVIGKMAKKLDTYDGVIDLKVSHHMYEDVIVYGFIKDKKNHN
FT                   SKWKKFKLEKKCRNENQDIDNVQVSSRRIEENFKLDKLNDVDTSDRMDIIDFDEYENNI
FT                   QQGNLGGATGANDTSTMNTTGTVESMEQGNSNTGMGQVDTGTMWQPWSGNSANQTSTGD
FT                   MNQTGTNTVTDQTSSNAGMNQMNTGTMGQPETSGETGGMGQLDLNMGDTSNENNNNQNA
FT                   SNQGFTISGDIGKYFEKLAQDFKPFIGKLNDINFCKWYKIIVNGIEDLSNDSNYNKYTL
FT                   AYYPMLNYYPYISKTGHFLLGYKCNKDGEMQYIIYAIPGSKEKNDQPYGGRTGFVTWTN
FT                   DGNNGQGYWLMFYDFKNSSIVIPAR"
FT   gene            80915..81487
FT                   /locus_tag="Cbei_0061"
FT   CDS_pept        80915..81487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32251"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH1"
FT                   /protein_id="ABR32251.1"
FT                   /translation="MNKKQLIVTSILLSLMLILVITQGFFKENFEQVILMDQGISKFKE
FT                   YSFDDNKYVISLPSEWNVEEKESKGQYVSYELDFKDKNNKLTGLLQVVNTKEDINVFAE
FT                   KDLNSQCLEYYNSELTSFKNSYNSGVLVKYETKVKNGYDFNNECYYLNLGEGKTAKILF
FT                   NLKSKDYKDNMKTILNTIISSIKSSQS"
FT   sig_peptide     80915..80983
FT                   /locus_tag="Cbei_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.352 at
FT                   residue 23"
FT   gene            81707..82477
FT                   /locus_tag="Cbei_0062"
FT   CDS_pept        81707..82477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0062"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: ctc:CTC00251 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32252"
FT                   /db_xref="GOA:A6LPH2"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH2"
FT                   /protein_id="ABR32252.1"
FT                   /translation="MRIILFEIFGIQIKGYGLMIAIGIIVAAAIFINKGKKKGYDEDSL
FT                   LNLVILAVIGGALGGKGLFILTEIKDIIKEPSILLNFGYGFVIYGAIGGGALAMYLYSR
FT                   KKSWNIVEMLDMTVPGLAIAQGFGRIGCFLAGCCYGAETKLPIGVTFPKGSLAPAGIHV
FT                   HPTQIYSSIFDFLLGFILLYYSKKEKQTGKIVGLYLIVYSIGRFLVEFLRDDPRGSIGI
FT                   LSTSQFIAIFTLVIGIVVFNNHRIFKGAKKNSEK"
FT   gene            82467..83303
FT                   /locus_tag="Cbei_0063"
FT   CDS_pept        82467..83303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32253"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH3"
FT                   /protein_id="ABR32253.1"
FT                   /translation="MRNSKFLTIVLPLVLVSSMMLSGCSFIDNIEVKMNLKNQQFDYIK
FT                   QNKVDKIIIQSVRDSGFRFVVNDPKAIDDIYKILSDGSEVSKKSSLDPDYIFEVCTGDE
FT                   VRKYQYVVGANEHGTGNFYDDDKAFSVPKNLENTIMQNLSFIRKPRDFNYIYYQSILKV
FT                   IDKKKDSLSNGNKVGVNIAGDTDCLKYIFSVDLEDFKKSLNKTLPSVDLVNNNYEDFDT
FT                   IIKVKNRGYNSTVFKTLITVDNKKDNSFESYYVTAEYNYKDWDIKISEPNKVPQDW"
FT   sig_peptide     82467..82538
FT                   /locus_tag="Cbei_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.838 at
FT                   residue 24"
FT   gene            83322..84161
FT                   /locus_tag="Cbei_0064"
FT   CDS_pept        83322..84161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0064"
FT                   /product="Mrp/NBP35 ATP-binding family protein"
FT                   /note="KEGG: cpf:CPF_2835 Mrp/NBP35 ATP-binding family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32254"
FT                   /db_xref="GOA:A6LPH4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH4"
FT                   /protein_id="ABR32254.1"
FT                   /translation="MSCESCKSKDTCQSKGTGCSEESLKLISRYGNIKNVIGIISGKGG
FT                   VGKSTVTGMMASMLSKKGYKVGVLDADITGPSMPRFFGVNNKRAKIIPLENDMVKFEPV
FT                   ETESGIKIISMNLLTAVEDEPVIWRGPVITGVLKQMFVETNWEELDYLLIDMPPGTGDI
FT                   ALTVMQEFPIDEIVIVSTPQDMVSMIVKKVVIMAQKIGVKIKGVVENMAYINCPDCDKK
FT                   IRVFSRKSSEENAEYLGIPLIGELPINIELTEALEQGKAEEYVKENPLYSLIFEGLY"
FT   gene            84291..84482
FT                   /locus_tag="Cbei_0065"
FT   CDS_pept        84291..84482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0065"
FT                   /product="ferredoxin"
FT                   /note="KEGG: cpr:CPR_2520 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32255"
FT                   /db_xref="GOA:A6LPH5"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH5"
FT                   /protein_id="ABR32255.1"
FT                   /translation="MKPKVDKDTCIACGLCPSICPECFDMQDDGKAGAIVDEVPEGCVD
FT                   EAKEAEESCPVNAIEIEE"
FT   gene            complement(84713..85390)
FT                   /locus_tag="Cbei_0066"
FT   CDS_pept        complement(84713..85390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0066"
FT                   /product="putative proton-coupled thiamine transporter
FT                   YuaJ"
FT                   /note="TIGRFAM: putative proton-coupled thiamine
FT                   transporter YuaJ; KEGG: cpf:CPF_1622 probable
FT                   proton-coupled thiamine transporter YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32256"
FT                   /db_xref="GOA:A6LPH6"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH6"
FT                   /protein_id="ABR32256.1"
FT                   /translation="MSIFNDWIEQFSKLFQNFSQNIQDILASPMSIITLLGCILLLIVF
FT                   AKAKKIKFTPELIARIGIALALATILKMLRLYHFPQGGSITLGSMIPVLLIAFIYGPEV
FT                   GCLTGFLYGVITLILDPYILHPIQVLFDYPLPFTALGLAGFFKQRRLVGVSIAILVRFL
FT                   CHLISGIVFFGSFAPEGMSPVVYSLLVNGPMIGIEGIICLVILAVLPIERIFHASSVNT
FT                   ISN"
FT   misc_binding    complement(85446..85546)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 81.50"
FT   gene            complement(85951..86799)
FT                   /locus_tag="Cbei_0067"
FT   CDS_pept        complement(85951..86799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0067"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: cac:CAC0948 uncharacterized protein, DegV
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32257"
FT                   /db_xref="GOA:A6LPH7"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH7"
FT                   /protein_id="ABR32257.1"
FT                   /translation="MDKIALITDSASDLNTNFVIENNIKIVPFKIIFSDREYIDGIDIT
FT                   PKALYEYLPKEIPKTSLPGVEDFTAALEQVKNEGYTHAIIITISSGLSGAYNSARLASE
FT                   NVPEVKTFVFDSMTLTMSEGAMVIETLNLIKQRKSFDEIVNTLPSFRDKIDVFFTIDTL
FT                   EYLIKGGRVGKVAGTIAGVLNLKPIITVGDDGIYHTVCKIRGIKQCISKLTNILINYLE
FT                   NHRCKVWILDGDAPEKSKMLYDSIKDLPNLIECILGGSIGPALGVHTGPGLVGLIVERL
FT                   D"
FT   gene            87260..89368
FT                   /locus_tag="Cbei_0068"
FT   CDS_pept        87260..89368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0068"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: ATP-cone domain protein; KEGG:
FT                   cpr:CPR_2516 anaerobic ribonucleoside-triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32258"
FT                   /db_xref="GOA:A6LPH8"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH8"
FT                   /protein_id="ABR32258.1"
FT                   /translation="MLYVVKRDGREVEFNSDKIAQAIKGSASEIGLNLKESQVLDTVHK
FT                   VITYIEEEYKKTITVEQIQNFVEKALRNEGHKDIAVAYSAYRRERTKVRDIKSDLMKAI
FT                   RQIGVETDRDNANVGNNFSSKLLRIASESNKWNTLATMPKNLAKAHENGDLYYHDLDSY
FT                   NLTVNCLHIPTKEILENGFNTGYGTINAPKRIETAAELSCILLQSTQNDMFGGQSHPDF
FT                   DNDMGIFVEPTREEIREELLELGVSEEKLEAMVEKKVRKKVQQAMQGVVYNLNTMHSRA
FT                   GSQVPFSSINIGLPTSSDAALVCEVFLLEYEKGLGKGEQPIFPNIIFRVKSGVNREEND
FT                   EYFYLYKLACRVAAKRMNPTFMNIDADFNKEYYDKGYVPATMGCRTYLMKNVNGEPGCK
FT                   GRGNIAPTTLNLPRIGLQAKNDINKFFSILDARLELAKDSLMHRYEILKNLRVKDLPFV
FT                   AGQGLMKGSEGLKPDDSIEPILKQGTWGIGFIGVAETLLALIGKHHGEDEEARKLGIRI
FT                   VEHIRQYCDRLTEEYKLNWSCYATPAEGLSGKFIKQDQKIFGLIKGVTDKEYYTNSYHI
FT                   PVSYPISIKDKIEIEAPYHKLCNGGHISYIEVDDTPDAETIMDIINYAYKNTNISYMGI
FT                   NFHIRYCRECGTYLQNNENKCPKCGSQNIQGISRVTGYLSLDERFGAGKYHEREDRISH
FT                   TERHGHHY"
FT   gene            89973..91142
FT                   /locus_tag="Cbei_0069"
FT   CDS_pept        89973..91142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0069"
FT                   /product="homocitrate synthase"
FT                   /note="TIGRFAM: homocitrate synthase; PFAM: pyruvate
FT                   carboxyltransferase; KEGG: chy:CHY_1104 2-isopropylmalate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32259"
FT                   /db_xref="GOA:A6LPH9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPH9"
FT                   /protein_id="ABR32259.1"
FT                   /translation="MALSNLKTNKKVSIVDTTLRDGEQTAGVVFANEEKIVIAEMLSDL
FT                   GVDQLEVGIPTMGGDEKKAIKEIVKRNLKPSIMAWNRAVVSDIEQSIDCGVDAVAISIS
FT                   VSDIHIQHKLKTSREWVLESMVKSVEFAKKNGLYVSVNGEDASRADKDFLVEYINAAKQ
FT                   AGADRFRYCDTVGIMEPFKIRDDIKYIYDKTGFDIEMHTHDDFGMATANAVAGIKGGAS
FT                   HVGVTVNGLGERAGNAALEEVIMALMLVYGYNGDGINTQMFREVSQYVSRASGRELPIW
FT                   KAIVGTNMFAHESGIHADGAIKDPKNYEAFDPDIVGLERQIVIGKHSGRASIINKFREY
FT                   NRELTEDEAKGILELVRATSVRLKRTLFDKEVVQLYKEYHRRLEERNKQ"
FT   gene            91157..93079
FT                   /locus_tag="Cbei_0070"
FT   CDS_pept        91157..93079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0070"
FT                   /product="putative aconitate hydratase"
FT                   /note="TIGRFAM: putative aconitate hydratase; PFAM:
FT                   aconitate hydratase domain protein; KEGG: cth:Cthe_3158
FT                   putative aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32260"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPI0"
FT                   /protein_id="ABR32260.1"
FT                   /translation="MGDNLVYKILKSHIVEGELKAGEPIALKIDQTLTQDSTGTMAYLQ
FT                   LEAMGIDRVKTKKSVAFIDHNMLQQGFENADDHKFIQTVASKYGVYFSKPGNGICHQIF
FT                   LERFSTPGDTLIGSDSHTPTAGGVGMLAMGAGGLDVALAMGGGAYNINTPKVVKIELTG
FT                   KLNKMVAAKDVILEVLRILTVKGGVGKVFEYAGEGVKTLSVPERATITNMGAELGATTS
FT                   IFPSDERTLEFFKAQGREEDFIEFKPDADAVYDEVVTINLSELTPLTAKPHSPDNVAKV
FT                   SEVGKIKVDQVVIGSCTNSSYEDLMKVAKILKGKKVHPDVSLVIGPGSRQVMEMIARNG
FT                   ALADIISSGARILENGCGPCIGMGQSPGTDAISLRTVNRNFYGRSGTLSAQIYIVSPET
FT                   AAVSAINGVLTDPTEVDVDLTIDMPKEFLIDDSMILAPAPTNAEVEVVRGPNIKPFPVS
FT                   KPLAEELDGKVLIKVEDNITTDHIMPSNSKLLPFRSNIPYLAEYCFNTVDTEFPKRAKE
FT                   FNGGFIIAGGNYGQGSSREHAALAPLYLGVKAVIAKSFARIHKANLINNGIVPIEFKNE
FT                   ADYEKIDLVDDLKMEDIQAALESGVVKVKNLTKGTEFEATVDLTEKEIAVIKEGGRLNY
FT                   VKANS"
FT   gene            93285..93794
FT                   /locus_tag="Cbei_0071"
FT   CDS_pept        93285..93794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0071"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; KEGG: cpf:CPF_2826 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32261"
FT                   /db_xref="GOA:A6LPI1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPI1"
FT                   /protein_id="ABR32261.1"
FT                   /translation="MEKTIRLAGIAYESLVNGPGIRRVFFSQGCKHNCKSCFNPDTHDF
FT                   YGGEQRDIDELINDTLNNEIIKGVTFSGGDPWEQADKFAYMAKEFRKKGLNIWSYTGYT
FT                   YEYILENKDSRLGWSDLLNNIDVLVDGKFEESKMSDGLKFRGSTNQRIIDVKESIKKEQ
FT                   IVIIEL"
FT   gene            93960..94571
FT                   /locus_tag="Cbei_0072"
FT   CDS_pept        93960..94571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0072"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.21"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase; PFAM:
FT                   methylpurine-DNA glycosylase (MPG); KEGG: ctc:CTC01030
FT                   DNA-3-methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32262"
FT                   /db_xref="GOA:A6LPI2"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPI2"
FT                   /protein_id="ABR32262.1"
FT                   /translation="MILNKEFYKQGALILAKELLGKVIIRKVDGVTLRAKIVETEAYIG
FT                   EIDKASHAYNGRRTERTEPLFREGGIAYVYFIYGKYYCFNVISGLEDKGEGVLIRAFEP
FT                   LNEFDYLAKKRFNQNYDELSETKKKAITNGPSKLCIAFSIDKSENYKRLYDEGDFYIEE
FT                   GEKDTFKIVETKRIGIDYAEEAIDFPWRFYIEGNKYISKK"
FT   gene            complement(94951..95916)
FT                   /locus_tag="Cbei_0073"
FT   CDS_pept        complement(94951..95916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0073"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   gka:GK3091 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32263"
FT                   /db_xref="GOA:A6LPI3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPI3"
FT                   /protein_id="ABR32263.1"
FT                   /translation="MKDILYLVIPCYNEEEVLHETSKRLLVKIKTMISNNLISNKSKIL
FT                   FVNDGSKDRTWRIIEELHSKNNIFSGINLSRNRGHQNALLAGLMVAKDYSDMTISLDAD
FT                   LQDDIDVIDAFVEKYYDGCDIVYGVRSTRETDTFFKRTTALGFYKLMRILGVDMVYNHA
FT                   DYRLMSKRVVDGLSQYKEVNLFLRGMIPLIGYKYSVVEYERHERFAGESKYPLKKMIAF
FT                   ALDGITSFSIKPIRLITLLGFTIFFAGGAALIYTLIVKISGRTVTGWTSLTLSIWVLGG
FT                   VQLLSLGVIGEYIGKIYNEAKHRPRFIISDKLINVDKENK"
FT   gene            complement(95992..97077)
FT                   /locus_tag="Cbei_0074"
FT   CDS_pept        complement(95992..97077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0074"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: cac:CAC0277 HD-GYP hydrolase domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32264"
FT                   /db_xref="GOA:A6LPI4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPI4"
FT                   /protein_id="ABR32264.1"
FT                   /translation="MRLIPIECVKPNTVIGKTLYDSDGRVLVRAGMVLSERIIFKIKDL
FT                   NILSIYIIDEFSSDEIEDIIKPELRQKAILTIKEAFSNINRLTVADKFSKNESVYFNNI
FT                   ESMAEDLIENVLNNKSVLLSLIDIRSMDNYIYSHSVNVAVISLVLGIALKLPKRQLQYL
FT                   CIGSLLHDVGKTFIPKEILMKEEELTDEEVTILDQHPILGYKYLSDSYNLSANSKIITL
FT                   QHHERPDGLGYPNRLANDEISTLSKIVSIANAYDSLSTGRPNKRAMFPSDVLEYLMSNA
FT                   GKKFDYEIVNIFCKIVIPFSKGTLVDLSNGDIAVVQETIPNFPLRPIVKILKSSRPGRV
FT                   NTEINLISETSVVISNIRYEL"
FT   gene            97459..98541
FT                   /locus_tag="Cbei_0075"
FT   CDS_pept        97459..98541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0075"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase, class V; KEGG: dsy:DSY4684 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32265"
FT                   /db_xref="GOA:A6LPI5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPI5"
FT                   /protein_id="ABR32265.1"
FT                   /translation="MSRVYNFSAGPAVLPESVLREAAGEMLDYKGTGMSVMEMSHRSKA
FT                   FEEIITDAEKTLRELMNIPDNYKVLFLQGGASQQFAMIPMNLMKNKVVDHIITGQWAKK
FT                   AASEAKIFGKVNILASSEDKTFSYIPDLKDLKVSEDADYVYICHNNTIYGTTYKELPNV
FT                   GDKILVADMSSDFLSEPVDVSKYGLIFAGVQKNAGPAGVVVVIIREDLITEDVLPGTPT
FT                   MLRYKVHADNKSLYNTPPAYGIYICGKVFKWVKNKGGLEAMKKINEEKASILYDFLDSS
FT                   SMFKGTVVKKDRSLMNVPFVTGSDELDAKFVKEAKAVGFENLKGHRTVGGMRASIYNAM
FT                   PIEGVKDLVEFMRKFEEDNK"
FT   gene            complement(99045..100439)
FT                   /locus_tag="Cbei_0076"
FT   CDS_pept        complement(99045..100439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0076"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; KEGG: cpr:CPR_2509
FT                   asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32266"
FT                   /db_xref="GOA:A6LPI6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPI6"
FT                   /protein_id="ABR32266.1"
FT                   /translation="MAKSILIRSLYRNTDDFLSKEITISGWIRTLRSSNAFGFIEVNDG
FT                   SFFKNIQVVFDDKLNNFKEISKLPISSSISVIGILVATPEAKQPFEIQAKNIIIEGMSN
FT                   SDYPLQKKRHTFEYLRTIAHLRPRSNAFAATFRVRSVAAYAIHKFFQDQNFVYTHTPII
FT                   TGSDCEGAGEMFRVTTLDPKTPELSKDGSVDFSKDFFGKETNLTVSGQLNAECFALAFR
FT                   NIYTFGPTFRAENSNTTRHAAEFWMIEPEIAFADLQDDMELAENMLKYVIKYVMDECPE
FT                   ELEFFNQFVDKGLLERLNHVVSSDFAKVTYTEAVEILQKCGKKFDYDVSWGIDLQTEHE
FT                   RYLTEEHFKKPLFVTDYPKDIKAFYMRLNDDGKTVAATDLLVPGIGEIIGGSQREERLD
FT                   VLKDRMTELNLSEDDYWWYLELRKYGETKHAGFGLGFERLIMYITGMTNIRDVVPFPRT
FT                   PGTSEF"
FT   gene            complement(100772..101470)
FT                   /locus_tag="Cbei_0077"
FT   CDS_pept        complement(100772..101470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0077"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cpe:CPE2498
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32267"
FT                   /db_xref="GOA:A6LPI7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPI7"
FT                   /protein_id="ABR32267.1"
FT                   /translation="MKIAIISDIHANVYALINLLEDIDIEKVDTIICLGDLVGYGPHPN
FT                   EVISMIRRRHILCIRGNYDSSVVDNEYSYIRETPINAFSLPWTVKELREENRLFLANLP
FT                   STLTLNIANKSLLFVHGSPDKINEYLLKDGDNTSEVMNSISNDVLICAHTHIPGMKDFK
FT                   NKVYINSGSVGKPKIGRPNSTYCILNISKEDGMKVQIKEIPYAYKRIVKDMTMLNFPKE
FT                   LIQSFENGLE"
FT   gene            complement(101507..102886)
FT                   /locus_tag="Cbei_0078"
FT   CDS_pept        complement(101507..102886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0078"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein; KEGG: cpr:CPR_2502
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32268"
FT                   /db_xref="GOA:A6LPI8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPI8"
FT                   /protein_id="ABR32268.1"
FT                   /translation="MSFNFIKDKDKKIHFIGIGGISMSGLAAVLLNSGYSVSGSDFKDS
FT                   AIIDKLRSSGAEIYIGHRRENINNVDLVVYTAAIPSDNPELLEAKEKNIALMDRAEFLG
FT                   QIMKGHKYSVAISGTHGKTTCTSMLSHITLADNLDPTILVGGELDAIGGNFRIGNSEYF
FT                   LTEACEYKRSFLKFPPYVGIILNIDSDHLDYYKDIDEIADTFLQFSRLIPEDGYLVGYA
FT                   DDQRVNEILSETNCNTLSYGFSDNANLTAKNIHFNTNGCATFDVYKDGNNLFNITLNVP
FT                   GKHNILNALASICVSLIFNISNDCIIEGLSNCKGAHKRFEYKGKLNGVTVIDDYAHHPT
FT                   EIKATLSTAKQMNHNKTYCIFQPHTYTRTKALFDEFTECFNDADELILMDIYAAREKNT
FT                   GLVSSDELGDALRNKGLKCINVHSHDEALNYVKSKLVSGDLLLTVGAGDVVIVGEKYLK
FT                   A"
FT   sig_peptide     complement(102770..102886)
FT                   /locus_tag="Cbei_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.770) with cleavage site probability 0.371 at
FT                   residue 39"
FT   gene            103174..103989
FT                   /locus_tag="Cbei_0079"
FT   CDS_pept        103174..103989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0079"
FT                   /product="purine operon repressor, PurR"
FT                   /note="TIGRFAM: pur operon repressor; PFAM:
FT                   phosphoribosyltransferase; purine repressor-like; KEGG:
FT                   cpr:CPR_2501 pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32269"
FT                   /db_xref="GOA:A6LPI9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPI9"
FT                   /protein_id="ABR32269.1"
FT                   /translation="MEKFTRNNRVVAITKILLENPNKILGLNKFSELLNAAKSTISEDI
FT                   VVVREILERLEMGKVETIAGVAGGIKYIPQSGEEEKKAFALELCQQLSDDGRVIPGNII
FT                   YMTDLMYDPKIINKAGVMLSSCFQGKEIDYVITVETKGIPLAYEVARNLGVQLVIARRD
FT                   SQVTEGPTVTINYVSGSNGRLQQMSLSKKSMKPSSKCIFIDDFMKGGGTAIGIKDLLKE
FT                   FDSELVGIGVLVDNKQIEKKLVDEYVSIVELKAVDKSAIIGIQPSKTFS"
FT   gene            104320..104595
FT                   /locus_tag="Cbei_0080"
FT   CDS_pept        104320..104595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0080"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: cac:CAC3223 stage
FT                   V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32270"
FT                   /db_xref="GOA:A6LPJ0"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPJ0"
FT                   /protein_id="ABR32270.1"
FT                   /translation="MQITDVRIRKIASEGKMKGIVSVTFDNEFVVHDIKVIEGQMGLFI
FT                   AMPSRKTPDGEFKDIAHPINTEAREKIQTAILEAYEKAVSEEVVEG"
FT   gene            104791..106158
FT                   /locus_tag="Cbei_0081"
FT   CDS_pept        104791..106158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0081"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: cpf:CPF_2813
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32271"
FT                   /db_xref="GOA:A6LPJ1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPJ1"
FT                   /protein_id="ABR32271.1"
FT                   /translation="MYKCALVLAAGQGKRIKSDLPKVLHKVCGKEMLKHVIDSIRKSGI
FT                   DDIDVIIGKGAELVKERTLDRNVSYSMQAEQLGTGHAVKCAEEFLKDKKGVVAIFTGDT
FT                   PLIKQSTIERLFNEHIEAKNSATILTAIVNDPTGYGRIVRTNDGVSKIVEHKDCTEEEL
FT                   KINEMNSGIYCFDIELLVDALNKITNNNGQGEYYLTDAIGILKSQGKKIGAVVTEYEET
FT                   IGVNSRVQLAEAEEILKNRINLMHMENGVTLIDPRTTYIGIDVEIGKDTIIYPNNILEG
FT                   NTKIGNNCLIYQNSRIVDSNIGNEVDVQASVILNSNIGDNTTVGPFAYIRPETTIGKHA
FT                   RIGDFVEIKKSTIGDGTKVSHLTYIGDAEVGSECNFGCGTVVVNYDGKNKHKTIIGDHS
FT                   FIGCNTNLVSPVTIHDNTYIAAGSTITSEVKEGDLAVARAKQRNISGWVDKKGLKK"
FT   gene            106206..107171
FT                   /locus_tag="Cbei_0082"
FT   CDS_pept        106206..107171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0082"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; KEGG: cpf:CPF_2812
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32272"
FT                   /db_xref="GOA:A6LPJ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPJ2"
FT                   /protein_id="ABR32272.1"
FT                   /translation="MITHGRNIKVFTGNSHSQLAQDIAEILGVPVGNSKVSTFSDGEIS
FT                   VDINETVRGNDVFIVQSTSSPVNNNLMELLIMIDAFKRASAGRITAVIPYYGYARQDRK
FT                   VKSRDPITAKLVADLLTAAGANRVLTMDLHASQIQGYFNIPVDHLLGAPILAEHYISKG
FT                   LVDQDDVVVVSPDLGSVTRARKFADNLHAPIAIIDKRRPKANVSEIMNIIGDIEGKRCI
FT                   LIDDMIDTAGTIANAANALKDLGAKNVYACCTHGVLSGPAMDRINTSAIEELVLLNTIP
FT                   LKEGNDNSKIRSISVAPLFAEAIKRIYDDQPISKLFECQQ"
FT   gene            107490..108176
FT                   /locus_tag="Cbei_0083"
FT   CDS_pept        107490..108176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0083"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ctc:CTC00189
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32273"
FT                   /db_xref="GOA:A6LPJ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPJ3"
FT                   /protein_id="ABR32273.1"
FT                   /translation="MDGVTTKVLIVDDDENISEVIDMYLKSSGYNTKIALNGKEAQEFY
FT                   LEYNPDIVLLDVMIPYIDGIDILKWIRKQKETPVIMITAKGDTFDKVLALEIGADDYIV
FT                   KPFEPKELLARVKAVLRRYSSENIKNEVIKLSDLSIDSTSYKVIYNEEEIKMPPKEFEL
FT                   LYYLANNKNKVFTREQLLCEVWGYDYPGDSRTVDVHIKRLREKLSSGEQWEIQTVWGVG
FT                   YKFEVN"
FT   gene            108177..109598
FT                   /locus_tag="Cbei_0084"
FT   CDS_pept        108177..109598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0084"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: cno:NT01CX_1017 sensory transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32274"
FT                   /db_xref="GOA:A6LPJ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPJ4"
FT                   /protein_id="ABR32274.1"
FT                   /translation="MKKSGSLLQKLIITFIVILTIVLVSLAWLLSIWFRITYFTEKKVQ
FT                   FQKDGEYISESIKTYNSNKNSLEYDKLQAIVDMSSVGANADITVSDKFDNIYIYSKTSS
FT                   TKEIDNKPENLDNSKYSLLDGKPVEYIGDRYTYIYPILEDDEFQGYIVMTAPLSTIGKQ
FT                   LHRIYLIVWISALGAMVFASVVLSLVSKKILINPLAEINKAAKRFANGEVNKRVHIESC
FT                   DEIGELASSFNIMAESLEKVENNRRDFISNVSHELRSPITSIKGFIAGIIDGVIPRDKE
FT                   GYYLDIVYSEIKRLTRLINDLLDLSAIESGKLKFNIRKIDINELIRLCVINNEQKIREK
FT                   QIMLKIDLKDQNCYVKADEDKTMQVITNLLDNAIKYCGNNGIIRISTYSKGSKVFVEIY
FT                   NNGPKIADEEIRHIWNRFYKSDKSRTNKVSTGLGLPIVRMIIMQQGEEVWVKNHPNIGV
FT                   TFTFSLTKYKNNKIR"
FT   sig_peptide     108177..108260
FT                   /locus_tag="Cbei_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.843 at
FT                   residue 28"
FT   gene            109621..110196
FT                   /locus_tag="Cbei_0085"
FT   CDS_pept        109621..110196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0085"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: cno:NT01CX_1019
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32275"
FT                   /db_xref="GOA:A6LPJ5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPJ5"
FT                   /protein_id="ABR32275.1"
FT                   /translation="MFLIVGLGNPGNEYENTRHNIGFKVIDNIAKEYNIEINRQKFKGM
FT                   YGEGFINGKKVMLLKPTTYMNLSGESVREVVDFYNLNNDEILVIYDDISLEVGKLRIRE
FT                   KGSAGGHNGIKSIIAHLNSEIFSRIKVGVGQPNGDLVKHVLGKFTKEETAILSESIEAS
FT                   TKAAAEIIKNDVKTAMNQFNGFKASTTV"
FT   gene            110211..113711
FT                   /locus_tag="Cbei_0086"
FT   CDS_pept        110211..113711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0086"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   helicase domain protein; transcription factor CarD; TRCF
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: cpr:CPR_2493
FT                   transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32276"
FT                   /db_xref="GOA:A6LPJ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPJ6"
FT                   /protein_id="ABR32276.1"
FT                   /translation="MRLKGLLEPLESSLEFQDIIQGIESKRYPIGIYGASESGRGYIIS
FT                   GIFENTNRSIVVVTQSDMEAKNLYEDLIFYTSEVYYFPVKEMVFYNIDAISGDLRWARL
FT                   KVINEILNNKKKIIVTSIEAFAAKYTPHNLFLEYSMKFKEGDEVNLADISKKLIQSGYE
FT                   RVEMVEGKGQFSLRGGILDVFPTGSTYPYRVELFGDEIESIRTFNTESQRSIEKVKKID
FT                   IFPAKEVIVSEEMLEVGRNKLKEEFNKIAESDKDSERVEKLRKILNKNLELLEETSSFE
FT                   TIDSYLPYFTKETESLFDYFKNYFFIVDNVQRCNGKLESTYLEFEENFTAFSQRGDIFP
FT                   GQGNLLINKEEVLESFEDEKIAFIEALTKVSGWLKPLSIVNVAQTTLNNYQGQLDLLID
FT                   EILGKKNLGYKTLILSGTRARGERLVGTLRDRGIESVYKDTVDKIEYGEVVITFGNQLR
FT                   GFEYPQYKVCIISDKEVFGAAKRKLKSSKAKKKGISKIKSFAELKPGDYVVHANHGIGV
FT                   YKGIKQIDVGGHKRDYLDIVYDKGDKLYVPVDQLDLIQKYIGSEGKSPKVNKLGSAEWQ
FT                   KAKAKARKSINEIAEDLVKLYAMRSTVKGHKFSKDTEWQKQFEDEFPFEETPDQLTSLE
FT                   EIKIDMESDKPMDRLLCGDVGYGKTEVAIRAAFKAVMDGKQVALLVPTTILAEQHYKNI
FT                   KNRFSDFPIKIDMVSRFRTAKQQKEILQKVKEGNLDILIGTHRLVSKDIQFKDLGLLIV
FT                   DEEQRFGVKQKEKIKGIKKNVDVLTLSATPIPRTLHMSLSGVRDISVIETPPEERYPVQ
FT                   TYVVEQNDQLIRDAILREIGRGGQVYFVYNRVEDIERMAKYVQSLVPESKVGIAHGQMA
FT                   ERQLEKEMFDFMSEEYNVLVCTTIIETGMDIQNVNTIIIYDADKMGLSQLYQLRGRVGR
FT                   SNRIAYAYLLYTKDKVLTEVAEKRLKALKDFTELGSGFKIAMRDLEIRGAGNMMGSSQH
FT                   GHMASIGYDLYCRMLEDTVKLLKGEIQKEPIETTLDIKVDAFISENYIEDEIQKIEVYK
FT                   KIAAIEGLDDYSDIKEELEDRYSKIPEPVYNLMDIAYIKSRAKSIFIEEIKETPKELLF
FT                   KFSQGESEYKNIFKILMEKYKNSVVLKFGSNPYFAFKLKYIKKENKLEFLKEVFDDIIL
FT                   "
FT   gene            113945..115033
FT                   /locus_tag="Cbei_0087"
FT   CDS_pept        113945..115033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0087"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA N-terminal domain; KEGG: cpf:CPF_2806 putative foldase
FT                   protein PrsA"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32277"
FT                   /db_xref="GOA:A6LPJ7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPJ7"
FT                   /protein_id="ABR32277.1"
FT                   /translation="MWKVIFSGFKSRISEGKTLKKLKKFVAALAMVTIAVSAMGCKMIE
FT                   KTPEAIQKTVLATVGNEKITKGDLDKEMEKYTAQLKQQYGDNYESNAQVKDQLQQAKKQ
FT                   ELDSLVTQKVVLQKATELNLKPSDDDINKQVDDQIAQIKSQYSEEGQFESVLEQNGLTE
FT                   DQLKDVVKNNVIMQAVQQDIVKDIEVTDDDVQTYYNENKDSKYTQGAGANASHILIAEK
FT                   ASDGSIDYDASLTKANDIKAKLDSGADFAKLAKENSTDSGTKDNGGSLGFVAYNSTQLV
FT                   AEFMDGFKNLKEGEISAPVKSQFGYHIIKATGLKDSQVTPFEQVKDQIKSSLLQQKQQD
FT                   ALSSKITEWKTDLKVKTYEDKL"
FT   sig_peptide     113945..114067
FT                   /locus_tag="Cbei_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.979 at
FT                   residue 41"
FT   gene            115288..115836
FT                   /locus_tag="Cbei_0088"
FT   CDS_pept        115288..115836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0088"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   Sporulation stage V, protein T; PFAM: SpoVT/AbrB domain
FT                   protein; KEGG: cpe:CPE2482 stage V sprulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32278"
FT                   /db_xref="GOA:A6LPJ8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPJ8"
FT                   /protein_id="ABR32278.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFTDRDGGVI
FT                   LKKYSPIEELTNFSKEYCESLQQVIGHVVLIADKDAFVSVSGAPKKDYIERKVSSELEK
FT                   IMDGRKTVLLNKADNAVIPLHNDDDETEYTSQVISPIIAEGDEIGAVIILSKEDGELGE
FT                   VETKLVETAAAFLGKQMEQ"
FT   gene            115932..117467
FT                   /locus_tag="Cbei_0089"
FT   CDS_pept        115932..117467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0089"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: ctc:CTC00197 stage V sporulation
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32279"
FT                   /db_xref="GOA:A6LPJ9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPJ9"
FT                   /protein_id="ABR32279.1"
FT                   /translation="MKKQSLIRGSIILGVAGILTRFLGLFFRWPLIMLIGDEGIGYYQM
FT                   SYPLYMFFIAMASGVPVAISKMISEKNATNDIYGSFEVMKESAILMTIIGTGTTLALFF
FT                   FAKPIVLFLKWDPKAYYSLIGISFAPIVISFVTIFRGFFQGLQNMTPSAISQIIEQIGR
FT                   VIFGVGLAVFLLPRGIEYSAGGAAFGATAGAVLGGAYLYSNYKRVKKRYAIKKIKSNPE
FT                   ILNTILKIAIPISLGTTVSSIMNLIDSILVPQKLLDAGFTNVQSTVLYAQLTGKASVIV
FT                   NIPLTLSMAICTSLIPIIAENFILKKQKELKSKIDASMKMASVIAIPCTFGLFFLAEPV
FT                   MKFIFPGRFEGIEILKYLSLTIPFIIITQTTTAILQGTGHYIKPVINLLIGCLIKIVLT
FT                   WVLVPMQMFNIYGAVLASFGAYLTVSILNIVMMKFTLRVRLNLYEILIKPCYASSIMML
FT                   IVLISYNILYKNTISNGISCLTSIFLGMIVYIIMIIVFKVFNVEEIRDRFKRK"
FT   gene            117485..118936
FT                   /locus_tag="Cbei_0090"
FT   CDS_pept        117485..118936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0090"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; MazG
FT                   nucleotide pyrophosphohydrolase; KEGG: cpr:CPR_2489 MazG
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32280"
FT                   /db_xref="GOA:A6LPK0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK0"
FT                   /protein_id="ABR32280.1"
FT                   /translation="MIKIVGLGPGSKDALTIGTINELEASKHIFLRTEKHPTVDYLKEK
FT                   NIVFDTYDNIYDSIDNFDEVYLNIAKDIINKHKNMTDLIYAVPGHPLVAEKSVFNLIEL
FT                   CKENGIEYKVIPAVSFIDAMIESLKIDPIEGLKVIDSFDISNQILDKRIGTIITQVYNQ
FT                   LIASEVKLRLLECYNDETEIYYVRAAGIEGQESIRKIPLFELDMQEDIDYLTSIYIPKD
FT                   LKNKKDFNDFLDIIEVLRGEDGCPWDREQTHKSLKKALIEESYEVIDAIDQDDDNSLIE
FT                   ELGDVLLQVVFHASIGKEDGYFDIGDVIEGICNKMISRHPHVFKDADGLNSSEDVLIKW
FT                   DELKKKEKGYNSVVDELKGITKGLPALLRAHKIQEKASKVGFDFENIDFAVSKVKEELK
FT                   EVIDVYNTENVEKIEEEVGDLIFSCVNIARFLKVDEEIALNYTIDKFIKRFQYIERAAK
FT                   DKNIELTSMTLDEMNELWEISKNLG"
FT   gene            119157..119432
FT                   /locus_tag="Cbei_0091"
FT   CDS_pept        119157..119432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0091"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: cac:CAC3211 DNA binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32281"
FT                   /db_xref="GOA:A6LPK1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK1"
FT                   /protein_id="ABR32281.1"
FT                   /translation="MNKAELITSMAEKSKLTKKDAELALKALIESVEEALEKGEKVQLV
FT                   GFGTFETRERAAREGRNPRTKEVINIPATTVPVFKAGKEFKDKVNK"
FT   gene            119503..119763
FT                   /locus_tag="Cbei_0092"
FT   CDS_pept        119503..119763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0092"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   cpf:CPF_2801 S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32282"
FT                   /db_xref="GOA:A6LPK2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK2"
FT                   /protein_id="ABR32282.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEICESGRILINGKVAKPSTKIKEGD
FT                   IIEITFANKVLKAEIASVVEHVRKEEAKEMYIILEGEEDKE"
FT   gene            119967..120260
FT                   /locus_tag="Cbei_0093"
FT   CDS_pept        119967..120260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0093"
FT                   /product="YabP family protein"
FT                   /note="PFAM: YabP family protein; KEGG: cno:NT01CX_1027
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32283"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK3"
FT                   /protein_id="ABR32283.1"
FT                   /translation="MEKRVENKVEDNKSSLSLENRKKLTLSGVIEVISFDEQKIDLTTN
FT                   LGNLTIKGEELKMNKLDVQNGDVIIAGSIASMVYNGKISKKSNESIISRLFK"
FT   gene            120270..120662
FT                   /locus_tag="Cbei_0094"
FT   CDS_pept        120270..120662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0094"
FT                   /product="Spore cortex biosynthesis protein YabQ"
FT                   /note="TIGRFAM: Spore cortex biosynthesis protein YabQ;
FT                   KEGG: cpf:CPF_2799 spore cortex biosynthesis protein YabQ"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32284"
FT                   /db_xref="GOA:A6LPK4"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK4"
FT                   /protein_id="ABR32284.1"
FT                   /translation="MPLGLNMQINLVICSLIGGVITGILFDIYRGIRGLNSIKILTIIE
FT                   DMLFCVLIALIVFTFLLYTNYAFLTPYVYIFIIMAIILYFKFISKYFYNSEMLIAKLSY
FT                   KLIRILLKNLLYPLKIIAYKITDKRK"
FT   gene            120740..121027
FT                   /locus_tag="Cbei_0095"
FT   CDS_pept        120740..121027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0095"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: cpf:CPF_2798
FT                   putative cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32285"
FT                   /db_xref="GOA:A6LPK5"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK5"
FT                   /protein_id="ABR32285.1"
FT                   /translation="MKTKLILKRTIITGFIIFFAFSYIRQSMTMNRIQKEIDSKQVQLN
FT                   EIKQKNERLQDEVDKINSNSSDYLEKLARERLGMIKPGEKVVNGEITNQN"
FT   sig_peptide     120740..120829
FT                   /locus_tag="Cbei_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.763) with cleavage site probability 0.451 at
FT                   residue 30"
FT   gene            121177..121587
FT                   /locus_tag="Cbei_0096"
FT   CDS_pept        121177..121587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0096"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   cpr:CPR_2483 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32286"
FT                   /db_xref="GOA:A6LPK6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK6"
FT                   /protein_id="ABR32286.1"
FT                   /translation="MTLMAGNIVEGTVINITNFGAFIEVEGKTGLVHISEVADSYVKDI
FT                   REHLSEQDKVKVKVISIDDNGKISLSIKQANVQRKSVKPAEIDWKAPDKKKTTNSGNFE
FT                   DIMSKFLKDSEERMQDVKKHQEFKSKGGKKGC"
FT   gene            121863..121951
FT                   /locus_tag="Cbei_R0011"
FT                   /note="tRNA-Leu1"
FT   tRNA            121863..121951
FT                   /locus_tag="Cbei_R0011"
FT                   /product="tRNA-Leu"
FT   gene            121973..122048
FT                   /locus_tag="Cbei_R0012"
FT                   /note="tRNA-Met2"
FT   tRNA            121973..122048
FT                   /locus_tag="Cbei_R0012"
FT                   /product="tRNA-Met"
FT   gene            122056..122132
FT                   /locus_tag="Cbei_R0013"
FT                   /note="tRNA-Met3"
FT   tRNA            122056..122132
FT                   /locus_tag="Cbei_R0013"
FT                   /product="tRNA-Met"
FT   gene            122139..122227
FT                   /locus_tag="Cbei_R0014"
FT                   /note="tRNA-Leu2"
FT   tRNA            122139..122227
FT                   /locus_tag="Cbei_R0014"
FT                   /product="tRNA-Leu"
FT   gene            122249..122324
FT                   /locus_tag="Cbei_R0015"
FT                   /note="tRNA-Met4"
FT   tRNA            122249..122324
FT                   /locus_tag="Cbei_R0015"
FT                   /product="tRNA-Met"
FT   gene            122332..122408
FT                   /locus_tag="Cbei_R0016"
FT                   /note="tRNA-Met5"
FT   tRNA            122332..122408
FT                   /locus_tag="Cbei_R0016"
FT                   /product="tRNA-Met"
FT   gene            122415..122503
FT                   /locus_tag="Cbei_R0017"
FT                   /note="tRNA-Leu3"
FT   tRNA            122415..122503
FT                   /locus_tag="Cbei_R0017"
FT                   /product="tRNA-Leu"
FT   gene            122525..122600
FT                   /locus_tag="Cbei_R0018"
FT                   /note="tRNA-Met6"
FT   tRNA            122525..122600
FT                   /locus_tag="Cbei_R0018"
FT                   /product="tRNA-Met"
FT   gene            122671..122759
FT                   /locus_tag="Cbei_R0019"
FT                   /note="tRNA-Leu4"
FT   tRNA            122671..122759
FT                   /locus_tag="Cbei_R0019"
FT                   /product="tRNA-Leu"
FT   gene            122781..122856
FT                   /locus_tag="Cbei_R0020"
FT                   /note="tRNA-Met7"
FT   tRNA            122781..122856
FT                   /locus_tag="Cbei_R0020"
FT                   /product="tRNA-Met"
FT   gene            123521..125932
FT                   /locus_tag="Cbei_0097"
FT   CDS_pept        123521..125932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0097"
FT                   /product="Sporulation stage II, protein E"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: cpf:CPF_2789 stage II sporulation protein E;
FT                   TIGRFAM: Sporulation stage II, protein E; PFAM: Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32287"
FT                   /db_xref="GOA:A6LPK7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK7"
FT                   /protein_id="ABR32287.1"
FT                   /translation="MRRANVQYGLGLDKYEGITRVENLRKKLWMKTSIVKLGIILMSGI
FT                   LLGRVNLLLNQSDSLGIAPIGIAYLIAVVTKENRRNSLTVAIGIAIGYLTISSLLTDGY
FT                   VYLVSVALVTIYYVFIASAKNRKKELVGFVIILSSFFCYGLLVNKYELGVNITLCLIQT
FT                   LIVLPIYYVIKYALNSLEEINTNYFFSSEEIVSVGIFLCLLVAGIGNINISNYSIRNIC
FT                   ALTLVLTIAYVGGATYGTMIGVSMGIMLGVASNDMMYSVAFFGVGGLIVGIFKDTGKIF
FT                   SILSGIIIYTALALYSNAVTLKLGVEVLTSSVLFLCVPKPVFTSIEIEINPYRKKASLG
FT                   EIQLNAIKEEFTFKLKELTSVLTNVSRCLLTNNDNENLLIKSKGSALVENLADRSCSSC
FT                   ENRPLCWEREFHQTFNSFQMLIQSKEEGKLAIPMDLQKRCIKNFTLLKNAEGIVTNYNV
FT                   NESIKERLAEGRNILSSHITNISCALDNLLNDFKKEVRIDTDLERLTKRILNKNSIYYN
FT                   DIFCYIDKSGRVKIRLSVNNCEGADYYGKNIVSLLSSAMRMKLCIGDDGCKINPQTNEC
FT                   IITIEEKPKYYMVSYGAMEPKGGETQIGDSYSFGRTRNGTYMTILSDGMGSGPEAKEES
FT                   KATVDLVEKLIEAGFDEDITVNTVNSIMGMRFSEDEKYATLDLNRIDLYNGNAIFVKIG
FT                   AAPSFIKRGRDVISINSKNLPFGLVDEVDVEVIREVLRPGDILINVSDGILDIDKSNSG
FT                   ESTWIEDYLKTINSDPRELSEKVLERAKKLSNGTIKDDMTVVVSKVYLDS"
FT   gene            126199..127605
FT                   /locus_tag="Cbei_0098"
FT   CDS_pept        126199..127605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0098"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: cno:NT01CX_1038 cell cycle
FT                   protein MesJ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32288"
FT                   /db_xref="GOA:A6LPK8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK8"
FT                   /protein_id="ABR32288.1"
FT                   /translation="MYRKVLSYIKDNNLIKPNDKILIALSGGPDSICLLNVLFELREKL
FT                   NISIAAAHLNHLLRGEDAFEDERYVINTCNDMGIKCFVKRVDINAYSKESKLSSEMAGR
FT                   NARYDFFDEILEKEGFNKIATAHNANDQAETVLFRLMRGTGLEGLGGIRASRDDKIIRP
FT                   ILCLSREEVENYVKLKNLNPRIDKTNFEKIYNRNKIRLDILPYMKENFNEDIVQTLNRM
FT                   STLLQKDNEFLEKLSAGLYNKYCMECNDYFIIKKEIFKEEEPLVNRVLRHALTRYSKSN
FT                   YDFEVKHIYEISCLAQKYSGKLVHLPNGVCAENVYGDIYIKTKTKKSDINSKKEEIILG
FT                   KDNIYINTVEFHKYVIQFSIINGYNENSINLKQGDFVKYFDFDKINNNISIRNRKNGDK
FT                   IIPLGMSGSKKLKDIFIDMKIPKNERECIPILCFDERIAWVIGIRISEEYKLTSKSTNI
FT                   LKVVVQRKEY"
FT   gene            127608..128147
FT                   /locus_tag="Cbei_0099"
FT   CDS_pept        127608..128147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0099"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; KEGG: cpe:CPE2471
FT                   hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32289"
FT                   /db_xref="GOA:A6LPK9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPK9"
FT                   /protein_id="ABR32289.1"
FT                   /translation="MKQDIQEILYSEEILSKRIKELASEISTDYRGKDLLIVGILKGSV
FT                   IFAAELIKNISIKCEIDFMAVSSYGSSTETSGVVRILKDLDNSIEGKDILVVEDIVDTG
FT                   VTLTYLLKYLKARKANSIEIVALLNKQARRKSDLDVKYIGFEVPDGFIVGYGIDYAEKY
FT                   RNLPFIGILKPEVYEK"
FT   gene            128222..130030
FT                   /locus_tag="Cbei_0100"
FT   CDS_pept        128222..130030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0100"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: ctc:CTC00205 cell division protein ftsH;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32290"
FT                   /db_xref="GOA:A6LPL0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPL0"
FT                   /protein_id="ABR32290.1"
FT                   /translation="MKKYSSAAVWIVCSVMLILAAVTMWQTGKGSNEITYSSFIQKWNS
FT                   NEIESILVKEDSMTIEGKTTDNKSFVTIAPGELVSSLIVNQPKLDVKVVFEKPSNNATW
FT                   IATLLPFILMAVFIFIFLFIFTQQSQSGSGGRGVMNFGKSKAKMVTPDTQTVTFEDIAG
FT                   ADEEKAELEEIVEFLKLPSKYIQIGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFS
FT                   ISGSDFVEMFVGVGASRVRSLFEEAKKNSPCIVFIDEIDAVGRQRGAGLGGGHDEREQT
FT                   LNQLLVEMDGFGANEGIIMIAATNRPDILDPALLRPGRFDRQIIVGAPDVKGREEILKV
FT                   HTRKKPLNDDVKLDVLARRTPGFSGADLENLTNEAALLAVRKDKKQISMSEMEEAITKV
FT                   IAGPEKKSRVITEHDRKLTAYHEAGHAVVMRLLPHCDPVHEISVIPRGRAGGYTMHLPK
FT                   EDTSYTSKSKLKDEMVGLLGGRVAERLIMGDISTGAKNDIDRASHIARSMVMDYGMSEE
FT                   IGTISFSTSGHDEVFLGRDLGKGRNFSEEIGSKIDKEIKKFIDEAYDRANRLLKENINK
FT                   LHAVAKALIEKEKLDAEEFEDIFVNN"
FT   sig_peptide     128222..128293
FT                   /locus_tag="Cbei_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.356 at
FT                   residue 24"
FT   gene            130234..131904
FT                   /locus_tag="Cbei_0101"
FT   CDS_pept        130234..131904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0101"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase, FTHFS; KEGG:
FT                   cpr:CPR_2471 formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32291"
FT                   /db_xref="GOA:A6LPL1"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPL1"
FT                   /protein_id="ABR32291.1"
FT                   /translation="MKSDIQIAQEAKMEPIKNVAEKLGLCEDDIEYYGKYKCKISLDVY
FT                   DKVKNNNNGKLVLVTAINPTPAGEGKSTVTVGLGQALNRIGKKAVIALREPSLGPVFGI
FT                   KGGAAGGGYAQVVPMEDINLHFTGDMHAITSANNLLSAAIDNHIHQGNVLRIDSRRIVF
FT                   KRVMDMNDRALRHIIVGMGGKVNGFVREDGFNITVASEIMAILCLASDLEDLKERMGNI
FT                   VIAYNLDGNPVYAKELEIQGAMALLMKDAIKPNLVQTLENTPALIHGGPFANIAHGCNS
FT                   IMATKLALKLGDVVITEAGFGADLGAEKFFDIKCRYGNLEPECVVVVATIRALKHHGGV
FT                   AKTELNIPNVEALKDGIANLEKQIENIKKFKITPVVAINKFVTDSSEEVEFIKDFCDRI
FT                   GVKVALCDVWAKGGEGGIDLANIVLDALENSESNFEPIYDKEKSIREKIFTIASEIYGA
FT                   DKVNYTPAAKKQIDELEKFKLDKLPICMAKTQYSLSDNPSLLARPTGFDITVKEVRVSN
FT                   GAGFIVVQTGDIMTMPGLPKVPAANKMDVLKSGEIIGLF"
FT   gene            132096..132896
FT                   /locus_tag="Cbei_0102"
FT   CDS_pept        132096..132896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0102"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bvg accessory factor; KEGG: cpe:CPE2468
FT                   putative transcriptional regulators, homologs of Bvg
FT                   accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32292"
FT                   /db_xref="GOA:A6LPL2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPL2"
FT                   /protein_id="ABR32292.1"
FT                   /translation="MILLVDAGNTNIVLGVHNGERYIASWRISSEGNKTSDEYGIQVMQ
FT                   LFNLSDIDPKNITGVIVSSVVPNIMHSLENMLRKCFCHEPIIVGPGVKTGINIKYDNPR
FT                   EVGADRIVNAVAAYEIYKRPVIIIDFGTATTFCAVRANGDYLGGCICPGIRISADALFE
FT                   RAAKLPRVELEVPKNMICKNTVSSMQSGIIFGYIGQVEYIVKKMKQEMKNSKYKEEPFV
FT                   LATGGLANLIAKETDVIDKVDSDLTLEGLKILYEKNKEIEISQR"
FT   gene            132946..133911
FT                   /locus_tag="Cbei_0103"
FT   CDS_pept        132946..133911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0103"
FT                   /product="putative TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase, DuS; dihydroorotate
FT                   dehydrogenase; KEGG: cpr:CPR_2469 putative dihydrouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32293"
FT                   /db_xref="GOA:A6LPL3"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPL3"
FT                   /protein_id="ABR32293.1"
FT                   /translation="MKIGNLTFENNIFLAPMAGVTDISFRGLCKEMGCGLVYTEMVSAK
FT                   ALYYGSENTQTLLRIADEEKPVAAQIFGREPDVMARICEEYLNNRKDICIIDINMGCPA
FT                   PKIVKNGEGSALMKEPELAYDIVRTIKKVSTKPVTVKFRKGFDEDNINAVEFAKGMEQA
FT                   GADAIAVHGRTRKQMYQGKADWDIIKRVKDSVSIPVIGNGDVFSPEDAIRMKRTTNCDG
FT                   IMIARGSQGNPWIFRQINNLLNGEVIQEVSDNEKIEMCIRHYELAIKYDGEFKAIREMR
FT                   KHASWYIKGLPRCTELKNKINTINDSEKVIEALRKYQDEL"
FT   gene            134393..134875
FT                   /locus_tag="Cbei_0104"
FT   CDS_pept        134393..134875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0104"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: cpr:CPR_2468 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32294"
FT                   /db_xref="GOA:A6LPL4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPL4"
FT                   /protein_id="ABR32294.1"
FT                   /translation="MSQSKQYVMTYEGVKKLESELEYLKTVKRKEITEKIKIALGYGDL
FT                   SENSEYDEAKNDQAFTEGRIIQLENMLKNAVVVDESEIPSDIVSVGSKVKVKDYEFDEE
FT                   VEYSIVGSAEADPMNFKISNESPVGNALVGKKVGDVVEVTVPDGVNKFEILGISRS"
FT   gene            134890..136395
FT                   /locus_tag="Cbei_0105"
FT   CDS_pept        134890..136395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0105"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; KEGG: cpf:CPF_2781 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32295"
FT                   /db_xref="GOA:A6LPL5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPL5"
FT                   /protein_id="ABR32295.1"
FT                   /translation="MSTEEMSMQELESQYNEQEGLRRAKLAELQGAGKDPFDVYKVNRT
FT                   HTSEEVKANYDALEGKEVTVAGRLMSKRGQGKVVFSDIHDKDGKIQLFLKIDKVGEENL
FT                   KQYKTFDLGDWIAATGEVFTTKTGEVSVNVNTFELTCKSLKPLPEKWHGLKDPDLRYRQ
FT                   REVDIITNTEVKDTFIKRSKIISAIREFLDAKSFIEVETPILGAIAGGAAAKPFITHHN
FT                   TLDMDMYLRIATELYLKRLIVAGFEKVYEIGRNFRNEGMSVRHNPEFTAIELYEAYSDY
FT                   NDMMEITENMVAYICEKVNGTTKVAYQGTEIDFKPPWRRITMVDAVKEYAGVDFNEIKS
FT                   DDEAQTIAKEKHLEFAKPLNTVTKGEVLNALYEEFGEANMIQPTFVTDYPVEISPLTKK
FT                   KRGNPEFTERFEGFVFGRELCNAYSELNDPIVQRQRFEQQAKERELGDDEAYMLDEQFM
FT                   SALETGMPPTGGMGMGIDRLIMFLTDSASIRDVILFPTMRPQK"
FT   gene            136705..136779
FT                   /locus_tag="Cbei_R0021"
FT                   /note="tRNA-Asn1"
FT   tRNA            136705..136779
FT                   /locus_tag="Cbei_R0021"
FT                   /product="tRNA-Asn"
FT   gene            137017..137091
FT                   /locus_tag="Cbei_R0022"
FT                   /note="tRNA-Asn2"
FT   tRNA            137017..137091
FT                   /locus_tag="Cbei_R0022"
FT                   /product="tRNA-Asn"
FT   gene            137531..137605
FT                   /locus_tag="Cbei_R0023"
FT                   /note="tRNA-Asn3"
FT   tRNA            137531..137605
FT                   /locus_tag="Cbei_R0023"
FT                   /product="tRNA-Asn"
FT   gene            137905..139296
FT                   /locus_tag="Cbei_0106"
FT   CDS_pept        137905..139296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0106"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; KEGG: cpr:CPR_2465 glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32296"
FT                   /db_xref="GOA:A6LPL6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPL6"
FT                   /protein_id="ABR32296.1"
FT                   /translation="MAVEKTMDKIVALCKNRGFVFPGSDIYGGLANSWDYGPLGVEFKN
FT                   NVKKAWWKKFVQESPYNVGLDSAILMNREVWVASGHVGGFSDPLMDCKECKARFRADKL
FT                   VEDHMTENGAEVATADGWTNEQLKEYIERNNIVCPKCGKMNYTDIRKFNLMFKTFQGVT
FT                   EDAKSEMYLRPETAQGIFVNFKAVQRTSRKKVPFGIAQIGKSFRNEITPGNFTFRTREF
FT                   EQMELEFFCKPGTDLEWHKYWKDYCWNFLLNLNVKAENLRMRDHGEEELSFYSNATSDI
FT                   EYLFPFGWGELWGIADRTDYDLSKHQEHSGQDLSYLDQTTNEKYVPYVIEPSLGADRVA
FT                   LAFLIEAYDEEELEGGDVRTVMHLHPALAPFKAAILPLSKKLSEKSLDIYAELSKKFNL
FT                   DFDETGSIGKRYRRQDEIGTPYCITIDFDTLEDESVTIRNRDTMEQERIKISEIENYIQ
FT                   ASLEF"
FT   gene            139445..140821
FT                   /locus_tag="Cbei_0107"
FT   CDS_pept        139445..140821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0107"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   cpr:CPR_2461 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32297"
FT                   /db_xref="GOA:A6LPL7"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPL7"
FT                   /protein_id="ABR32297.1"
FT                   /translation="MKKDFNEFKEFIVGKKVGVVGIGVSNIPLINFLIDLGAAVTAFDK
FT                   KNLEELGDVADGFNKKGVKLELGEKYLDNLKGFDVIFKTPSMRIDSEALVRARKEGAYV
FT                   TSEMEEFVRYTRGKVYGITGSDGKTTTTTIISKLLEGQGYKTWVGGNIGTPLFSEIENI
FT                   HDEDKVVLELSSFQLMTMTQEIDVAVCTNLSPNHLDMHKSMQEYIDAKKNIFIYQNSNG
FT                   LLVVNRENEITHGFIKEAKGNVKEFSSKRELIDGAYYKNGILYLEDKEVCKKDDIVIKG
FT                   MHNVENYLAAFLATKDDVSVEVMKKVAETFAGVEHRCELVREIDGVKYYNDSIASSPTR
FT                   TLAGLRAFDEKVIVIAGGYDKNIPFEPLAYEGYPYIKELILMGATKHKIKDVFDNLENE
FT                   KGIKININMVESLEEAVRLAESIANQGDIVTLSPACASFDMYPNFMIRGNKFKEIVKSL
FT                   "
FT   gene            complement(140884..141906)
FT                   /locus_tag="Cbei_0108"
FT   CDS_pept        complement(140884..141906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC3039 hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32298"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPL8"
FT                   /protein_id="ABR32298.1"
FT                   /translation="MNRGIFYFILPFTMFSFIGCSSNIASPSNSQTAPPSKTSIQVQNT
FT                   QAMDATEPNSFILTSSSSYFCPFLFNGNNLIFPNPDENNRISIIPSPFPKDILESKSVT
FT                   DFANYSADNMTLINQMIYFSNGSDNNALSSFNISDKTYTKLNDDSVNNLIASNSELFYI
FT                   NKNNENRIYKYNTSTSEHSLVCPDSVGSFIINGDFIVYQNLSDNSKLYSIKTDGSNRQK
FT                   LTDYTANSFIVFDGQLLFFNSSDNNNLYSLDPSTLSCKRISIMNGFQLKIIDKSIYFIN
FT                   GSDSNNLYSLSVDLKNSTATSKPEISEGINEYYLTTSGIFYSPSINVNNIYFKDFSSKS
FT                   "
FT   sig_peptide     complement(141814..141906)
FT                   /locus_tag="Cbei_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.681 at
FT                   residue 31"
FT   gene            142453..143957
FT                   /locus_tag="Cbei_R0024"
FT   rRNA            142453..143957
FT                   /locus_tag="Cbei_R0024"
FT                   /product="16S ribosomal RNA"
FT   gene            144098..144173
FT                   /locus_tag="Cbei_R0025"
FT                   /note="tRNA-Ala2"
FT   tRNA            144098..144173
FT                   /locus_tag="Cbei_R0025"
FT                   /product="tRNA-Ala"
FT   gene            144177..144253
FT                   /locus_tag="Cbei_R0026"
FT                   /note="tRNA-Ile1"
FT   tRNA            144177..144253
FT                   /locus_tag="Cbei_R0026"
FT                   /product="tRNA-Ile"
FT   gene            144366..147274
FT                   /locus_tag="Cbei_R0027"
FT   rRNA            144366..147274
FT                   /locus_tag="Cbei_R0027"
FT                   /product="23S ribosomal RNA"
FT   gene            147348..147463
FT                   /locus_tag="Cbei_R0028"
FT   rRNA            147348..147463
FT                   /locus_tag="Cbei_R0028"
FT                   /product="5S ribosomal RNA"
FT   gene            147468..147543
FT                   /locus_tag="Cbei_R0029"
FT                   /note="tRNA-Phe1"
FT   tRNA            147468..147543
FT                   /locus_tag="Cbei_R0029"
FT                   /product="tRNA-Phe"
FT   gene            147548..147622
FT                   /locus_tag="Cbei_R0030"
FT                   /note="tRNA-Cys1"
FT   tRNA            147548..147622
FT                   /locus_tag="Cbei_R0030"
FT                   /product="tRNA-Cys"
FT   gene            148303..149700
FT                   /locus_tag="Cbei_0109"
FT   CDS_pept        148303..149700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0109"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1; KEGG:
FT                   lbr:LVIS_0186 D-xylose proton-symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32299"
FT                   /db_xref="GOA:A6LPL9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPL9"
FT                   /protein_id="ABR32299.1"
FT                   /translation="MKIKISNSVIYIFAALSGLLFGYDTGVISGAILFIQEQMHLDSWQ
FT                   QGWVVSSVLLGAILGAAIIGPMSDKYGRIKLILTSAVIFFVGALGSAFAPEIWSLIIFR
FT                   IILGVAVGASSALIPTYLAELSPSEKRGTISSLFQLMVMSGILLAYITNYAFSDLYTGW
FT                   RVMLGFAAIPAAVLLIGALVLPESPRFLVKDGRADEARSILEHMNKHDKGAVNYELAQI
FT                   KKQAEIKSGGVKELFSEFVRPALVIGFGLAVFQQIMGCNTVLYYAPTIFTDVGFGVQAA
FT                   LLAHIGIGVFNIIITAIAVAIMDKIDRKKMLIYGAIGMGVSLLIMSISMKFSNGSFVAS
FT                   IICVIALTIYIAFFSATWGPVMWVMVGEVFPLNIRGLGNSFSSVINWSANMMVSLTFPV
FT                   LLNYFGTGSLFIGYGVICFAAIWFVQSKVFETRNRSLEDIEAELRSYKGVEKLQKDICT
FT                   QDATTKA"
FT   sig_peptide     148303..148371
FT                   /locus_tag="Cbei_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.955 at
FT                   residue 23"
FT   gene            complement(149740..150687)
FT                   /locus_tag="Cbei_0110"
FT   CDS_pept        complement(149740..150687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0110"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: cpr:CPR_2452 magnesium and cobalt transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32300"
FT                   /db_xref="GOA:A6LPM0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM0"
FT                   /protein_id="ABR32300.1"
FT                   /translation="MIQIYKSESEFDPSLKLIDTIENGAWINLIAPSAEELILISKKTG
FT                   VPLEFLKAALDDEETSRIDIEEDSLLIIVDIPFTEMEDNSLTYDTYPLSIIHTNKQLIT
FT                   VCLKNSKILTDFANNKIKSFYTFKKSRFTLQILNRISTYYLLYLRQIDKKSLMIEKRLH
FT                   KSMKNRELIQLHSLEKSLVYFSTSLKANEITLEKMLKLELMQKYEEDKDVLEDVIIENK
FT                   QAIEMTEIYSNILASTMDFFASVISNNLNIVMKVLASVTILMAIPTIIGGIFGMNIALP
FT                   LSADNPHAFSIVMGVTVGICGLVAFILYKKDMFN"
FT   gene            complement(150965..152125)
FT                   /locus_tag="Cbei_0111"
FT   CDS_pept        complement(150965..152125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0111"
FT                   /product="amidohydrolase-like protein"
FT                   /note="KEGG: cpf:CPF_2765 amidohydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32301"
FT                   /db_xref="GOA:A6LPM1"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM1"
FT                   /protein_id="ABR32301.1"
FT                   /translation="MKNKIISFLSTCADDIKNLCTYLYENPEKSYSEVNASNCICNLLN
FT                   KYKFEVDRNFLNINNSFIAKKGQGHPKICYLCEYDAIENEGHITGHNMITAMSVSATLA
FT                   LGSVIDDIGGSVILVGCPGEYFGGTKGTMVKQGLFDDIDVVMVAHPDTCTCESGSSSAI
FT                   IPLGLKFESESKLSFLNRNSYTSLDAVLLTLNILNSIKKGFPDNLEINSVISNGGYTTL
FT                   LLPADSEIKFCIRASNTKTANEAYDKIRKIAHNVTALIDIPNKFFLYESPNKELITNRT
FT                   LNRLFSHNLKESGIININPPKDIYAGLSIGDVSHKVPCIHPYISIIDDENIKYGSLDFA
FT                   KATTSEFALKQCNIAATALALTAIDLIQNETLLSEVKSEFFNNRNC"
FT   gene            152532..152714
FT                   /locus_tag="Cbei_0112"
FT   CDS_pept        152532..152714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32302"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM2"
FT                   /protein_id="ABR32302.1"
FT                   /translation="MEDTNKSCFLCGASDCDGIILNGEKICKACEEKIVNTNVEDPDYD
FT                   YYKDNVRIILFSEHA"
FT   gene            152764..153405
FT                   /locus_tag="Cbei_0113"
FT   CDS_pept        152764..153405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0113"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: cno:NT01CX_0761
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32303"
FT                   /db_xref="GOA:A6LPM3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPM3"
FT                   /protein_id="ABR32303.1"
FT                   /translation="MKKGLFIVFEGGEGTGKTTAIDAIYDWITENNFECIKTREPGGIK
FT                   ISEQIRQVILSKDNKEMDAKTEALLYAAARRQHLVEKVIPALNQGVIVLCDRFIDSSLA
FT                   YQGYARNLGIEEVLSINKFAIGEYMPDISVLFDLDPKIGLARIANNDCREVNRLDIEKL
FT                   EFHERVREGYDIVYKNNNHRIVKIDANNTKENVINQIKNILRPKIWTNIK"
FT   gene            153479..153811
FT                   /locus_tag="Cbei_0114"
FT   CDS_pept        153479..153811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0114"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   cac:CAC0299 protein from nitrogen regulatory protein P-II
FT                   (GlnB) family, ortholog YAAQ B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32304"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM4"
FT                   /protein_id="ABR32304.1"
FT                   /translation="MKLIIAIVQDEDSADVIEALTEEDYRVTKLATTGGFLKSGNTTLL
FT                   VGIEEEKVELVIDVIRNVCRKRNETVVTPTTLGGSESGYMQQYPVQISVGGATVFVIDV
FT                   DKFVKI"
FT   gene            153831..154763
FT                   /locus_tag="Cbei_0115"
FT   CDS_pept        153831..154763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0115"
FT                   /product="DNA polymerase III delta' subunit"
FT                   /note="KEGG: cpe:CPE2449 DNA polymerase III delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32305"
FT                   /db_xref="GOA:A6LPM5"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM5"
FT                   /protein_id="ABR32305.1"
FT                   /translation="MRKIIGHKNIIDNINNRRQKDSFSHANLIIGNDGIGKSIVAKYLS
FT                   NQIIKERNGVESVDIVRYSPNSNSFGVDDVRNIISEVNKKPYEGDKKVLILYKCDKLTV
FT                   QAQNALLKTIEEPPRGVHLILLSDSLEVILDTIKSRCQIYRLTPLNKEEILSYLEEKYN
FT                   NLSEDDKKAALAYSAGIPGNVDRFFSDDKLRNLRDICIELFEDIVSRQKGIILKYEELL
FT                   KSAKEDKLELLNILLSYIRDILLLKELNDSELVVNFDKIYKIKNISRGISYKKLNSMLE
FT                   YIKEARINFNSNTNYSMVISVLLMGFAEV"
FT   gene            154767..155672
FT                   /locus_tag="Cbei_0116"
FT   CDS_pept        154767..155672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0116"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: cpr:CPR_2443 PSP1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32306"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM6"
FT                   /protein_id="ABR32306.1"
FT                   /translation="MIKVIGVRFKKAGKIYYFSPLELDIKKGNYVIVETARGIEFGECV
FT                   IGIKEIKEEDIVSPLKNVIRIADEDDIRKHKENKDKEKEALDICLAKIQEHKLNMKLID
FT                   VEYTFDNHKVIFYFTADGRVDFRELVKDLATIFKTRIELRQIGVRDEAKMVGGLGPCGR
FT                   PMCCSTFLGDFASVSIKMAKEQNLSLNPTKISGICGRLMCCLNYEQTTYEGIRKRLPKV
FT                   GSIVKIEAGNGEVVGNSIVKEMVKVKVRRGDEEVVEEFKITDVELVSGKYEDTIDENNI
FT                   KLIVESEEDKTLIKNLINEK"
FT   gene            155684..155887
FT                   /locus_tag="Cbei_0117"
FT   CDS_pept        155684..155887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0117"
FT                   /product="metal-binding protein of ferredoxin fold"
FT                   /note="KEGG: cac:CAC0302 predicted metal-binding protein of
FT                   ferredoxin fold"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32307"
FT                   /db_xref="GOA:A6LPM7"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM7"
FT                   /protein_id="ABR32307.1"
FT                   /translation="MKSVIKICNMESNDDAKIIQDTVVKNSGVIATEISLAKREITVIY
FT                   NDIFLKLERIINSIEDLGYVVL"
FT   gene            156010..156180
FT                   /locus_tag="Cbei_0118"
FT   CDS_pept        156010..156180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0118"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: cpr:CPR_2442 ferredoxin (FdxA)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32308"
FT                   /db_xref="GOA:A6LPM8"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM8"
FT                   /protein_id="ABR32308.1"
FT                   /translation="MAFVINDSCVSCGACAGECPVSAITQGDTQFVIDADTCIDCGNCA
FT                   NVCPVGAPNQE"
FT   gene            complement(156237..156887)
FT                   /locus_tag="Cbei_0119"
FT   CDS_pept        complement(156237..156887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0119"
FT                   /product="Zn-dependent hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /note="KEGG: cac:CAC0482 Zn-dependent hydrolase of the
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32309"
FT                   /db_xref="GOA:A6LPM9"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPM9"
FT                   /protein_id="ABR32309.1"
FT                   /translation="MQIIWYGHSCFLMKTSIGKRILIDPFSNNLGYDNNFPKSDLITIS
FT                   HNHFDSSYINDINNTTKIINESGNFNLSFLNIEGFDSFHDKCNGLKRGSNIIYIFKDDK
FT                   LSICHLGHLGHIPCSLILEKLKNIDILLIPIGGHFTLDGFESAKLCNLISPKYIVPMHY
FT                   KTNTTSLYLDDPKNFIISMKSVKKINSNILDTSDLDINSNLKSECILLTPPYK"
FT   gene            157057..157512
FT                   /locus_tag="Cbei_0120"
FT   CDS_pept        157057..157512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0120"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: cpf:CPF_2754 transcriptional
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32310"
FT                   /db_xref="GOA:A6LPN0"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN0"
FT                   /protein_id="ABR32310.1"
FT                   /translation="MARLSDIIEEFIKQMFNENRDNVIFIQRNELADQFRCAPSQINYV
FT                   LTTRFTYERGYLIESKRGGGGHIAIKQLDDDNSNRREELINQSIGETITYHNANALLNH
FT                   LLESGVIEERECEIMKIAINDRSLTSADNKNKVRADILKAMIMIILS"
FT   gene            157527..158105
FT                   /locus_tag="Cbei_0121"
FT   CDS_pept        157527..158105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0121"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: cac:CAC3191
FT                   uncharacterized conserved protein, containing ClpE-like
FT                   Zn-zinger domain; YACH B.subtilis ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32311"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN1"
FT                   /protein_id="ABR32311.1"
FT                   /translation="MLCEKCKKNEAKINLITVMNGQKQEIWLCENCAKDIANIPFFNPI
FT                   MQNINVPFQGILTEILSNVDNGKSNIDNNKVKEIICPNCGLTYQEFKKSGRLGCTDCYK
FT                   EFNIVLEPRIKSLQVGSKHIGKIPKVKGKELVQRKNLKDLKEEMQKLIVAEEYERAAIV
FT                   RDEIKKLELYILESNTKEIINRKEGNCDE"
FT   gene            158098..159111
FT                   /locus_tag="Cbei_0122"
FT   CDS_pept        158098..159111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0122"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   cac:CAC3190 arginine kinase related enzyme, YACI B.subtilis
FT                   ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32312"
FT                   /db_xref="GOA:A6LPN2"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN2"
FT                   /protein_id="ABR32312.1"
FT                   /translation="MNSWEDDKERFGAVLSSKVLLARNFSNLPFPNKLNYIKGRENGKE
FT                   VYNVLKNELDNEEITLYEIWNTKEEFSKQYLERDLISKELLKNSDKGSFILNKEEDLSI
FT                   MINEKDHINLQCVSDGLKLEEIFERATVIDDKIEENFDYAFDETLGYLTASPENIGTGM
FT                   KASVVLHLPALSMSEEINNISKRLGKLGIAIKGVHLDGTKVFGNLYRISNKVSLGLTEE
FT                   NIINKLKEAVWSIIIEENKFREILLSKCRHELEDKIYRAYGILKYAMILDFKESIELLS
FT                   NVRLGAELSIINIDKGKLDKLFILITNSSLQNYLKKSLDDKEIKYERAKLVKEMLT"
FT   gene            159137..161611
FT                   /locus_tag="Cbei_0123"
FT   CDS_pept        159137..161611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0123"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
FT                   protein; Clp N terminal domain protein; ATPase associated
FT                   with various cellular activities, AAA_5; ATPase AAA-2
FT                   domain protein; SMART: AAA ATPase; KEGG: ctc:CTC02633
FT                   negative regulator of genetic competence mecB/clpC"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32313"
FT                   /db_xref="GOA:A6LPN3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN3"
FT                   /protein_id="ABR32313.1"
FT                   /translation="MEYNKLTERAQAVILEAENESEKFKHGYVGTEHILLGILKEDGYS
FT                   AKLLKKYGVNIENIRNMIQRYLGYGDIKKTDDNILLTPRTKRLIDESFAAAKRLNHKYV
FT                   SPEHILLALLNQEEGMAYTILKSLNLNFTIISEELLVFLSGTYEDKASDKNIIDNKKAN
FT                   TPMLDKYGRDLTVLSKEQGLDPVIGRDNETQRLLEILCRRIKNNPCLIGEPGVGKTAVV
FT                   EGLAQRIVEGNIPEILRNKRVVSLDLTSMIAGAKYRGEFEERLKKTMDEIIKDKDIIIF
FT                   IDEIHTIIGAGGAEGAIDASNILKPALARGEIQCIGATTIDEYRKYIEKDSALERRFQP
FT                   VTVGEPSKEETLKILKGLRDKYEAHHRVEITDEALEAAVNLADRYITDRFMPDKAIDLI
FT                   DEGAAKVRIQSLTAPPDLKDLEEKIENIGKEKEEAIRVQDFERAANLRDKERILKEQLG
FT                   NMKDSWDTQNSIKTLVVDAEKIASVVSSWTKIPIQKLTESESERLLKLEEILHKRVVGQ
FT                   NEAVKSIARAVRRARVGIKDPNRPIGSFIFLGPTGVGKTELSKALAEAMFGDENNIIRI
FT                   DMSEYMEGHSVSRLIGSPPGYVGHEEGGQLTEAVRRKPYSIVLLDEIEKANPEVFNILL
FT                   QIMEDGRLTDGKGKIVNFKNTIIIMTSNVGAHQIKKQKSIGFSSVSSKNENETEYEKMK
FT                   ENILGELKQKFRPEFLNRIDDTIVFHKLSDEDLNQIIDLMLASIRKRLEDRDIYLNFED
FT                   NSKRFLLNKGIDLDYGARPLRRLIIKEVEDKLSEEILQGNIRIGDRVKVSELENKLIFK
FT                   RLAESNLELNKN"
FT   gene            161742..162677
FT                   /locus_tag="Cbei_0124"
FT   CDS_pept        161742..162677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0124"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   glucose-inhibited division protein A; HI0933 family
FT                   protein; KEGG: cpr:CPR_2436 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32314"
FT                   /db_xref="GOA:A6LPN4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN4"
FT                   /protein_id="ABR32314.1"
FT                   /translation="MSKEKKELDLIIIGGGPAGLTAAMYAGRAKLDTLLLENELVGGQV
FT                   RNSYTIENYPGFKSIGGGDLADIFQEQARDLGANIDEFDSIEKIYISDDEKIIETESYV
FT                   YQPKAVIIATGAAPRKLPIPQEEQFSGRGIHYCAICDGALYQGKKVAVVGGGNSALEES
FT                   IFLTRFAEKVYLIRRYDYFKGEQSLIDEVFNNPKIEVLLNKDLIQANGKEFLESVIIKD
FT                   TKTQESSSLDVNAVFGYIGTEPRTKEVKDYIKLNEQGYIITDEDLQTNIQGVYAAGDVR
FT                   QKKYRQITTAVSDGTIALLNAEKYILRKRK"
FT   gene            complement(162753..162980)
FT                   /locus_tag="Cbei_0125"
FT   CDS_pept        complement(162753..162980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0125"
FT                   /product="glutaredoxin-like protein, YruB-family"
FT                   /note="TIGRFAM: glutaredoxin-like protein, YruB-family;
FT                   PFAM: glutaredoxin; KEGG: cpr:CPR_2433 glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32315"
FT                   /db_xref="GOA:A6LPN5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN5"
FT                   /protein_id="ABR32315.1"
FT                   /translation="MVKVYTTNTCPWCVKAKTFLKSENIEFQELNVQDDMEAREEMIKK
FT                   SNQMGVPVLDINDNIIIGFDKPAILKALGK"
FT   gene            163466..164842
FT                   /locus_tag="Cbei_0126"
FT   CDS_pept        163466..164842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0126"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: efa:EF0040 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32316"
FT                   /db_xref="GOA:A6LPN6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN6"
FT                   /protein_id="ABR32316.1"
FT                   /translation="MKKKTLYRCNSCGFESIKWLGKCPTCNNWNTLEEITIEAKNLETR
FT                   SRQVAKKPLKKLLDIVSNKSDRIVTGINEFDRVMGGGIVKDSISIITARPGAGKSTLLL
FT                   EISDAVAQKGYKVIYASGEESDSQIKNRADRILNKIHEDIWVLQETSLDNVLDAVEEID
FT                   PDIIIIDSIQTFTMESSLPARAGSPTQTMECANALLQMAKNDRRPRAVIIVGQMTKSDE
FT                   LAGLRALEHLVDTVLIIEDDSDEELRVLVSSKNRFGGIENGFFQMGERGIISIDNPSEF
FT                   FMTKREEGEIVSGSALTVIKEGTRAIITEIESLVSKSFTPYPTRIGETLGKDKLNTLIS
FT                   ILEQRGGINLYDKNVIIKTTGGIKIREQGINLAVIMSIVSSVKQQGIESNIAFIADVGL
FT                   TGELKKVPSLESRIRELERMGFKKVYVPKDSIGKSSNLKKIDIIELKTLMDVINNIYRS
FT                   "
FT   gene            165081..166145
FT                   /locus_tag="Cbei_0127"
FT   CDS_pept        165081..166145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0127"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: cno:NT01CX_1089 domain of unknown
FT                   function DUF147 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32317"
FT                   /db_xref="GOA:A6LPN7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPN7"
FT                   /protein_id="ABR32317.1"
FT                   /translation="MRIEKGIGIKNVLKIMCPGTQLREGLENILRAKTGGLLVIGDDEE
FT                   VMKLVDGGFYINSEYTPSYAYELAKMDGAIVITGDLKKIVCANAQLIPDSSIPTYETGT
FT                   RHRTAHRVAKQTNNIVIAISQRRNIITMYKGDIKYVLRESSVILGKANQALQTLEKYVA
FT                   VLERVINNLNLLEFQDLTTLFDVVTAIQRTEMVMRIVEEINMYILELGNEGRLISMQLN
FT                   ELVKHIERDGILLIRDYCKDGLQYNEVYEHIQKLNSSELLELDAVARTLGRGGIPLMDT
FT                   LISPKGYRMLSKVPRIPSNVIDNLIKEFEELSNIIDADINDLDNVEGIGEARATAIKDG
FT                   LKRIKEQVSLKKEI"
FT   gene            166388..167488
FT                   /locus_tag="Cbei_0128"
FT   CDS_pept        166388..167488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0128"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein, PINc; KEGG: cpr:CPR_2427 PIN/TRAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32318"
FT                   /db_xref="GOA:A6LPN8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPN8"
FT                   /protein_id="ABR32318.1"
FT                   /translation="MLKRLLRGIFSVIGLILGYFISEILLTIPQVDNLTYISTTITRVL
FT                   FIIIISFIFGLIFYIISPIIYKGISNLIEYIEKSMQKMSITEIIYGTFGAVIALILMTF
FT                   IAKPINDINIIGPILLILLNVLAAIIGAEIMIKKKEDITALLVNMKKPVIKEKKVKEVI
FT                   KESIKGIPKVLDTSVIIDGRIFDICETGFVEGPLVIPNFVLDELRHISDSSDSLKRNRG
FT                   RRGLDILNKIQKELAIETQIVEDDFPKIAEVDAKLLKLAQKMEGKVITNDYNLNKVAEF
FT                   QGVPVLNINELSNAIKPVVLPGEEMTIDIVKDGKESSQGVAYLEDGTMIVVEGGRKYIG
FT                   QTTSVIVTSVLQTAAGRMIFAKPKDN"
FT   gene            167510..168190
FT                   /locus_tag="Cbei_0129"
FT   CDS_pept        167510..168190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0129"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   Nucleotidyl transferase; KEGG: cpr:CPR_2426
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32319"
FT                   /db_xref="GOA:A6LPN9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPN9"
FT                   /protein_id="ABR32319.1"
FT                   /translation="MVSAIVLAGGRGKRMGNIQSKQYIDLNGAPILYYTLKQFIENDLI
FT                   DKIILVVPEDEKDYCKREVLNKYGLKIDDLVSGGNERQESVYNALEKLEKSDIVLIHDG
FT                   ARPFVSQKIINYAVEYAKRYKAAAPGVMPKDTIKIKDSNNFSVDTLVRSELVAIQTPQA
FT                   FDFNLIYECHKEIKKRCISVTDDTSVVELLGHKVYIYEGDYKNIKITTPEDLILAEYFV
FT                   KNIV"
FT   gene            168583..170295
FT                   /locus_tag="Cbei_0130"
FT   CDS_pept        168583..170295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0130"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; YbaK/prolyl-tRNA synthetase associated
FT                   region; KEGG: cpf:CPF_2738 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32320"
FT                   /db_xref="GOA:A6LPP0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPP0"
FT                   /protein_id="ABR32320.1"
FT                   /translation="MKMSNMLISTLREVPAEAEIDSHKLMLRAGMIRKMAAGVYNYMPL
FT                   GLKVLKKVEDIIREEMNAAGAQEFLASAIIPAELWQESGRWDAYGAEMFRLKDRGDRDF
FT                   CLGPTHEEVFTDIARNEIKSYKQLPLNLYQIQTKYRDERRPRFGVMRSREFVMKDAYSF
FT                   DKDQGGLDLAYDKMHDAYVKIFNRCGLDAKCVAADSGAIGGSNSAEFMVKSEVGEDDVV
FT                   FCSECNYAANIEKASSPAEKELKQEFKEINKVETPNTKTIDELVKFFGTNEKKFAKTIL
FT                   FNADGKIVAVMVRGDREINEVKVSNAIGEVINLELASSEDVKKATGAEIGFAGPIGIKV
FT                   DMLLVDEEVANMYNFIVGANETGYHINNVNYGRDFEGVIGDYRNVTEGEKCPVCGGKVT
FT                   IARGTEVGHIFKLGTKYSEAMNAKFIDEDGKEKPFIMGCYGIGVTRTMASIIEQHHDEN
FT                   GIVWPLSVAPYHVSVIPVNVKDEEQARIANEIYEKLTSAGIEALLDDRNERAGVKFKDS
FT                   ELMGIPMRITVGKKINDGEIEFKLRDGEMEVIKIEDVYNIIKGEFEKNKIKLK"
FT   gene            170313..171713
FT                   /locus_tag="Cbei_0131"
FT   CDS_pept        170313..171713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0131"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase, class Ia, DALR; tRNA synthetase
FT                   class I (M); Cysteinyl-tRNA synthetase, class Ia-like;
FT                   KEGG: cpr:CPR_2424 cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32321"
FT                   /db_xref="GOA:A6LPP1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPP1"
FT                   /protein_id="ABR32321.1"
FT                   /translation="MRVFNTLTRQKEEFIPIITGEVKMYVCGPTVYNFFHIGNGRTFIV
FT                   FDTIRRYLEYRGYKVRFVQNFTDIDDKMINKANDEGITVKELGDKYIKEYYQDADSLKI
FT                   ERATVNPRATEYIHDIIKFVEELIEAGFAYEVDGDVYYSTKKFDNYGRLVGQNLDDLQV
FT                   GARISVDERKKDPMDFAVWKAQKPGEPAWESPWGPGRPGWHIECSCMAKKLLGDTIDIH
FT                   AGGMDLRFPHHENEIAQSEALTGKTFANYWLHAAFVNVDNKKMSKSLNNFFTAREVLEE
FT                   YSSDAIRFLMLSGHYRIQINFTKELLDSAKSSIERLYNCINNLENLKDEVTKKLMDEAE
FT                   EKYLKSLDKYREKFIEKMDDDFNTADAISVLFDLTKDINNNVNINSSSELCEKAESMVR
FT                   ELGNPLGILQDRIEKDLETEIQELIEKRQQARKNKDFALADKIRDDLKSRNIILEDTPQ
FT                   GVRWKKID"
FT   gene            171763..172176
FT                   /locus_tag="Cbei_0132"
FT   CDS_pept        171763..172176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0132"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; KEGG: cpe:CPE2426
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32322"
FT                   /db_xref="GOA:A6LPP2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPP2"
FT                   /protein_id="ABR32322.1"
FT                   /translation="MLDDLRIRKFSKDEARMLNSLQLALIGDGVFEVFIRNYILTQNTA
FT                   LSANKIHVKAIGYVKAKSQACIMHEIENLLNEEEEAVYKRGRNAKSPTVPKNAEIRDYR
FT                   MATGFEALIGYLYLVGDKERLEFIFDRSIEIIN"
FT   gene            172207..173109
FT                   /locus_tag="Cbei_0133"
FT   CDS_pept        172207..173109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0133"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding; KEGG: cpr:CPR_2420
FT                   RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32323"
FT                   /db_xref="GOA:A6LPP3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPP3"
FT                   /protein_id="ABR32323.1"
FT                   /translation="MNSKLKRNISSGKFMEDKDKSVTESKGKAKSYNQVKNKNKKDNMV
FT                   GNDKSTSAIEEREDIVIGRNAVIEALRGERTIEALYISNSKLEGSIKTIVGLAKENKIL
FT                   IKEVDKRKLDSMCGGEVHQGVIAKVTPYKYSEVSDILDLAEKRGEAPFIVILDEVEDPH
FT                   NLGSIVRTAELFGVHGIILPKRRSASVSTTVYKSSVGAIEHVKIAKVTNLNSTIEELKE
FT                   KGIWIYGADIRAEEYSYQVDFGGPCAVIIGNEGRGISKLTVEKCDKLIKIPMVGKINSL
FT                   NASVAGGIIMYEVLKGRLK"
FT   gene            173123..173635
FT                   /locus_tag="Cbei_0134"
FT   CDS_pept        173123..173635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0134"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   cpr:CPR_2419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32324"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPP4"
FT                   /protein_id="ABR32324.1"
FT                   /translation="MKTIFVDGYNVINSWPNLKQKKDSSFEGARQTLIDTLHNYGVFNA
FT                   CRIILVFDAHKVTGSIEKKEEVNRNISVVFTKDGETADSYIEKQVNALGRKHEIVVVTS
FT                   DSLEQQTIFQRGAVRMSSLEFYNEVLRIEKSIKNKADKNRISQKNIISDNIDDRIVKIL
FT                   EEIRRSK"
FT   gene            173671..174342
FT                   /locus_tag="Cbei_0135"
FT   CDS_pept        173671..174342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0135"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H type; RNA polymerase
FT                   sigma-70; PFAM: sigma-70 region 2 domain protein; Sigma-70,
FT                   region 4 type 2; KEGG: cpf:CPF_2732 RNA polymerase sigma-H
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32325"
FT                   /db_xref="GOA:A6LPP5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPP5"
FT                   /protein_id="ABR32325.1"
FT                   /translation="MSKRVVSLMQKRVENKQLKGFLDFKDKSDEEIVAKAKSGNSRAQE
FT                   YLISKYENFVKSKAKSYFLIGADKEDIYQEGMIGLYKAIRDFNAEKSTSFKAFAEICVI
FT                   RQIITAIKTATRQKHIPLNTYVSLNKPIYEEESERTLLDVLAGLKISDPEELMISKEQM
FT                   DYIEKKISKVLSDLELEVLTSYLDGKSYQEIASDLERHSKSIDNALQRVKRKLEKCLDL
FT                   K"
FT   gene            174419..174494
FT                   /locus_tag="Cbei_R0031"
FT                   /note="tRNA-Thr1"
FT   tRNA            174419..174494
FT                   /locus_tag="Cbei_R0031"
FT                   /product="tRNA-Thr"
FT   gene            174560..175753
FT                   /locus_tag="Cbei_0136"
FT   CDS_pept        174560..175753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0136"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="2.7.7.4"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   cpr:CPR_2416 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32326"
FT                   /db_xref="GOA:A6LPP6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPP6"
FT                   /protein_id="ABR32326.1"
FT                   /translation="MAKAKYERSKPHVNIGTIGHVDHGKTTLTAAITTVLANKGFAEAF
FT                   NYADIDKAPEEKERGITINTAHVEYQTENRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLGSRVGIQYIVVFLNKADMVDDPELLELVEMEVRELLSEYDF
FT                   PGDDIPVITGSALKALENPTDEEAIKPIMDLMEAVDSYIPTPERATDKPFLMPIEDVFT
FT                   ITGRGTVATGRVEAGVLHVGDEVEIVGLTEEKKKVVVTGIEMFRKLLDEAQAGDNIGAL
FT                   LRGVQRTDIERGQVLSKPNSVHPHTKFVGQVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGSIKLPDGMEMVMPGDHIDMNVELITPIAMDEGLRFAIREGGRTVGSGVVTKIVE"
FT   gene            175931..176080
FT                   /locus_tag="Cbei_0137"
FT   CDS_pept        175931..176080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0137"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: cpf:CPF_2729
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32327"
FT                   /db_xref="GOA:A6LPP7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPP7"
FT                   /protein_id="ABR32327.1"
FT                   /translation="MRTKVTLACTECKQRNYDSMKNKKNDPDRLEMKKYCKFCKKHTLH
FT                   RETK"
FT   gene            176129..176359
FT                   /locus_tag="Cbei_0138"
FT   CDS_pept        176129..176359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0138"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: cpf:CPF_2728
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32328"
FT                   /db_xref="GOA:A6LPP8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPP8"
FT                   /protein_id="ABR32328.1"
FT                   /translation="MSAKNSVKTEKTIKSNGLFGFFREVKVEVKKITWPSKDETKKAFV
FT                   AVIVFTLMYTILVGGLDSIFNNLFKMILNFK"
FT   gene            176373..176918
FT                   /locus_tag="Cbei_0139"
FT   CDS_pept        176373..176918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0139"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein; KEGG:
FT                   cpr:CPR_2413 transcription termination/antitermination
FT                   factor NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32329"
FT                   /db_xref="GOA:A6LPP9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPP9"
FT                   /protein_id="ABR32329.1"
FT                   /translation="MILYRLTNMSDRARWYVVHTYSGYENKVKANLEKAIENRNLEALI
FT                   HDIQVPMEEVVEEKDGKQKVSLKKKFPGYVLVKMLMGDEAWYVVRNTRGVTGFVGPGSK
FT                   PVPLSDEEVESMGVLEVPVEIDLEVGESIRIISGPLRDSVATIQEIIPDKRKVKALVEM
FT                   FGRETLAELDFNQVEKLV"
FT   gene            176997..177422
FT                   /locus_tag="Cbei_0140"
FT   CDS_pept        176997..177422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0140"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: ctc:CTC02612 LSU
FT                   ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32330"
FT                   /db_xref="GOA:A6LPQ0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ0"
FT                   /protein_id="ABR32330.1"
FT                   /translation="MAKKVTGMIKLQLQAGKATPAPPVGPALGQHGVNIMGFCKEFNAK
FT                   TANQAGYIIPVVITVYQDRSFSFILKTPPAAVLIKKEIGLESGSGVPNKTKVGKLTQDQ
FT                   LKKIAETKMPDLNAASLESAMRMIAGTARSMGVTIEE"
FT   gene            177477..178166
FT                   /locus_tag="Cbei_0141"
FT   CDS_pept        177477..178166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0141"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: cpr:CPR_2411
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32331"
FT                   /db_xref="GOA:A6LPQ1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ1"
FT                   /protein_id="ABR32331.1"
FT                   /translation="MGKKYIESAKLIDKSALYNPVEALDLTLKTAKANFDETIELHVRL
FT                   GVDPRHADQQVRGAVVLPNGTGKTVRVLVFAKGDKAAEAQQAGADFVGADELVQKIQSE
FT                   NWFDYDVVVATPDMMGIVGRIGRVLGPKGLMPNPKSGTVTFDVAKAIEEIKAGKVEYRV
FT                   DKTAIVHCPIGKKSFGTEKLKENFTALMEALVKAKPAAAKGQYLKSVSVSSTMGPSAKV
FT                   NPTRALD"
FT   gene            178369..178872
FT                   /locus_tag="Cbei_0142"
FT   CDS_pept        178369..178872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0142"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: cpr:CPR_2410 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32332"
FT                   /db_xref="GOA:A6LPQ2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPQ2"
FT                   /protein_id="ABR32332.1"
FT                   /translation="MNKNRELKEAKVAEIKEKLEKSKAVVLSKYQGLNVEEDTALRKSL
FT                   REAGVEYKVYKNTLVTLAAKELGLDGIAEYLEGAVSIAFSYEDVTLAARLLNDFAKDHK
FT                   KLELKAGIIEGEIYDEAKIKQLATIPSKEVLIAKLLGSIKSPISSFARVLSAIADSKGT
FT                   ESAE"
FT   gene            178924..179289
FT                   /locus_tag="Cbei_0143"
FT   CDS_pept        178924..179289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0143"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like; KEGG: cpr:CPR_2409 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32333"
FT                   /db_xref="GOA:A6LPQ3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ3"
FT                   /protein_id="ABR32333.1"
FT                   /translation="MTREEIIQAIKEMSVLDLNELVKACEEEFGVSAAAAVVAGGAVAG
FT                   GAAAEEKTEFDVVLASAGDNKIKVIKVVREITGLGLKEAKEIVDGAPKTLKEGVSKDEA
FT                   EDMKAKLAEVGATAEVK"
FT   gene            179620..183330
FT                   /locus_tag="Cbei_0144"
FT   CDS_pept        179620..183330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0144"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase Rpb2,
FT                   domain 7; RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3; KEGG:
FT                   cpr:CPR_2408 DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32334"
FT                   /db_xref="GOA:A6LPQ4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ4"
FT                   /protein_id="ABR32334.1"
FT                   /translation="MVHPVQVGKRTRMSFGKVNDVTEMPNLIEVQLDSYEWFLREGLHE
FT                   VFDDINPITNFTGNLVLEFVDYKLDMENIKYSVEECKERDATYAAPLKVSIRLQNNETG
FT                   EIKEQEVFMGDFPLMTEQGTFVINGAERVIVSQLVRSPGVYYNYSIDKSGKKLYSSTVI
FT                   PNRGAWLEYETDSNDVIYVRIDKTRKLSISILARAMGLGSDQELLDFFGEEERFRASIE
FT                   KDNTKTKEEALLEIYKRLRPGEPPTVDSAISLIDTLFFDAKRYDLSRVGRYKFNKKLAL
FT                   NLRIANQVAATDIVNPQTGEIMVEKGQKISRLVAEEIQNAGVKSVDVLIEDKVIRVISN
FT                   NFVDLKKQVSFDISDLGIKELVHYPTLKEILDNFSDEASIKEEIKKNISKLIPKHIIRD
FT                   DIFATISYELGLTYGIGYVDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMTIQ
FT                   DQEAITPQMLINIRPVAAAIKEFFGSSQLSQFMDQTNPLSELTHKRRLSALGPGGLSRE
FT                   RAGFEVRDVHHSHYGRMCPIETPEGPNIGLINSLATFAKVNEYGFIETPYRIVDKENGR
FT                   ATDEIRYFTADEEDQCLIAEAKEPMDENGHFINKKVRVRHLEDILVVPTTDVDLIDVSA
FT                   RQIVSVATAMIPFLENDDASRALMGSNMQRQAVPLLSPQAPIVGTGIEFKAAVDSGVLP
FT                   KAKNAGVVTYVSGSEIRVKRDSDGGTDVYKLLKFKRSNSGTCINQRPIVDTGEIVYKNQ
FT                   VIADGPSTDLGEIALGKNIRMGFITWEGYNYEDAMLISEELVREDVFTSMHIEEYECEA
FT                   RDTKLGPEEITRDIPNVSDDALKDVDDRGIIRIGAEVRSGDILVGKVTPKGETELTAEE
FT                   RLLRAIFGEKAREVRDTSLRVPHGEAGIIVDIKVFTRENGDELNPGVNELVRCYIAQKR
FT                   KISVGDKMAGRHGNKGVISRILPEEDMPFLPDGRPLQICLNPLGVPSRMNIGQVLEVHL
FT                   GWAASHLGWHIATPVFDGATQPEITECMIKAGFREDAKTILYDGRTGEPFDNPVTVGIM
FT                   YILKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQE
FT                   ILTVKSDDVVGRVKTYEAIVKGENIPEPGVPESFKVLIKELQALCLDIKVLNDEHEEVT
FT                   LKEFVDEDMANLEVNIEGTEEIMVPEPDVLDDDSYDQNNDEDIDEIDYDESVDIADLET
FT                   ELELDDFNDEH"
FT   gene            183352..186888
FT                   /locus_tag="Cbei_0145"
FT   CDS_pept        183352..186888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0145"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase, alpha subunit; RNA polymerase Rpb1,
FT                   domain 3; RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 5; RNA polymerase Rpb1, domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein; KEGG: cpr:CPR_2407
FT                   DNA-directed RNA polymerase, beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32335"
FT                   /db_xref="GOA:A6LPQ5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ5"
FT                   /protein_id="ABR32335.1"
FT                   /translation="MFELNNFDAIQIGLASPEQIRQWSRGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPMKDWECHCGKYKRVRYKGIVCDRCGVEVTKAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLILDMSPRALEKVLYFASYIVIDPKETPLLKKQLLNEKEYREAVDKYG
FT                   DESFVAGMGAEAIQDLLNEIDLVTSSKELKEELKQSSGQKKVRIIRRLEVVESFRKSGN
FT                   DPQWMVINVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKKLLDLGAPDII
FT                   VRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYS
FT                   GRSVIVVGPELKMYQCGLPKEMAIELFKPFVMKKLVQDGIAHNIKSAKRMVERVLPQVW
FT                   DVLEEVIADHPVLLNRAPTLHRLGIQAFQPVLVEGRAIKLHPLACTAYNADFDGDQMAV
FT                   HLPLSVEAQAEARFLMLAATNILKPSDGKPVCVPTQDMILGSYYLTMDKNGAKGDGMTF
FT                   SSKDEAIMAYEVKEIDIHAQINVRMFREVDGELKSKIIKTTVGKIIFNESIPQNLGLVN
FT                   RENEEESFNLEVDFLATKKSLGKIIDQCYMKHGPVKTSIMLDNIKALGYHYSSIGAVTV
FT                   ASSDIIVPKVKYDLLKEADETIEKIEKMYKRGFISDEERYERVIEKWTQTTEDVANALM
FT                   DSLDKFNPIYMMADSGARGSKSQIKQLAGMRGLMASPSGKIIELPIRASFKEGLDVIEY
FT                   FLSTHGARKGNADTALKTADSGYLTRRLVDVSQDVIVREEDCGTDEGIFVSEIKEGNEV
FT                   IEELRERLIGRYTAEDIVDPETGDVLHPKNEYMDPYAADKIVSAGIKKVKIRSVFTCKC
FT                   KVGVCARCYGMNMATAKKIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGADITQGL
FT                   PRVEELFEARKPKGLAIVSEIAGTARIEETKKKRTVIVMGADGEERSYDIPFGSRLRVN
FT                   ESDYVEAGDEITEGSVNPHDIMSIKGIDGARRYLLSEVQKVYRLQGVDINDKHLEVVVR
FT                   QMTRKIKIVDSGDTDLLPGTMIDMFDFYEENARVREFGGEEAKGEQTLLGITKAALATD
FT                   SFLSAASFQETTRVLTEAAIKGKVDPLVGLKENVIIGKLIPAGTGMMRYRSLKVETDSE
FT                   LVEETIGETVEE"
FT   gene            187145..187522
FT                   /locus_tag="Cbei_0146"
FT   CDS_pept        187145..187522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0146"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: cpr:CPR_2405 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32336"
FT                   /db_xref="GOA:A6LPQ6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ6"
FT                   /protein_id="ABR32336.1"
FT                   /translation="MPTISQLVRKGRKTAVVKSTAPALKECPQKRGVCTVVKTTTPKKP
FT                   NSALRKIARVRLTNGFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDC
FT                   AGVANRLQGRSKYGAKRPKKK"
FT   gene            187672..188142
FT                   /locus_tag="Cbei_0147"
FT   CDS_pept        187672..188142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0147"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: cpr:CPR_2404
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32337"
FT                   /db_xref="GOA:A6LPQ7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ7"
FT                   /protein_id="ABR32337.1"
FT                   /translation="MPRKGHIAKRDVLPDPVYNSKVVTKFINSIMEDGKKGVAQKICYE
FT                   AFGLIAKRSGKEALEVFEEAMNNVMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWM
FT                   LIAARKRGEKLMSERVAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY"
FT   gene            188226..190292
FT                   /locus_tag="Cbei_0148"
FT   CDS_pept        188226..190292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0148"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: cpf:CPF_2717 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32338"
FT                   /db_xref="GOA:A6LPQ8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPQ8"
FT                   /protein_id="ABR32338.1"
FT                   /translation="MARKYPLDKFRNFGIMAHIDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GEATMDWMVQEQERGITITSAATSCFWKEHELNIIDTPGHVDFTVEVERSLRVLDGAVT
FT                   VLDAKSGVEPQTETVWRQADKYGVPRMIYVNKMDATGADFFRCIQTVKDRLKANAVPIQ
FT                   IPVGSEQGFKGMVDLIKNVAFIFYDDLGKDMREEAIPAEYADQAEEYRAAMIEAIAETD
FT                   EELMEKYLEGEELTIEELKAALRKATIANEIYPCICGSSYKNKGVQEMIDGVVDYLPSP
FT                   LDVPAIKGTTLDGEEDHRNSSDSEPLSALAFKIATDPFVGKLAFTRIYSGVMQSGSYVL
FT                   NSTKGKKERIGRLVKMHSNSRSEVESLEAGEIGAVIGLKNTTTGDTLCAENSPIILEAM
FT                   EFPEPVIRVAIEPKTKDAQEKMGMALAKLAEEDPTFKTWTDTETGQTIIAGMGELHLEI
FT                   IVDRLQREFKVECNVGAPQVAYKETIRSAVKAEAKYAKQSGGKGQYGHAVIEMEPTEGE
FT                   YVFENAVVGGAIPKEYIPAIDAGIQEASKNGIIAGYNVINFKVKLVHGSYHEVDSSEMA
FT                   FKIAGSMAFKNAMSKASPVLLEPMMKVEVTVPEEYMGDVIGDINSRRGIMEGMEALNGA
FT                   QVIRAFVPLSEMFGYATTLRSRTQGRGVYSMVFDHYDEVPKNIQEQIAGSRAK"
FT   gene            190480..191673
FT                   /locus_tag="Cbei_0149"
FT   CDS_pept        190480..191673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0149"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="2.7.7.4"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   cpr:CPR_2416 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32339"
FT                   /db_xref="GOA:A6LPP6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPP6"
FT                   /protein_id="ABR32339.1"
FT                   /translation="MAKAKYERSKPHVNIGTIGHVDHGKTTLTAAITTVLANKGFAEAF
FT                   NYADIDKAPEEKERGITINTAHVEYQTENRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLGSRVGIQYIVVFLNKADMVDDPELLELVEMEVRELLSEYDF
FT                   PGDDIPVITGSALKALENPTDEEAIKPIMDLMEAVDSYIPTPERATDKPFLMPIEDVFT
FT                   ITGRGTVATGRVEAGVLHVGDEVEIVGLTEEKKKVVVTGIEMFRKLLDEAQAGDNIGAL
FT                   LRGVQRTDIERGQVLSKPNSVHPHTKFVGQVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGSIKLPDGMEMVMPGDHIDMNVELITPIAMDEGLRFAIREGGRTVGSGVVTKIVE"
FT   gene            192128..192436
FT                   /locus_tag="Cbei_0150"
FT   CDS_pept        192128..192436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0150"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: cpr:CPR_2400
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32340"
FT                   /db_xref="GOA:A6LPR0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR0"
FT                   /protein_id="ABR32340.1"
FT                   /translation="MSKQKIRIRLKAFDHTILDQSAEKIVETAKTSGAKVVGPVPLPTE
FT                   KDVVTILRAVHKYKDSREQFEIRTHKRLIDIVNPSPKTVDALMRLNLPAGVDIEIKL"
FT   gene            192509..193138
FT                   /locus_tag="Cbei_0151"
FT   CDS_pept        192509..193138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0151"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: cpf:CPF_2714
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32341"
FT                   /db_xref="GOA:A6LPR1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR1"
FT                   /protein_id="ABR32341.1"
FT                   /translation="MKKAIIGRKVGMTQIFDEKGKVIPVTVVEAGPCVVVQKKTLENDG
FT                   YEAIQVGFDEIREKLANKPRKGHFAKAGATLRRTLKEFRLDDISQYEVGNEIKADVFGA
FT                   GDKVDVSAVSKGKGFQGSIKRWNQQRGPMTHGSKFHRAPGSMGASSDPSRTFKNKRMPG
FT                   HMGSVNTTVLNLEVVKVIAEKNLILIKGGIPGPNKGTVVIKDTVRA"
FT   gene            193165..193785
FT                   /locus_tag="Cbei_0152"
FT   CDS_pept        193165..193785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0152"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: cpr:CPR_2398
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32342"
FT                   /db_xref="GOA:A6LPR2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR2"
FT                   /protein_id="ABR32342.1"
FT                   /translation="MPTVGVFNKEGNKVADMELNENVFAAEINEYALHQVVVALLANKR
FT                   QGTQSTKTRSEVRGGGIKPWRQKGTGRARQGSIRSPQWIKGGIVFAPKPRDYRVSVPKS
FT                   MRKVAMKSALTSKVQDNQMIVLDSLNFEAPKTKSMIEMLKALEANKALIITAESNEVVY
FT                   KSARNIQGISVIPANNINVYDLLKYEKLIITKDAVSKIEEVYA"
FT   gene            193785..194081
FT                   /locus_tag="Cbei_0153"
FT   CDS_pept        193785..194081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0153"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: cac:CAC3131
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32343"
FT                   /db_xref="GOA:A6LPR3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR3"
FT                   /protein_id="ABR32343.1"
FT                   /translation="MKLTSHDIIRKPIITEKSMASMAEKRYTFIVHVDANKSQIKRAVE
FT                   EVFNVKVESVNTINGLGKTKRMGVHVGKRSDYKKAIVTLTEESNGIEFFEGMQ"
FT   gene            194146..194979
FT                   /locus_tag="Cbei_0154"
FT   CDS_pept        194146..194979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0154"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: cpr:CPR_2396
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32344"
FT                   /db_xref="GOA:A6LPR4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR4"
FT                   /protein_id="ABR32344.1"
FT                   /translation="MAVKKFNPITPARRQMTMPTFEEITSQEPEKSLLVALKSKAGRNA
FT                   QGKITVRHRGGGVKRKYRIIDFKRNKDEIPAKVATIEYDPNRSAYIALAIYSDGEKRYI
FT                   LAPAGLKVGDVIESGVNADIKPGNALPLKNIPVGTVIHNIELQRGKGGQLVRAAGGSAQ
FT                   LMAKEGDYATLRLPSGEMRYVRIECRATIGTLSNATNDIVNIGKAGRKRHMGWRPTVRG
FT                   SVMNPNDHPHGGGEGKSPVGRPSPVTPWGKPALGYKTRKTKKYSDKFIIKDRRAK"
FT   gene            195045..195317
FT                   /locus_tag="Cbei_0155"
FT   CDS_pept        195045..195317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0155"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: cpr:CPR_2395 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32345"
FT                   /db_xref="GOA:A6LPR5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR5"
FT                   /protein_id="ABR32345.1"
FT                   /translation="MSRSTKKAPFVHEGLFKKIEEMNGNGEKKVVKTWSRSSTIFPQFI
FT                   GHTIAVHDGRKHVPVYVSEDMVGHKLGEFVLTRTYKGHDDKTSKR"
FT   gene            195338..195673
FT                   /locus_tag="Cbei_0156"
FT   CDS_pept        195338..195673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0156"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: ctc:CTC02597 LSU ribosomal protein
FT                   L22P"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32346"
FT                   /db_xref="GOA:A6LPR6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR6"
FT                   /protein_id="ABR32346.1"
FT                   /translation="MEARAIAKYIRMSPTKVGVILDLIRGKQVNEAFAILQYTPREAAV
FT                   VINKVLKSAVANAENNLELNADNLYVSECFVGQGSTLKRFQPHAQGRAFKILKKTSNIT
FT                   VVVKERA"
FT   gene            195698..196363
FT                   /locus_tag="Cbei_0157"
FT   CDS_pept        195698..196363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0157"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3-C-terminal domain protein; KH, type 2 domain
FT                   protein; Ribosomal protein S3, N-terminal domain; SMART: KH
FT                   domain protein; KEGG: cpr:CPR_2393 ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32347"
FT                   /db_xref="GOA:A6LPR7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR7"
FT                   /protein_id="ABR32347.1"
FT                   /translation="MGQKVNPHGLRVGVIKGWDAKWYANKKNFADNLIEDNKIRKFVKK
FT                   ELFSAGISKIEIERAAKRVKLNIYTAKPGVIIGKGGSGIEALKNKLTQFVENKNVLINI
FT                   VEVKSAEADAQLMAENIAAQLEKRISFRRAMKQTMQRAMKHGIKGVKTACSGRLGGAEI
FT                   ARTEHYHEGTIPLQTLRADIDYGFAEADTTYGKIGVKVWVYNGEVLPTKKVEKEEANA"
FT   gene            196381..196815
FT                   /locus_tag="Cbei_0158"
FT   CDS_pept        196381..196815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0158"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: cpr:CPR_2392
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32348"
FT                   /db_xref="GOA:A6LPR8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR8"
FT                   /protein_id="ABR32348.1"
FT                   /translation="MLMPKRVKHRKVQRGRMKGKATRGNFLAYGDYGIQALTCGWITSN
FT                   QIESARIAINRYIKRGGKLWIKIFPDKPVTEKPAETRMGSGKGSPEYWVAVVKPGRVLF
FT                   ELSGVPEETAREAMRLASHKLPVKTKFVSKRDFEEMGGEE"
FT   gene            196815..197027
FT                   /locus_tag="Cbei_0159"
FT   CDS_pept        196815..197027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0159"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: cpr:CPR_2391
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32349"
FT                   /db_xref="GOA:A6LPR9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPR9"
FT                   /protein_id="ABR32349.1"
FT                   /translation="MKARELKELKSSNPQDLTVKLGDLKAELFNLRFQLATGQLENPMR
FT                   IREVKKSIAQIKTILREEELKALEQ"
FT   gene            197051..197305
FT                   /locus_tag="Cbei_0160"
FT   CDS_pept        197051..197305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0160"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: cpr:CPR_2390
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32350"
FT                   /db_xref="GOA:A6LPS0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS0"
FT                   /protein_id="ABR32350.1"
FT                   /translation="MERSLRKKRIGRVVSDKMEKTIVVAVETKVRHPLYGKTVNRTTKF
FT                   KVHDENNEAKINDRVSIMETRPLSKDKRWRLVEIVEKAK"
FT   gene            197334..197702
FT                   /locus_tag="Cbei_0161"
FT   CDS_pept        197334..197702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0161"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: cpr:CPR_2389 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32351"
FT                   /db_xref="GOA:A6LPS1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS1"
FT                   /protein_id="ABR32351.1"
FT                   /translation="MIQQQTLLKVADNSGAKEIMCIRVLGGSKRKFGNIGDVIVASVKS
FT                   ATPGGVVKKGDVVKAVVVRSVKGVRRADGSYIKFDENAAVIIKDDKQPRGTRIFGPVAR
FT                   ELRDKEFTKILSLAPEVL"
FT   gene            197718..198032
FT                   /locus_tag="Cbei_0162"
FT   CDS_pept        197718..198032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0162"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW (Kyrpides, Ouzounis, Woese) domain
FT                   protein; KEGG: cpf:CPF_2703 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32352"
FT                   /db_xref="GOA:A6LPS2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS2"
FT                   /protein_id="ABR32352.1"
FT                   /translation="MKIHVRKNDTVIVISGKDKGKTGEVLKAYPKTGKVLVQGVNIVKK
FT                   HQKANKGQVESAIIEKEAAINSSKVMLYCNKCKNATRISNKVLDDGTKVRVCKKCGETF
FT                   "
FT   gene            198055..198594
FT                   /locus_tag="Cbei_0163"
FT   CDS_pept        198055..198594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0163"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: cpr:CPR_2387
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32353"
FT                   /db_xref="GOA:A6LPS3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS3"
FT                   /protein_id="ABR32353.1"
FT                   /translation="MTRLQEKYQKEVVPAMIEKFGYKNIMEVPKLEKIVINMGVGEAKE
FT                   NQKVLESAVNDLTLIAGQKPVLTRAKKSVANFKIRENMPLGCKVTLRKANMFEFADKLM
FT                   SIALPRVRDFRGVSSKAFDGRGNYSLGIKEQLIFPEIEYDKIDKVRGMDIIFVTTANTD
FT                   EEARELLRFLGMPFAQ"
FT   gene            198611..198796
FT                   /locus_tag="Cbei_0164"
FT   CDS_pept        198611..198796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0164"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: cpr:CPR_2386
FT                   ribosomal protein S14p/S29e"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32354"
FT                   /db_xref="GOA:A6LPS4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS4"
FT                   /protein_id="ABR32354.1"
FT                   /translation="MARKAIIEKWSKTPKYKTRAYTRCRICGRPHAVLKKYGVCRICFR
FT                   ELAYKGEIPGCRKASW"
FT   gene            198829..199227
FT                   /locus_tag="Cbei_0165"
FT   CDS_pept        198829..199227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0165"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: cpr:CPR_2385
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32355"
FT                   /db_xref="GOA:A6LPS5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS5"
FT                   /protein_id="ABR32355.1"
FT                   /translation="MVMTDPIADLLTRVRNANAVRHEVVEVPSSNVKKEIANILLQEGY
FT                   IKEINEYNDGVVPMLRLSLKYGANKERVITGIKRISKPGLRVYCKKDEVPKVLNGLGIA
FT                   VVSTSNGIMVDREARKNGLGGEVICYVW"
FT   gene            199296..199838
FT                   /locus_tag="Cbei_0166"
FT   CDS_pept        199296..199838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0166"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: cpr:CPR_2384
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32356"
FT                   /db_xref="GOA:A6LPS6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS6"
FT                   /protein_id="ABR32356.1"
FT                   /translation="MSRVGRLPIAIPADVTVTVTPDNLVTVKGPKGELVKTMHKDISIA
FT                   VENNEVIVTRHSEQKDHRALHGLTRALINNMVIGVKQGYQKTLDLVGVGYRAQLQGKKL
FT                   VMNLGYSHPVEIEPIDGITFETPAATRVIVSGIDKEKVGFAAADIRKWRVPEPYKGKGI
FT                   KYENEVIRRKEGKTGKK"
FT   gene            199857..200216
FT                   /locus_tag="Cbei_0167"
FT   CDS_pept        199857..200216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0167"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: ctc:CTC02587 LSU ribosomal protein
FT                   L18P"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32357"
FT                   /db_xref="GOA:A6LPS7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS7"
FT                   /protein_id="ABR32357.1"
FT                   /translation="MFKKVDKKASREKRHLRVRKKVFGTAERPRLSVFKSEKNIYAQVI
FT                   DDINGVTLVAASSLEKDFAAKGGNKEGAKLVGELVAKKAIEKGIDVVVFDRGGYIYHGR
FT                   IQELAQAAREAGLKF"
FT   gene            200237..200734
FT                   /locus_tag="Cbei_0168"
FT   CDS_pept        200237..200734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0168"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   cpr:CPR_2382 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32358"
FT                   /db_xref="GOA:A6LPS8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPS8"
FT                   /protein_id="ABR32358.1"
FT                   /translation="MRIDPSTLDLKEKVVFINRVTKVVKGGRNFRFSALVVVGDENGHV
FT                   GVGMGKSIEIPEAIKKGIEDAKKNLVSVAMVGTTIPHQVNGKFGTANVLIMPAKEGTGV
FT                   IAGGPARAVLELAGLKDVRAKSLGSNNPNNMVNATINGLASLRTVEDIAKLRGKSVEEI
FT                   LG"
FT   gene            200747..200926
FT                   /locus_tag="Cbei_0169"
FT   CDS_pept        200747..200926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0169"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: cpr:CPR_2381
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32359"
FT                   /db_xref="GOA:A6LPS9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPS9"
FT                   /protein_id="ABR32359.1"
FT                   /translation="MAKLRITLVKSLIGRKKDHIATANALGLTKIRKTVEPEATPQVQG
FT                   MIKKIEYLLKVEEV"
FT   gene            200948..201388
FT                   /locus_tag="Cbei_0170"
FT   CDS_pept        200948..201388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0170"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: cpr:CPR_2380
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32360"
FT                   /db_xref="GOA:A6LPT0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPT0"
FT                   /protein_id="ABR32360.1"
FT                   /translation="MKLHELKPAAGSKKAPKRIGRGTGSGLGRNAGKGEKGQNARSGGG
FT                   VRPGFEGGQMPLYRRLPKRGFTNIFAKKIVSINLDRLNIFENGTEVTPELLLERRVVSK
FT                   VLDGVKILGNGTLEKSLTVKGCKFSKSAIEKIEAAGGKVEVM"
FT   gene            201390..202688
FT                   /locus_tag="Cbei_0171"
FT   CDS_pept        201390..202688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0171"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: cpf:CPF_2694 preprotein translocase,
FT                   SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32361"
FT                   /db_xref="GOA:A6LPT1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPT1"
FT                   /protein_id="ABR32361.1"
FT                   /translation="MLQTLSNAFKVPELRKKILWTVLLVAVFRMGSHIPLPGINSDFLK
FT                   NLSQSGGLLGFYDMLSGGAFSRSSILALGVMPYINASIIIQLLTVAIPQLEQLSKEGDT
FT                   GRKKIQNATRYVSLGIAFILAYGIFATISSSGATVGLTAIQKTIVVFALVVGTTFCMWL
FT                   GDQLTVKGIGNGTSILIFVNIISRVPATIASMMTLQQAGSASIVEIVLFGVFTVFLLAT
FT                   ILYFSLSERRIPVQYAGKFASGNSNMVKSQSTHIPLSIIGSAVLAIIFSMSVMDFPKTI
FT                   ATLFGGVGESQKEWAKWVLNNPTSIFNNKSWMYMVLYAVLTIFFNWFYTQITFKPDEMS
FT                   ENLHKSAGFVPGVRPGEETTTYFERVLNRLSFIGGILAAVLAVTPVMIQNYTQFQNIAF
FT                   SGTGLLIVINVALDFTRKVESQMVVRHYKGFLK"
FT   gene            202714..203364
FT                   /locus_tag="Cbei_0172"
FT   CDS_pept        202714..203364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0172"
FT                   /product="Nucleoside-triphosphate--adenylate kinase"
FT                   /EC_number="2.7.4.10"
FT                   /note="PFAM: adenylate kinase; adenylate kinase, lid domain
FT                   protein; KEGG: cpe:CPE2384 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32362"
FT                   /db_xref="GOA:A6LPT2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPT2"
FT                   /protein_id="ABR32362.1"
FT                   /translation="MKIVLLGPPGAGKGTQAKSISNKYSIPHISTGDIFRKNISENTPL
FT                   GIEAKGYIDNGQLVPDEVTINMVKDRLQQDDCKVGYLLDGFPRTVAQADALNNFLVDKN
FT                   EQLDTALLIKVPNEFILERMTGRRVCPSCGASYHVKFNPPTNEGKCDLCGSEVIQRKDD
FT                   TVETVKERLDVYQKETQPLIEFYGEKGLLSEVDGTKAINEVFRGICELLGNNK"
FT   gene            203364..204113
FT                   /locus_tag="Cbei_0173"
FT   CDS_pept        203364..204113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0173"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: cpr:CPR_2377 methionine
FT                   aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32363"
FT                   /db_xref="GOA:A6LPT3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPT3"
FT                   /protein_id="ABR32363.1"
FT                   /translation="MITVKNHDEIAIMRKAGRIVGETLLLLEKEVKPGVITASLDRIAE
FT                   EFITKHGAKPSFKGLYGFPSSLCISVNEQVIHGFPGEYVLKEGDIVSIDCGAFFDGFHG
FT                   DAARTFSVGEVSVEAQRLIDITRESFFQGIKFAKQGNKLTDISHEIQSYVEAAGFSVVR
FT                   DFVGHGIGRKVHEDPNVPNFGKSGRGPKLLEGMVLAIEPMVNAGTYKVKTLKDGWTVVT
FT                   ADTSLSAHYENTVAILSDGPEILTLIK"
FT   gene            204201..204482
FT                   /locus_tag="Cbei_0174"
FT   CDS_pept        204201..204482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_2691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32364"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPT4"
FT                   /protein_id="ABR32364.1"
FT                   /translation="MQNNDLIGKVVLSKAGRDKDHLYVVVRQIDDDYVLLANGDTKLIE
FT                   MPKKKKIKHLSILEDVDDELLSLINSCDKSTNLKIKRFLKLRGIVKEG"
FT   gene            204490..204708
FT                   /locus_tag="Cbei_0175"
FT   CDS_pept        204490..204708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0175"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1, IF1 family protein;
FT                   KEGG: cpr:CPR_2375 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32365"
FT                   /db_xref="GOA:A6LPT5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPT5"
FT                   /protein_id="ABR32365.1"
FT                   /translation="MSKDDVIEMQGTVLESLPNAMFQVELESGHKILAHISGKLRMNFI
FT                   RILPGDKVTVELSPYDLTRGRITWRAK"
FT   gene            204763..204876
FT                   /locus_tag="Cbei_0176"
FT   CDS_pept        204763..204876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0176"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36; KEGG: cno:NT01CX_1140
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32366"
FT                   /db_xref="GOA:A6LPT6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPT6"
FT                   /protein_id="ABR32366.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            205100..205468
FT                   /locus_tag="Cbei_0177"
FT   CDS_pept        205100..205468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0177"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: cpr:CPR_2373
FT                   ribosomal protein S13p/S18e"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32367"
FT                   /db_xref="GOA:A6LPT7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPT7"
FT                   /protein_id="ABR32367.1"
FT                   /translation="MARISGIDLPREKRVEIGLTYIYGIGLSTSQKILAVTGINPDTRV
FT                   KDLSEEEVNEIRTYINKNLMVEGDLRRDVALNIKRLVEIGSYRGIRHRRGLPVRGQKTK
FT                   TNARTRKGPKKTIANKKK"
FT   gene            205484..205879
FT                   /locus_tag="Cbei_0178"
FT   CDS_pept        205484..205879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0178"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: cpr:CPR_2372
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32368"
FT                   /db_xref="GOA:A6LPT8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPT8"
FT                   /protein_id="ABR32368.1"
FT                   /translation="MAAKTVKKTRRRKERKNVEHGAAHIKSTFNNSIVTLTDAVGNALS
FT                   WSSAGALGFRGSRKSTPFAAQMAAETAAKVAMEHGLKSIEVYVKGPGSGREAAIRSLQA
FT                   AGLEVTLIKDVTPIPHNGCRPPKRRRV"
FT   gene            205910..206530
FT                   /locus_tag="Cbei_0179"
FT   CDS_pept        205910..206530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0179"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: cpf:CPF_2686 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32369"
FT                   /db_xref="GOA:A6LPT9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPT9"
FT                   /protein_id="ABR32369.1"
FT                   /translation="MARYTGATCRLCRREGMKLFLKGDRCFTDKCAFVRRSYAPGQHGA
FT                   NKKKVSNYGVQLREKQKARRIYGILEGQFRTYYEKAEHIKGITGENLLKLLEMRLDNIV
FT                   YRLGYGSSRNEARQLVTHGHFLVNGKKVDICSYHVSVNDVITVCEKSRSSEKFKTFVEN
FT                   PKTLPKWLEANVDNYEGKVVAEPSREDIDVPVNETLIVELYSK"
FT   gene            206633..207580
FT                   /locus_tag="Cbei_0180"
FT   CDS_pept        206633..207580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0180"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase, alpha subunit domain protein; RNA
FT                   polymerase, dimerisation; RNA polymerase, insert; SMART:
FT                   RNA polymerase, RpoA/D/Rpb3-type; KEGG: cpr:CPR_2370
FT                   DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32370"
FT                   /db_xref="GOA:A6LPU0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPU0"
FT                   /protein_id="ABR32370.1"
FT                   /translation="MLEIEKPIIECIEANEDGTYGKYVVEPLERGYGITLGNALRRILL
FT                   SSLPGVATTSVKIDGVLHEFSTVQGVKEDVTELILNIKSLALRMNGEGPKVIYIDAKGP
FT                   GEVTGADIKTDGDVEVVNKNLHIATLDNDGRLYMELTVNKGRGYVTQNKNKSDELPISA
FT                   IAVDSIYTPVKRVNFTVDNTRVGQITDYDKLTLEIWTNGTIKIDEAISLSAKILIEHFK
FT                   LFMSLTDNTNDVEIMIEKEDDKKEKVLEMTVEELDLSVRSYNCLKRAGINTVQELATKS
FT                   MDDMMKVRNLGKKSLEEVERKLKELGLALKLTEE"
FT   gene            207593..207934
FT                   /locus_tag="Cbei_0181"
FT   CDS_pept        207593..207934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0181"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: cpr:CPR_2369
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32371"
FT                   /db_xref="GOA:A6LPU1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPU1"
FT                   /protein_id="ABR32371.1"
FT                   /translation="MAGHRKLGLPTDQRRAMLRNLVTSLLKHGKIETTETRAKETRSIA
FT                   EKMITLGKRGDLHARRQVLSYVQEELVVKNLFDNVAPKYTERNGGYTRIIKKGPRRGDG
FT                   AEIVILELV"
FT   gene            208168..209019
FT                   /locus_tag="Cbei_0182"
FT   CDS_pept        208168..209019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0182"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cpf:CPF_2683 cobalt ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32372"
FT                   /db_xref="GOA:A6LPU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPU2"
FT                   /protein_id="ABR32372.1"
FT                   /translation="MSDAMIKCAKVSFKYVKDTEGVKQEKYAIKDVDLEVKKGEFLVVL
FT                   GHNGSGKSTIAKHMNALVVPSEGTVIVDGLDTSKMENVWEIRSRAGMVFQNPDNQLVAT
FT                   IVEEDVAFGPENLGIEPLEIRKRVDESLEKVGMSKYKRHAPHLLSGGQKQRIAIAGILA
FT                   IQPECIIFDEPTAMLDPSGRREVLKTINELNKIHGITIVLITHYMDEAAQADRIVVMDG
FT                   GSVKMEGTPREIFPQVERMKKIGLDVPQVTELAYELKKAGIDINEKILNVDEMVNELCQ
FT                   LK"
FT   gene            209004..209873
FT                   /locus_tag="Cbei_0183"
FT   CDS_pept        209004..209873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0183"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cpf:CPF_2682 cobalt ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32373"
FT                   /db_xref="GOA:A6LPU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPU3"
FT                   /protein_id="ABR32373.1"
FT                   /translation="MSIKVENLTHIYMPKSPFEKTALDNVSLEIKDGEFVALIGHTGSG
FT                   KSTLIQHFNGLLEATSGEIIVDGINITDKKAKLTDIRKKVGLVFQYPEYQIFEETIAKD
FT                   IEFGPRNLGLSDSEINNRVIRAMEMVGLDYETYKDRSPFDLSGGQKRRVAIAGVIAMQP
FT                   TTLILDEPTAGLDPKGRDDILNQIRKLHEDYNMTIIIVSHSMEDVAKIAERIIVMNGGK
FT                   VALQGTPAEVFKEVDVLEKIGLGVPQVTYLIRELRKKGFDIPDNIFTIEEAKKQLLSTL
FT                   RINKVKGE"
FT   gene            209882..210688
FT                   /locus_tag="Cbei_0184"
FT   CDS_pept        209882..210688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0184"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: cpf:CPF_2681
FT                   cobalt ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32374"
FT                   /db_xref="GOA:A6LPU4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPU4"
FT                   /protein_id="ABR32374.1"
FT                   /translation="MLKNITIGQYLPGESFVHKLDPRTKILISILFIACLFIINKFIGY
FT                   TFVVVFLLAIILIAKVPFRFIFNGLKPIFLLIVLTAALNIFMVRGAEGTEVFSIGFLKA
FT                   YPEGLSIAAFMAIRLILLIVGTSLLTLTTSPIELTDGIEKLLRPIGKEMAHELAMMMTI
FT                   ALRFIPTLIDETDKIIKAQKARGADFESGGIIKKAKSLVPLLVPLFISSFRRADELAMA
FT                   MEARGYRGGAGRTRMKILEFSYRDLVAFIVFCILVLWCIAVRFIML"
FT   gene            210705..211439
FT                   /locus_tag="Cbei_0185"
FT   CDS_pept        210705..211439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0185"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase; KEGG: cpe:CPE2371
FT                   tRNA-pseudouridine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32375"
FT                   /db_xref="GOA:A6LPU5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPU5"
FT                   /protein_id="ABR32375.1"
FT                   /translation="MRNIKLIIEFDGSNFCGWQRQPKGRTIQKVIETAIFKATGEEIMI
FT                   NGSSRTDAGVHAREMVANFLTNSSIPGDKFREAINTRLPEDVSIIKSEEVSEDFHARYS
FT                   SKGKTYSYTIINRYERLSLGHQYLYHYKYRLDVNEMRRACEYFIGRHDFRAFMSPGSSI
FT                   KTTTRTIHDLYIDQNGNEIKIFITADGFLYNMVRIIVGTLIKIGNGKLEVENIKDIIEE
FT                   GNRKKAGMCVPPNGLILEKVFY"
FT   gene            211600..212034
FT                   /locus_tag="Cbei_0186"
FT   CDS_pept        211600..212034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0186"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: cpr:CPR_2364
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32376"
FT                   /db_xref="GOA:A6LPU6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPU6"
FT                   /protein_id="ABR32376.1"
FT                   /translation="MKSYIAKASEIERKWYVVDAAGKPLGRVASQVASILRGKNKPTFT
FT                   PNVDCGDFVIVINAEKVVLTGKKLDQKLMRKHSLYPGGLKETPYRVVLDKKPEFAFEEA
FT                   VRRMLPNGVLGRQMLKKLNVYRGAEHNHAAQKPEVLELRY"
FT   gene            212061..212453
FT                   /locus_tag="Cbei_0187"
FT   CDS_pept        212061..212453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0187"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: ctc:CTC02571 SSU
FT                   ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32377"
FT                   /db_xref="GOA:A6LPU7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPU7"
FT                   /protein_id="ABR32377.1"
FT                   /translation="MAKVQYMGTGRRKKSVARVRLVPGSGKVLVNKREIENFFGLETLR
FT                   VIVNQPLVLTGTKDRFDVLVNVHGGGFTGQAGAIRHGIARALVKSDEALKPELKKAGFL
FT                   TRDPRMKERKKYGLKAARRAPQFSKR"
FT   gene            212974..213636
FT                   /locus_tag="Cbei_0188"
FT   CDS_pept        212974..213636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0188"
FT                   /product="N-acetylmuramoyl-L-alanine amidase CwlD"
FT                   /note="TIGRFAM: N-acetylmuramoyl-L-alanine amidase CwlD;
FT                   PFAM: cell wall hydrolase/autolysin; KEGG: cpr:CPR_2361
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32378"
FT                   /db_xref="GOA:A6LPU8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPU8"
FT                   /protein_id="ABR32378.1"
FT                   /translation="MRMKKWIALFCIFCLMSGIPVRTNSEENKDKRIILIDPGHGGIDG
FT                   GAKSKSGTIEKDINLSISLKLKKELEDSGYAVYMTREGDSQLDAKKVKDLNARCQMKKD
FT                   VKCDAFISIHQNMFPQSSCFGSQVWYSSNEISKSLAENIQVSLKETINDNNKRVPKAAK
FT                   EQYRILRDGYEGACVLVECGFLSNYEEEQKLKSDEHQDKIAKGITAGINKYFESKDS"
FT   sig_peptide     212974..213051
FT                   /locus_tag="Cbei_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.840 at
FT                   residue 26"
FT   gene            214215..215057
FT                   /locus_tag="Cbei_0189"
FT   CDS_pept        214215..215057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0189"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region; KEGG: cac:CAC3091 fumarate
FT                   hydratase, subunit A (N-terminal domain of FumA E.coli)
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32379"
FT                   /db_xref="GOA:A6LPU9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPU9"
FT                   /protein_id="ABR32379.1"
FT                   /translation="MREINVELITEAIKNLSIEANYFLGSDINDALLNAKKEEPWKLAS
FT                   DVLDKILINSEIARNEKMPMCQDTGMACVFIEIGQDVHLVGGRIEDAINEGVRRGYEEG
FT                   FLRKSVVKDPIRRVNTKDNTPAIIYYDIVDGDKVKIILAPKGFGSENMSRIGMLKPSDG
FT                   LDGVKKFIIDTVKAAGPNPCPPMVIGVGIGGTFDKAAYLAKKALLRPINIRNEDEFYKE
FT                   LELELLQEVNKLGIGPQGFGGKTTALGLNIETYSTHIAGLPVAVNINCHATRHKEVIL"
FT   gene            215262..215819
FT                   /locus_tag="Cbei_0190"
FT   CDS_pept        215262..215819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0190"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region; KEGG: ctc:CTC02561 fumarate
FT                   hydratase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32380"
FT                   /db_xref="GOA:A6LPV0"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV0"
FT                   /protein_id="ABR32380.1"
FT                   /translation="MEIKLETPLNEEKIRQLKAGDSILLSGIIYSARDAAHKRLIELLD
FT                   EGKELPFNIKDQVIYYVGPSPAKPGTVIGSAGPTTSYRMDAYAPKLMDIGLKGMIGKGA
FT                   RNDEVISSIKRNEAVYFGAIGGAAALIGKSIIKSEIIAYEDLGAEAIRKMEVKDMPLVV
FT                   IIDAQGNNLYEIGQREYLDSVK"
FT   gene            215860..216621
FT                   /locus_tag="Cbei_0191"
FT   CDS_pept        215860..216621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0191"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cno:NT01CX_0444 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32381"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV1"
FT                   /protein_id="ABR32381.1"
FT                   /translation="MSRIKLPGKEKNKRILLFVLVLIALGIIAHEFIENRNSKDNKYKE
FT                   EKEIVMPEGTQQSDNNVANKELESIDMKNDSKKAVDDKTNEKSSYSERENELYDEAYNL
FT                   FFSHKYIESISKADLLISEFPSNAMGYNIRGIAKSYNGDFNSGIDDIDKALSIDNNYGY
FT                   ARFNKALTYELYGKMDDALEWYNKALDVEDYEWSYYGIASIYGRRGDIKNTMLYLNKAI
FT                   QMDASIKEIAKEEHDFDTVKNSEEFKKAVYN"
FT   sig_peptide     215860..215949
FT                   /locus_tag="Cbei_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.921 at
FT                   residue 30"
FT   gene            216687..217379
FT                   /locus_tag="Cbei_0192"
FT   CDS_pept        216687..217379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0192"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cpf:CPF_2674 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32382"
FT                   /db_xref="GOA:A6LPV2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV2"
FT                   /protein_id="ABR32382.1"
FT                   /translation="MFNVLVVDDEKEIRDAIEIYLRGENLKVFKAEDGLEALDILEKEK
FT                   IHLIILDIMMPRFDGIRTCLKIRESQNLPIIMLSAKGEDSDKILGLNVGADDYITKPFN
FT                   HLELVARVKSQLRRYEKPLNVEEGKDIIKVKDLVIDTVAKKITLRGEDVKVTATEYKIL
FT                   YLLASNLGKVFSIKEIYEHVWEEIFYKSENTVTVHIRRIREKIEINTKEPEYIKVVWGI
FT                   GYKIEKED"
FT   gene            217546..218706
FT                   /locus_tag="Cbei_0193"
FT   CDS_pept        217546..218706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0193"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: cpr:CPR_2358 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32383"
FT                   /db_xref="GOA:A6LPV3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV3"
FT                   /protein_id="ABR32383.1"
FT                   /translation="MYVAFITKIIFILKKNQNSPRIQSDFVNNVIFVIKNGFHYKETRS
FT                   KLIISIALALILLIAYLYFLATGGYENNIFVKFFQTYPFKGSVFVIIILFFTMMYALKK
FT                   TLDIIVVNDALRRVSEGNLQDDIKLDGSPAIKELAKNINLIKAGYKEILEDGVHNEKLK
FT                   TELISNVSHDLKTPLTSIINYVNILKNSDITEEEREEYLLILERKSLKLKVLIEDLFEM
FT                   SKINSGKIKLNRELIDILSLIHQGIGEYSTLYEEKNISFKVTSEEDAVYMELDGKMMSR
FT                   ALENIIINALKYSMSNTRVYINVKIDGDYVNVGVKNIANYEMDFNEYEMFERFARGDKS
FT                   RNSKVEGSGLGLAITKSIVELHGGEVKIKKEGDMFKIYLMLPINKG"
FT   gene            218903..221134
FT                   /locus_tag="Cbei_0194"
FT   CDS_pept        218903..221134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0194"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase, alpha
FT                   subunit; PFAM: ribonucleotide reductase large subunit;
FT                   Ribonucleotide reductase large subunit, N terminal domain
FT                   protein; KEGG: cpe:CPE2361 ribonucleoside-diphosphate
FT                   reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32384"
FT                   /db_xref="GOA:A6LPV4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV4"
FT                   /protein_id="ABR32384.1"
FT                   /translation="MSLLSELCKDAINTIKDNEGLYTEDKLLDALNPIVRKDMNKREIR
FT                   NSLIQVALELTTDMEPNWQYVAARAYTYELYDRVRSSRNLEDDKNLYQDYYEFIESLTE
FT                   RGLYGEYILKNYSREDILELEKDIKPERDFLFNYSGINLLASRYLVQDYNRSPIELPQQ
FT                   MFMGIAMHLAIPEKEENRVYWAKRFYDVLSSLKATMATPTMSNARKPFYQLSSCFIDSV
FT                   EDSLEGIYKSLDNFAKVSKFGGGMGIYMGKIRALGSPIRGFKGASGGVIPWVKLFNDTA
FT                   IAVDQLGVRNGSVAIWLDAWHKDIPEFLQIRTNNGDDRKKAHDVFPGICYPDLFWRLAE
FT                   NDIDANWHMMCPHEIKNIKGYALEDFYGEQWEEKYYECVSDERIEKRVMSVKDLVRLII
FT                   KSAVETGAPFAFYRDMTNKMNPNKHNGMIYSSNLCTEIMQNMSPMKIQKSQILSDKDEY
FT                   AVVEKIIPGDFVVCNLSSVVLGNIDVCNDEEVEYVVETQIRAMDNVIDLNYYSVPFAEI
FT                   TNKKYRAIGLGTSGYHHMLVNNKIHWTEEEHKSFVDKIYEKINYYAIKASMNISKEKGF
FT                   YELFKGSDWDTGEYFRLRNYNSAKWNELKELVHEFGTRNGYLIAVAPNGSTATIAGTTE
FT                   GIDPIMARFYLEEKKGSIIPKTAPNLSEDNYWYYNSAYNIEQMWCVKMNGIRQRHIDQG
FT                   QSFNLYITSSYTMRQIMNLYIEACKCGVKSIYYVRSKSLEVTECETCSA"
FT   gene            221388..222422
FT                   /locus_tag="Cbei_0195"
FT   CDS_pept        221388..222422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0195"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: cac:CAC3276
FT                   ribonucleotide reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32385"
FT                   /db_xref="GOA:A6LPV5"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV5"
FT                   /protein_id="ABR32385.1"
FT                   /translation="MTINKKPLFNELGDREISKKRIINGNTTNLNDFNNMKYSWVSDWY
FT                   RQGMNNFWIPEEVNLSQDLKDYQNLLEEERIAYDKILSFLIFLDSIQTANLSNINNYIT
FT                   ASEINLCLTIQSFQEAVHSQSYSYMLDSICSPEKRNEILYQWKDDDILLKRNKFIGDLY
FT                   NEFIENPTEYNLLRTLMANYILEGIYFYSGFMFFYNLERNGKMPGSAQEIRYINRDENT
FT                   HLWLFRNIIKELQNENPELFTEEVKNELRNMMKIGVEQEILWGHYVIGDKIQGINKQLI
FT                   ENYIKYLGNKRLKEINLSPLFKEQDKNPASWVDTLSNANSVKTDFFEARSTAYAKVTTL
FT                   IDDL"
FT   gene            222653..224272
FT                   /locus_tag="Cbei_0196"
FT   CDS_pept        222653..224272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0196"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein, mobile region; PEP-utilising protein
FT                   domain protein; KEGG: cpe:CPE2357
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32386"
FT                   /db_xref="GOA:A6LPV6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV6"
FT                   /protein_id="ABR32386.1"
FT                   /translation="MKKGIAASKGYAIGKVFLQEHEEIIINDSKIADIDAEKAKMQKAL
FT                   DDSKVQLEAIKDKAEKEMGAEKAAVFEAHITLLDDPEFTGAMMMEIENNSINGLKAIES
FT                   VANTFVAIFESMDNEYMRERAADIKDVSKRILSNFAGKGGDSFAITEENTVVVAHDLTP
FT                   SDTAGLDRTKVVGFITNIGGRTSHAAIMARTLEIPAVLGLGDITTAVKTGDAVIVDGIT
FT                   GDVIINPSEEVLAEYREKKAKFQAEQEELKKLIDVKTTTKSGRRIEVCGNIGKPEDVLG
FT                   VLANGGDGVGLFRTEFLYMDRDSAPTEDEQYESYKFVLEKMEGKQVVIRTLDIGGDKTL
FT                   PYLPLPEEMNPFLGYRAIRLCLDRKDIFKVQLRALLRASIYGNLAVMFPMISGLEEFEQ
FT                   AREVVEECKAELKAEGKEYSEKIQWGIMVEIPAAAVYADELAKHVDFFSIGTNDLIQYT
FT                   LAADRMSEKVSYLYNPMHPAVLRLIKMTIDGAHKHGKWVGMCGEMAGDEAAIPTLVEYG
FT                   LDEFSMSATSILNAKKIMLEQE"
FT   gene            224417..225682
FT                   /locus_tag="Cbei_0197"
FT   CDS_pept        224417..225682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0197"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cno:NT01CX_1157
FT                   TPR-repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32387"
FT                   /db_xref="GOA:A6LPV7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV7"
FT                   /protein_id="ABR32387.1"
FT                   /translation="MNKKVKRAHDKAMSYYEMGQIDKALEICEDILLEGLDNPNVLNFK
FT                   GLLLYQKGNLEEAVTVWKMNSDLNNDDIAKSYINDSILDRKRLELYRQGEQALKQLKVD
FT                   KALNIFMRCAESDFNAIKVNTGIAMCYQRKGDFYRAREYAEKVLNIDKNAITAKKIEKE
FT                   LKDSGTFIEERNSSKGLFGIIIMVIVAAIVVGGYTAVSKYKSLNNTVEETTKDKSDINK
FT                   EAYTYEEKDNKESTPETLKEEVKEEHDNIKFNKDKMIALINNNDLDGIYEQIKDIKQES
FT                   ISSDDQGVYKQAVDLIKDQGVSRFYENGLKSFNENKYSDAKVFLDKAYAYCEGNSLKEH
FT                   ILFYRASSSSKLSDNSAAVKQYEEYYSQYPNGVYVEEALYNLALLNSSINKDKSKQYAS
FT                   ILINNYPDSMYANNNIKNIIKE"
FT   gene            225844..227019
FT                   /locus_tag="Cbei_0198"
FT   CDS_pept        225844..227019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0198"
FT                   /product="isoaspartyl dipeptidase"
FT                   /note="TIGRFAM: isoaspartyl dipeptidase; PFAM:
FT                   amidohydrolase; KEGG: cpf:CPF_2665 isoaspartyl dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32388"
FT                   /db_xref="GOA:A6LPV8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV8"
FT                   /protein_id="ABR32388.1"
FT                   /translation="MISIIKGCNVYAPKHLGIKDVVIVGGKIEGIYENLNIKIAPIDVE
FT                   VIDGRNKLLFPGFIDGHVHIIGAGGEGGYNTRTPEMPLSSLVKAGITTVVGCIGTDGTC
FT                   RSMKSLIAKVKALKQDGMSAYCFTGSYELPVKTVTDSIKSDLMLIEEIIGIGEIAISDH
FT                   RSSQQAFEVFANAVAESRVGGLLSNKCGIVNIHLGEGNRKLNYLFELLDKTEIPETQLL
FT                   PTHINRNGKLFKEGLEYVKRGGFIDLTTSCDLENLGEGELRAGEGLKKYLDEKLPIDHI
FT                   TFTSDGNGSMEKFDKDGKLEGYEICSVSTLYREIKYAITEQNVPIEDAIKVVTSNVAAI
FT                   MKLANKGAIESGKDADLLIVDKKSLDIEMVFANGKKMMENGEVIVKGFFEK"
FT   gene            complement(227090..227695)
FT                   /locus_tag="Cbei_0199"
FT   CDS_pept        complement(227090..227695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0199"
FT                   /product="cell wall hydrolase, SleB"
FT                   /note="PFAM: cell wall hydrolase, SleB; KEGG: cpr:CPR_2348
FT                   spore-cortex-lytic enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32389"
FT                   /db_xref="GOA:A6LPV9"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPV9"
FT                   /protein_id="ABR32389.1"
FT                   /translation="MKKTYSIFVTALILYLSVINMNPAFASNLAGSHGEIKTTYENPKM
FT                   KVNYLSANINNSQSDEKNNEVLEVFKHDTQQLYITGEDIDLMAKLVSAESGGEPYAGKV
FT                   AVASVVLNRTIDPHFPNTIREVIFQKNAFSCVKNGKITANPDQDCYNAVYDAIRGADPT
FT                   NDALFFYNPATATCHWMKETQKVNEKIIGHHTFFKVKV"
FT   sig_peptide     complement(227615..227695)
FT                   /locus_tag="Cbei_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            227940..228788
FT                   /locus_tag="Cbei_0200"
FT   CDS_pept        227940..228788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0200"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   cpr:CPR_2346 conserved hypothetical protein TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32390"
FT                   /db_xref="GOA:A6LPW0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPW0"
FT                   /protein_id="ABR32390.1"
FT                   /translation="MQELLTMLIKSFSNISIWSILDILVVSYIFYKGYMLIKETRAEQL
FT                   LKGIVLIIALIPISYLLKLDMLYFILNKTLTIGVLSVVIIFQPEIRRALEHLGRSAFDD
FT                   HYLNNREDFNTMINEITIAVQNLAESKTGALIVMEQSTGLNELIGAGTVLDAKITSNLL
FT                   ENIFVVNTPLHDGATIIRNNRILASGCVLPLTSNNSINKKLGTRHRAAIGLSEVSDALV
FT                   IIVSEETGVVSLAINGKITRGYDKDRLKLILTKVVENRNQKRVKTAGEKVRSWIKVKTE
FT                   R"
FT   gene            228761..229981
FT                   /locus_tag="Cbei_0201"
FT   CDS_pept        228761..229981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0201"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: cpr:CPR_2345
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32391"
FT                   /db_xref="GOA:A6LPW1"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPW1"
FT                   /protein_id="ABR32391.1"
FT                   /translation="MDKSENGTLIVKIICLLLSVVLWLYISNVENPLRTYELKGIPVEL
FT                   TNEDSLVDSKFAIVNKQPFTVDLKLEGPSSEILKVKKEDFKIVADMSAYALKVGENTIP
FT                   VQITSYPENITIKNNGMLGIKVNLEELTQKELTISSKVKVTYKENIYEKEQNINPNTVT
FT                   ITGGKSSVDKVTEAILTGEEKDVDKNKQGDYNIQFIDSFGNAVSNIESNIKTAKLSITV
FT                   TNGKTVPVNVKTTGNVPQGFVLDGYELSKNNVTVLGDSQVLNKLESIDTEAVDMSSLQP
FT                   DSEVDVKLNLPEGISISDGEASIKAKFKLKKEENTTKNIECNVQYKNLSDIFLVTNQSL
FT                   VSNVKLSGTQEALDKISSQNISVILDLANVKEEGTFDYTPQATLVNANNVTVSDVGTVS
FT                   VTIKKKG"
FT   gene            230153..231754
FT                   /locus_tag="Cbei_0202"
FT   CDS_pept        230153..231754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0202"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; KEGG: cpf:CPF_2658
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32392"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05627"
FT                   /protein_id="ABR32392.1"
FT                   /translation="MAIRINNINLSLDDDLNVLEKKICKKLNMSKEDISRLDIIKRSID
FT                   ARKKNDIKVSFSVNVFCKKEKMLLSRIHDKDISFEEIREIESIKSGTEEIKARPVVVGF
FT                   GPAGIFAALTLARYGYKPIVYERGEDVDKRTETVEKFWKDGRLNLESNVQFGEGGAGAF
FT                   SDGKLTTRIKDHRCSFVLDELIKAGAPAEIKYESKAHVGTDLLKGVVKNIREEIKRLGG
FT                   EVNFNSKLEKITYKDGKLESIVVNGKNITCEALVLAIGHSSRDTYEMLYRENVSMDAKA
FT                   FAIGVRIEHPQELINVNQYGNNHNHPKLHAADYRLTYQSEKLKRGVYSFCMCPGGVVVA
FT                   AASEEGRLVSNGMSYHARDLDNANSALVVTVSPEDFKGSSPLRGMEFQRHYESLAFKLG
FT                   GGNYKAPVQLVGDFMKDRVSTKLGEVIPSYTAGYEFRELKECLPDYVVEALKEGIINFD
FT                   KKIKGYAREDAILTGIETRTSAPVRLNRNASLESINVCGLYPTGEGAGFAGGIISAAVD
FT                   GIKVAEHIIEKFDLPK"
FT   gene            232027..232935
FT                   /locus_tag="Cbei_0203"
FT   CDS_pept        232027..232935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0203"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="TIGRFAM: Phosphate butyryltransferase; PFAM:
FT                   phosphate acetyl/butaryl transferase; KEGG: cpr:CPR_2343
FT                   phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32393"
FT                   /db_xref="GOA:Q05624"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR014079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05624"
FT                   /protein_id="ABR32393.1"
FT                   /translation="MSKNFDELLSRLKEVPTKKVAVAVAQDEPVLEAIKEATENNIAQA
FT                   ILVGDKQQIHEIAKKINLDLSDYEIMDIKDPKKATLEAVKLVSSGHADMLMKGLVDTAT
FT                   FLRSVLNKEVGLRTGKLMSHVAVFDVEGWDRLLFLTDAAFNTYPEFKDKVGMINNAVVV
FT                   AHACGIDVPRVAPICPVEVVNTSMQSTVDAALLAKMSDRGQIKGCVIDGPFALDNAISE
FT                   EAAHHKGVTGSVAGKADILLLPNIEAANVMYKTLTYFSKSRNGGLLVGTSAPVILTSRA
FT                   DSFETKVNSIALAALVAARNK"
FT   gene            233080..234147
FT                   /locus_tag="Cbei_0204"
FT   CDS_pept        233080..234147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0204"
FT                   /product="Butyrate kinase"
FT                   /note="TIGRFAM: Butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: cpf:CPF_2656 butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32394"
FT                   /db_xref="GOA:Q05619"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05619"
FT                   /protein_id="ABR32394.1"
FT                   /translation="MSYKLLIINPGSTSTKIGVYEGEKELFEETLRHTNEEIKRYDTIY
FT                   DQFEFRKEVILNVLKEKNFDIKTLSAIVGRGGMLRPVEGGTYAVNDAMVEDLKVGVQGP
FT                   HASNLGGIIAKSIGDELNIPSFIVDPVVTDELADVARLSGVPELPRKSKFHALNQKAVA
FT                   KRYGKESGQGYENLNLVVVHMGGGVSVGAHNHGKVVDVNNALDGDGPFSPERAGSVPIG
FT                   DLVKMCFSGKYSEAEVYGKAVGKGGFVGYLNTNDVKGVIDKMEEGDKECESIYKAFVYQ
FT                   ISKAIGEMSVVLEGKVDQIIFTGGIAYSPTLVPDLKAKVEWIAPVTVYPGEDELLALAQ
FT                   GAIRVLDGEEQAKVY"
FT   gene            234292..234765
FT                   /locus_tag="Cbei_0205"
FT   CDS_pept        234292..234765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0205"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase, HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase, HD region; KEGG:
FT                   cpr:CPR_1097 HDIG/HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32395"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05626"
FT                   /protein_id="ABR32395.1"
FT                   /translation="MDRFNCILNDTEYIYYLKRNKKFEKDRKFCKHNLKHFLDVARIAQ
FT                   LINLEESLGFNKEIIYTTAILHDIGKSLQYENGTPHEISSWEISKEILHNYRYNEEEIE
FT                   IIKQGILGHRDKKSENFAQLMYRADKLSRLCISCKSIDECNWGDEKKNFKIYY"
FT   gene            234782..235591
FT                   /locus_tag="Cbei_0206"
FT   CDS_pept        234782..235591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0206"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase, DHPS; KEGG: cpe:CPE1021
FT                   dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32396"
FT                   /db_xref="GOA:Q05621"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05621"
FT                   /protein_id="ABR32396.1"
FT                   /translation="MKIGSKEFNIGERTYIMGILNFTPDSFSDGGKFNDIDVAVKHVKE
FT                   MIDNGADIIDVGGESTRPGYEIVSEEEEISRVVPIIKAIKEDFDIPVSIDTYKAKVAEQ
FT                   AIEAGANLINDIWGFKKDKDMAKVAAKYNVPCCLMHNRDNTEYKNLMEDILNDLKECIN
FT                   IAKDAGVKDENIILDPGIGFGKTYEQNLEAMNNLERIKELGYPILLGTSRKSMIGLALN
FT                   LPVEERIEGTVATTVIGIMKDACDFVRVHDVLENSRAAKMTDIIVRR"
FT   gene            235604..236428
FT                   /locus_tag="Cbei_0207"
FT   CDS_pept        235604..236428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0207"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; dihydroneopterin aldolase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK;
FT                   KEGG: cpf:CPF_1277 dihydroneopterin
FT                   aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32397"
FT                   /db_xref="GOA:A6LPW7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPW7"
FT                   /protein_id="ABR32397.1"
FT                   /translation="MDKMYIRELELFGFHGVFEEEKRLGQKFILSFELDIDLKLAGKTG
FT                   DLTKTVHYGELCEKIEDEFKRKNYELIETATLNLADFILNEYKIIEGVKVFLKKPWAPI
FT                   KKHLDTVEIMIERRRHKAYISLGSNIGNKEQYLEDAINKISAEKNIEIIRKSSFIKTKP
FT                   WGYLEQEDFLNGVVEIETILEAEELMDVLLGIEANLDRKRTIKWGPRTIDLDIIIYDSV
FT                   VSSNEKVILPHPRMHEREFVLKPLSEIAPYLMHPVLNKRVFTLLEELEKKDN"
FT   gene            236467..237303
FT                   /locus_tag="Cbei_0208"
FT   CDS_pept        236467..237303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0208"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   cpf:CPF_2644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32398"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPW8"
FT                   /protein_id="ABR32398.1"
FT                   /translation="MRSSLKFTNKLNMLSEMECESKFQILEYENLDGATDVQTAFGLNI
FT                   MKKSGIKLKQVRILLEDSSVTLEPGSLSYMKGKIQITNKSGGLLGLGKKIISSKLIGES
FT                   IFRPTYSGTGEIFLEPSFGHFALIELEDDEIVVGDNMFYACEEGIEIDATMQKNVSSAF
FT                   LGNEGLYQTRIEGSGIVVLKVPVPESEIFKCILINDTLKVDGNFAILRTGNIEFSVEKS
FT                   SKSIIGTAVSGEGMVNVYRGTGEVWLVPTKSIYKDLNIKGLDAISGINPESNVEDL"
FT   gene            237444..237797
FT                   /locus_tag="Cbei_0209"
FT   CDS_pept        237444..237797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0209"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="TIGRFAM: TrpR like protein, YerC/YecD; PFAM: Trp
FT                   repressor; KEGG: cpr:CPR_2329 TrpR-like protein YerC/YecD"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32399"
FT                   /db_xref="GOA:A6LPW9"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPW9"
FT                   /protein_id="ABR32399.1"
FT                   /translation="MVIIKEKISITRGDKVGSLESKLKSKELDLFFKSILELKNIDECY
FT                   KFFEDVATINEVKSLAQRLHVAKLLKCKKTYSEIAEITGASTATISRVNRCLNYGSDGY
FT                   NLVLERLKDENID"
FT   gene            238013..239359
FT                   /locus_tag="Cbei_0210"
FT   CDS_pept        238013..239359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0210"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: cpr:CPR_2324 phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32400"
FT                   /db_xref="GOA:A6LPX0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPX0"
FT                   /protein_id="ABR32400.1"
FT                   /translation="MGRMFGTDGVRGVANTELTARIAYDLGRAGAYVLTEGAHKPKILV
FT                   AKDTRISGDMLESALIAGILSVGAEAIVLGVVPTPAVAYLTRKYGADAGVMISASHNPV
FT                   EYNGIKFFNDKGYKLSDELEDEIQRVIESDFEGVPSPTGTDLGRETIEVSALDDYIEFA
FT                   KNTIPYSLKGLKIALDCANGAAYKSSVKAFRELGADVFVINDNPDGTNINENCGSTHPE
FT                   ELMEYVIKKKCDLGFAFDGDADRCLAVDEKGNLINGDFILMLCAKYLKELGKLKDDTLV
FT                   VTVMSNLGLDIACKNEKINIVKTAVGDRYVLEEMVKNKYVLGGEQSGHVIFLDYNSTGD
FT                   GLVTALQIAGIVKKKEKALSELCSIMKELPQVLANATIPNDKKDLYLTDDEIQNEIRKI
FT                   EEALNGVGRVLIRPSGTEPLVRVMLEGENQAEIDEMAHNLANLIEKKYN"
FT   gene            239587..240012
FT                   /locus_tag="Cbei_0211"
FT   CDS_pept        239587..240012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_2064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32401"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPX1"
FT                   /protein_id="ABR32401.1"
FT                   /translation="MDKEPYNEYLVVMPTGNCKGFNDIEGVKAYINMYYELRLDDVFHK
FT                   DGYNDATEIGGDEYRYNVFTQLGAEEGAKCEIYKTASFIEEINKELVFEDEKEEIISKL
FT                   CEAKINFNIYDYSLDTVLANIQEVEYMDDYGTNVSRM"
FT   gene            240552..241061
FT                   /locus_tag="Cbei_0212"
FT   CDS_pept        240552..241061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0212"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: mbu:Mbur_0709
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32402"
FT                   /db_xref="GOA:A6LPX2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPX2"
FT                   /protein_id="ABR32402.1"
FT                   /translation="MEKHVLSVLVKNSSGVLSRVSGLFSRRGYNIDSLTVGRTEDPSIS
FT                   RMTITLMGDENVLEQVKKQLNKLEDVIRVINFKADDSVYRELVLIKVKASAENRAAINE
FT                   TVNIFRSKIIDLSTDTLTIELTGDENKISALINLMEEYGIEELVRTGVTALQRGEKTIR
FT                   NSIESY"
FT   gene            241127..242722
FT                   /locus_tag="Cbei_0213"
FT   CDS_pept        241127..242722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0213"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: cth:Cthe_2519 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32403"
FT                   /db_xref="GOA:A6LPX3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPX3"
FT                   /protein_id="ABR32403.1"
FT                   /translation="MAQNQVKIFDSTLRDGAQGQGISFSLEDKIKIVKVLDEMKVDYIE
FT                   AGNPGSNPKDMEFFKRLKDVELKNAKVVAFGSTRRPKINVEDDKNLKDLLSSGADTIVV
FT                   FGKSWDFQVTDIIKTSLSENVNMIKDTIEYLCVKGKEVIFDAEHFYDGYKANKEYAMAT
FT                   LKAAEEAGAKVVVLCDTNGGALPQEIYSITKTIKETVKVELGIHSHDDMGMAVANSIMA
FT                   VEAGASQIQGTFIGIGERCGNANLSTIIPTLKLKLGYKVLNDNELVNLTKTSRYIAEIC
FT                   NITLSDEDPFVGNSAFAHKGGMHIDAVTKSPKSYEHIEPELVGNKRRFLVSEVSGKSTI
FT                   LQEIQKIFPNISKDDKSVQKITDRLKELEYDGYQFEGAEGTVELVIRKIIGKYKPFFKL
FT                   NHFKIIGEQPYGSEEFSSTAVINITVDGQNEMTAAEGEGPVNALDKAIRKALEVFYPEL
FT                   KQARLVDYKVRVLDSESATEAKVRVLIESTDGIESWSTVGVSRDVIQASWIALVDSIEY
FT                   KLIKDIERKVKAYF"
FT   gene            242736..243995
FT                   /locus_tag="Cbei_0214"
FT   CDS_pept        242736..243995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0214"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase, large subunit;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein; KEGG: cth:Cthe_2211 3-isopropylmalate
FT                   dehydratase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32404"
FT                   /db_xref="GOA:A6LPX4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPX4"
FT                   /protein_id="ABR32404.1"
FT                   /translation="MGMTMTQKILAAHAGLEAVKAGQLIEANLDLVLGNDITTPVAVNE
FT                   FKKFGTDKVFSKSQIAIVPDHFTPNKDIKAAEQVKYIREFAQNMEIENFFEVGEMGIEH
FT                   CLLPEKGLVVAGDVVIGADSHTCTYGALGAFSTGIGSTDMAAGMATGKCWFKVPSALKF
FT                   VLKNKPAKWISGKDIILHIIGMIGVDGALYKSMEFVGDGLQYLSMDDRFTMANMAIEAG
FT                   GKNGIFPVDDKTEEYLKDHASREWKVYEADEDAEYDKVFEIDLSELRPTVSFPHLPDNT
FT                   RTIDNTGDVAIDQVVIGSCTNGRISDLRMARDILKGKKVKKGIRCIVIPGTQKIYLQAI
FT                   KEGIVTDLVEAGAAFSTPTCGPCLGGHMGILAKGERCVSTTNRNFVGRMGHVESEVYLA
FT                   SPAVAAASALTGKITDPELV"
FT   gene            244009..244494
FT                   /locus_tag="Cbei_0215"
FT   CDS_pept        244009..244494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0215"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   cth:Cthe_2210 3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32405"
FT                   /db_xref="GOA:A6LPX5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPX5"
FT                   /protein_id="ABR32405.1"
FT                   /translation="MSVKGKVFKYGDNVDTDVIIPARYLNTSDANELAAHCMEDIDVDF
FT                   VKNVKSGDIIVANKNFGCGSSREHAPLAIKTAGVSCVIASTFARIFYRNAINIGLPILE
FT                   CDEAVKNIDAGDELEVDFSTGLIKNLTKSQEYQGEAFPEFMQKIIDNDGLIGYIRNR"
FT   gene            244634..245716
FT                   /locus_tag="Cbei_0216"
FT   CDS_pept        244634..245716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0216"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; KEGG: cac:CAC3171
FT                   isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32406"
FT                   /db_xref="GOA:A6LPX6"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPX6"
FT                   /protein_id="ABR32406.1"
FT                   /translation="MKCNIAVIPGDGIGPEVIDETIKVLKVIGDKFGHRFEYEYVLAGG
FT                   CAIDKEGTPLPEATLEACKKSDAVLLGAVGGPKWDDPTAKIRPEQALLGLRGALNLYCN
FT                   LRPAVLYAPLKNESPLKDSIVKDGIDICIVRELTGGIYFGERGLEEVDGVKSAYDTERY
FT                   NVNEITRIAKIGFETAMKRNKKLTSVDKANILESSRLWRSVVNEMAKDYPEVEVNHLYV
FT                   DNTAMQLVKDPNQFDVIVTSNIFGDILSDEASMVTGSIGMLPSASLGEGTLGMYEPIHG
FT                   SAPDIAGQGIANPLATILSAAMMLRYSFSLEEEAKSIENAVLAVLEDGYRTGDIMTEGK
FT                   KKVGTIEMGNLVREKLEATK"
FT   gene            245786..247459
FT                   /locus_tag="Cbei_0217"
FT   CDS_pept        245786..247459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0217"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein,
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: cth:Cthe_2714 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32407"
FT                   /db_xref="GOA:A6LPX7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPX7"
FT                   /protein_id="ABR32407.1"
FT                   /translation="MLLTGAEILIKSLLDEGVETIFGYPGGAVLNIYDELYKYKDKIRH
FT                   VLTCHEQGASHAADGYARATGKVGVCLATSGPGATNLVTGIATAYMDSIPMVAITGNVA
FT                   KPLLGKDSFQEVDITGITMPITKHNYIVRDINELQDVIREAFYIAQEGRPGPVLIDIPK
FT                   DITAEKTQYNKIIPKEVIRKSEHITEKSLQEAVGLINQSKRPLIYAGGGIGISGATSEL
FT                   IKFAEKINCPVSTSLMCMSEFPNDHELYTGMIGMHGTKASNIAATKCDLLITLGARFSD
FT                   RVISNQNHIKNAKILQIDVDPAEINKNIKVDTCIVGDLKVALNQLIPIIDEKKNDEWLD
FT                   TINNLKENNKLVPYCDLTPELFFDRLNKLNDGSFIISTEVGQHQMWTAQYFNFKSERTF
FT                   ITSGGLGTMGYGLGAAIGAQIGRFDKRVFNIAGDGSFGMNCNELVTAVKNNLPLIQVIM
FT                   NNNCLGMVRQWQDFFYEGRYSETTLDRPTDYVKLAEAFGAKAFRITQVDEIDDILRKAL
FT                   DSEGPVLIDYLINSDKKVFPMVAPGAPINQIISEEDININ"
FT   gene            247472..248476
FT                   /locus_tag="Cbei_0218"
FT   CDS_pept        247472..248476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0218"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; PFAM:
FT                   acetohydroxy acid isomeroreductase; Acetohydroxy acid
FT                   isomeroreductase, catalytic domain protein; KEGG:
FT                   cno:NT01CX_2028 ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32408"
FT                   /db_xref="GOA:A6LPX8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LPX8"
FT                   /protein_id="ABR32408.1"
FT                   /translation="MPKMYYEKDTDLNLLRGKKVAIIGYGSQGHAHALNLHESGVDVVV
FT                   GLYNGSKSWAKAEAAGLQVATVADAAKAADLIMILLPDEKQAKIYNEEIAPNLEEGNAL
FT                   VFAHGFNIHFGQVVPPSYVDVFMVAPKGPGHLVRRTYTEGAGVPCLIAVHQDATGKAKQ
FT                   YALAYANGIGGARAGVLETTFKDETETDLFGEQAVLCGGVSELIKAGFETLVEAGYAPE
FT                   NAYFECMHEMKLIVDLLYQGGLSMMRYSISDTAEYGDYQIGRRIITDETKKEMKKVLTE
FT                   IQDGTFAKNWLLENQTNRPGFNARRRMEAEHPIEKVGKELRGMMSWIDTAKVD"
FT   gene            249021..251945
FT                   /locus_tag="Cbei_0219"
FT   CDS_pept        249021..251945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0219"
FT                   /product="sigma-54 factor, interaction domain-containing
FT                   protein"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; PTS system fructose
FT                   subfamily IIA component; PRD domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: tte:TTE0180 NtrC family transcriptional
FT                   regulator, ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32409"
FT                   /db_xref="GOA:A6LPX9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPX9"
FT                   /protein_id="ABR32409.1"
FT                   /translation="MQRLIELINSEDKKNPYTDQELAEFLSIPRLKVIQKRNELNIPDS
FT                   RDRRKELLLADLREILKKNINLSERKVTELMMERGYNISRSIISKNIKDVIQEIKGGNE
FT                   STLPNETLVIKEKDNNKNEESFQKLIGYRGSLRNKIDLAKAAILYPPNGLHTLIYGGSG
FT                   VGKSELAECMYEFSVLSGVKSKDAPFIVFNCADYAENPNLLIAQLFGVIKGAYTGANSD
FT                   KEGLVEKANGGILFLDEIHRLPSEGQEILFYLIDKGKYRRLGETNVERKVNVLILAATT
FT                   ENPESNLLLTFRRRIPVLIELPKLTERPLSERLEVIVMFLTREARRINRNLLVKKDVLT
FT                   CLMMYNCKANIGQLKSDIQVICAKSYVKYMFKNTDEVVIDIEDLSLSIKSALSEGQKEK
FT                   KQVKNLGIDDLYIDIKNEQKNKDEIYKYVNENEIYHYIEEQFKKLELEGIKNEEMDEIL
FT                   LEKVENKLGKIIDNKKITKLLNINELKTIVRPEVINITEGILELVREKYKFINNSFFIA
FT                   LAIHINFTIERVMNGKVITKSNIHMEKATMVQEMKIAEKIRIMIEKSTKLKIPKEETTY
FT                   IAIYIKKFCSDVFNVKPKVRVIIITHGHVACGIADIVNQLLGVEDTVGIEIALDESPES
FT                   GIERTIELVQEIDEGRGCLLLVDMGSLGMFSTIVEERTGIKTMSLARVDTLLALEAVRK
FT                   ASIEGASLEDIVEMLKEVKEYNGTFKSEIAGKKNKKKAIITVCLTGEGNSLSIKKYLES
FT                   HLKTANHSIEIFAMGLIREKDVEAEITKMSSEYDIVAVCGTIKVNIANIPFIDYDSILN
FT                   GSGINRLIKLMEIQFDNKEMLVYERLNKLIYEEFILLNLDCVFKEEVIDKMAELLEEKG
FT                   FVNNKFMLNLYKREAMGNSVFNKEVAIPHGLPENIIRPAIVIAKLNKPIQWDNETAVDI
FT                   VFMLALKEDNREEIKKLFYMVREKNLVNNVRIAQSEKEVKKLFS"
FT   gene            252039..252506
FT                   /locus_tag="Cbei_0220"
FT   CDS_pept        252039..252506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0220"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; KEGG: tte:TTE0181
FT                   Phosphotransferase system mannitol/fructose-specific IIA
FT                   domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32410"
FT                   /db_xref="GOA:A6LPY0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY0"
FT                   /protein_id="ABR32410.1"
FT                   /translation="MELVKFINEKLIKVNLPCKDRNELFKVMHDEAFKYGYVESSFLDG
FT                   LISRESIFPTGIKLNNYSVAIPHTDAVHVKKEFIAIVVPENPIQFKLMEDEKQEEKVNL
FT                   VFMLGLNKPHSQLEVLRELMDLIQREDLVKQIIRATSQEDIENILNKLQSV"
FT   gene            252522..252800
FT                   /locus_tag="Cbei_0221"
FT   CDS_pept        252522..252800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0221"
FT                   /product="phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit; KEGG: lwe:lwe2615
FT                   PTS system, galactitol-specific, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32411"
FT                   /db_xref="GOA:A6LPY1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY1"
FT                   /protein_id="ABR32411.1"
FT                   /translation="MKKRILVACGAGIATSTVVCDRVERLVKENNIDATVTQCKIAEVG
FT                   SLEDHADLIISTTILPREFKIPAIKATAYISGIGTDKLDEKILSYLR"
FT   sig_peptide     252522..252581
FT                   /locus_tag="Cbei_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.922 at
FT                   residue 20"
FT   gene            252876..254150
FT                   /locus_tag="Cbei_0222"
FT   CDS_pept        252876..254150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0222"
FT                   /product="PTS system, galactitol-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, galactitol-specific IIC
FT                   subunit; PFAM: PTS system Galactitol-specific IIC
FT                   component; KEGG: lwe:lwe2614 PTS system,
FT                   galactitol-specific, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32412"
FT                   /db_xref="GOA:A6LPY2"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY2"
FT                   /protein_id="ABR32412.1"
FT                   /translation="MNNLMGVIQYVLGLGPTVILPIAILIIGLVFGIGLKKALKAGFTI
FT                   GIGFVGINLVINLLTGSLGPAAQQMVERFGLKLTVLDTGWPSAAAGAWASPVAAILIPI
FT                   IMGVNILMILTKTTKTLNIDIWNYWHFIAAGATGYILTNNWFFAIFCAVLLEVVTLFIA
FT                   DKTAPMIGSFYDLEGVSLPTASTASFAPLGFLVGYLVEKIPGLNKIKADPDTIQKKFGI
FT                   FGEPMMMGIVIGWVLGILAGYDIGKTFNMGITMGAVMILMPRMVKIIMEGLIPVSEAAR
FT                   EFLQKKYGDRELYIGLDAAVAVGHPAVISTALILVPITIFLAVILPGNKVLPFADLATI
FT                   PFCVAFIVGSRKGNIVHSVITGTIVMAISLYMATDFAPVFTQMLASAQFKMPEGVALVS
FT                   NIDTGGNLLNWLVLKLSQLVQPLFG"
FT   gene            254220..255251
FT                   /locus_tag="Cbei_0223"
FT   CDS_pept        254220..255251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0223"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   lmo:lmo2663 polyol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32413"
FT                   /db_xref="GOA:A6LPY3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY3"
FT                   /protein_id="ABR32413.1"
FT                   /translation="MKALTKTNPGYDQMELLDMQEPKATKNFVKIKVEYSGICGSDLHS
FT                   FKGEYGNIKTPVVLGHEFSGTVVEVGEEVKEIKIGDRVTSETTFETCGTCDYCKSKDYN
FT                   LCPSRKGIGTQVNGSFAEYVLSREESVHVLPDNVSFLAASLTEPLACCVHAALEKTTID
FT                   KDDVVLILGPGPIGLLLAQVVKSQGAKVILSGVTKDKERLEFGKKLGVDVIVDSLQEDL
FT                   EKIVMEKTNGYGVNRAFDCSGAVPAVNQGLRLIKKKGEFVQVGLFANIKNPLDQEAIIQ
FT                   REIKYVGSRSQKPSSWIKSLELMEAKKVDPEALITKIVDLKDWRSGIEAAMEGTELKVV
FT                   IRS"
FT   gene            255275..256093
FT                   /locus_tag="Cbei_0224"
FT   CDS_pept        255275..256093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0224"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   cpf:CPF_0292 putative transketolase, N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32414"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY4"
FT                   /protein_id="ABR32414.1"
FT                   /translation="MNENLKKIANNIRISIIKSVSAAKSGHPGGSLSITDILTVLYFEK
FT                   MNIDPQNPKNPNRDRFVLSKGHSAPALYATLAERGYFSKEELLGLRKYESKLQGHPDMK
FT                   KIIGVDMSTGSLGQGLSTANGMALAGKLDESSYRVYAILGDGEVQEGQIWEAAMSSAHY
FT                   KLDNLTTFLDLNGLQIDGSNDEVMSIGHVDEKFRSFGWNVLTINGHCFEEIVKAIDEAA
FT                   ATKGKPTMIVCNTVKGKGVSFMENNVAWHGSAPNEEQTMKALAELEGGVR"
FT   gene            256093..257013
FT                   /locus_tag="Cbei_0225"
FT   CDS_pept        256093..257013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0225"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: cpr:CPR_0288 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32415"
FT                   /db_xref="GOA:A6LPY5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY5"
FT                   /protein_id="ABR32415.1"
FT                   /translation="MGIATREAYGKALKKLSEDRNVVVLEADLGKATKSIEFKKHAPER
FT                   YFDMGIAEGDMIGTAAGLATCGKIPFASTFAMFAAGRAFEQIRNSVAYPNLNVKIVATH
FT                   AGITVGEDGGSHQAIEDISLMRSIPNMVVLNPADAIEAEKAIFAAKEYYGPVYIRLGRS
FT                   ATPDIHSEDYEFKIGKGEVLLNGEDIAVVATGLMVAKALEAAKKLSEQGINATVVNIST
FT                   IKPFDNELIVDIAKRIGKIVTVEEHSIIGGLGSTVAELLIEEHPVKIKRIGINDEFGRS
FT                   GNAEVLLEKYNLTAAHIVETVKSLL"
FT   gene            257057..257728
FT                   /locus_tag="Cbei_0226"
FT   CDS_pept        257057..257728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0226"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   tte:TTE1498 Pentose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32416"
FT                   /db_xref="GOA:A6LPY6"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY6"
FT                   /protein_id="ABR32416.1"
FT                   /translation="METIISPSLLSANVCNYSDDFKVFNEKNIQVIHIDIMDGHYVPNI
FT                   SIGLDQVASLRKLTDAEFDVHLMVTNPDEFVEALVEAGANSITIHSEVATHLYKSIHYL
FT                   KSFGIKAGVALNPATPISCLEHVYSLLDRVLVMSVEPGFGGQTFIPFSLEKIRKLNDIK
FT                   SENNYGFTVQVDGGINLDNIEDVIKSGARDIVIGSSLFRENLSDNIDSFNQKIIGINNT
FT                   P"
FT   gene            257842..258291
FT                   /locus_tag="Cbei_0227"
FT   CDS_pept        257842..258291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0227"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /EC_number="5.3.1.26"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: lin:lin2811 similar to
FT                   ribose 5-phosphate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32417"
FT                   /db_xref="GOA:A6LPY7"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY7"
FT                   /protein_id="ABR32417.1"
FT                   /translation="MKRMKIALGCDHGGINLKGAIKKHLISKNIEVEDFGTNSSESVNY
FT                   PEYAIKVSKAVISKECDLGILCCGTGIGMSIAANKHKGIRAAVVGDCFSAKMTREHNNT
FT                   NVLCLGERVTGEGLALTIVDTWINSKFQGGRHSERLALVEEIENK"
FT   gene            258399..259928
FT                   /locus_tag="Cbei_0228"
FT   CDS_pept        258399..259928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0228"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: lwe:lwe1891
FT                   phosphoglucomutase/phosphomannomutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32418"
FT                   /db_xref="GOA:A6LPY8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY8"
FT                   /protein_id="ABR32418.1"
FT                   /translation="MLQELKKLQSGTDIRGIAIEYEGAKNLTPNLVNNVGFGFVEWLKK
FT                   TKGLSNKNIKIAVGMDSRLSGPELKKSLIEALVDSGCNVYDCGICTTPAMFMTTILENY
FT                   SCDGAVMITASHLPYYYNGLKFFTKEGGCEKEDIENIIECSNLAEKKCTTKGLVETIYF
FT                   IDVYSNILVDKIRKNVNSKTNYERPLEGTKIIVDAGNGAGGFFAYKVLEKLGASVEGSQ
FT                   FTEPDGNFPNHIPNPENEEAMNSIKEAVLNNKADLGIIFDTDVDRAAIVSSDGKEINKN
FT                   ALIALISSIVLEENPNSIIVTDSVTSTGLSDFITSLGGIHHRFKRGYKNVINESKRLNK
FT                   EGKLSCLAIETSGHAALKENYFLDDGAYLIAKILIKMAKLKDEGKEISSLIENLKYPKE
FT                   SMDMRINIKREDFKSYGEMIIEGLKKYVDHVNGWTIEPKNYEGIKINCDKENGDGWLLL
FT                   RLSLHEPVLPLNIESDSENSINIILERLMPFLRKYEDLNLDNFSNVFFGNN"
FT   gene            260139..260402
FT                   /locus_tag="Cbei_0229"
FT   CDS_pept        260139..260402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0229"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: cpe:CPE1444 putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32419"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPY9"
FT                   /protein_id="ABR32419.1"
FT                   /translation="MNYVYIVECSDRTLYTGWTNNLRKRIQMHSDGCGAKYTRGRGPVK
FT                   LVYYEVFENRKDAMKREYEIKKLTRKDKLALIGTYKAENRYK"
FT   gene            260772..262085
FT                   /locus_tag="Cbei_0230"
FT   CDS_pept        260772..262085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0230"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: cno:NT01CX_0965 hypothetical ABC transporter
FT                   extracellular binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32420"
FT                   /db_xref="GOA:A6LPZ0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ0"
FT                   /protein_id="ABR32420.1"
FT                   /translation="MKTKQILSTILASTLLAGTMVGCGSSSGASSQSSSDAGSGKTIKV
FT                   YQLKVEINDALQELAKKYEKEKGVKVEVTSVGGGADYGASLKAEFQKGTEPDIFMIQGA
FT                   GDYETWKHKIDDLSDQGWVKNAVKGTLDTVTIDGKVYGMPAATEGYGLLYNKDILDKAG
FT                   INPKSLDSFDKLKAAFETLDSKKAELGLDNVVSYTTKEFWVTGNHTFNIPLATQDNPAQ
FT                   FTKDYLAGKADIVNNKQFNDWMNLVELLCKYGGGKNLDTIDYSTQVGNFALGKTAFLHQ
FT                   GNWVAGDLQKLEDPNKKFHMGFAPLAINNDPKMSGSIPVGVPMYWVVNKDSKINKEAKE
FT                   FLDWMVTSQTGQEALVKDMNMIPAFTNFTVESDNELNKSISEYNKEGKTLPWAFTNLPD
FT                   GFNKNSLAPLFSKFINTDMGPQAKKDMLQGIQDATKAK"
FT   sig_peptide     260772..260858
FT                   /locus_tag="Cbei_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.518 at
FT                   residue 29"
FT   gene            262194..263060
FT                   /locus_tag="Cbei_0231"
FT   CDS_pept        262194..263060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0231"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB2569 multiple
FT                   sugar-binding transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32421"
FT                   /db_xref="GOA:A6LPZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ1"
FT                   /protein_id="ABR32421.1"
FT                   /translation="MSKKSRDIKDFWIFVGPALFAMTMVVIIPFIIGIYYTFTNWNGAN
FT                   PHYDFVGIKNYTGIFKDVQFIYSLKITVLYTIVSVITINIIGFGLAYIVTRKLKTSSFL
FT                   RTGFFMPNLIGGLILGFIWQFMFNSVFTGVGKALGSATLSTSLLQAPTTAMLAMLIVST
FT                   WQYAGYIMVIYVAALENVPTDLIEAAHIDGANGWHTFKNITIPMVRQAVTICLFLTLAN
FT                   SFKLFDLNFSLTPMKTTEMLALNIYNEAFIVNNMGIGQAKAIIFFVLVTTISLTQVYFN
FT                   KKKEVEV"
FT   gene            263060..263959
FT                   /locus_tag="Cbei_0232"
FT   CDS_pept        263060..263959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0232"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cno:NT01CX_0967 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32422"
FT                   /db_xref="GOA:A6LPZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ2"
FT                   /protein_id="ABR32422.1"
FT                   /translation="MEPSKVVNNIEKVKANKKLKTLDSYTGRLKLLEVFSWLLLIAYMT
FT                   PFYLMLINSFKTRREIFSNTTGLPDTWNFQNYLDAMKKMSVISSFANSMIITIGSVVLI
FT                   ILFSSMASWMLVRDRSRKSKIIFYIFTSGMIVPFQAVMIPLVKWMAKIQFGPFQMLGTH
FT                   YGLIFMYIGFGVSMSIFLYHGFIKGVPKEVEEAATIDGCSKWQTYMKILLPLLKPITVT
FT                   VAVLNSIWIWNDFLLPFLTINGKINTIPLAMNNFFGAFSKQWELAMAALILAIIPIIIF
FT                   YFFVQKHIIAGIVQGSIK"
FT   gene            264114..265604
FT                   /locus_tag="Cbei_0233"
FT   CDS_pept        264114..265604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0233"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase, family 77; KEGG: cpe:CPE2338
FT                   4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32423"
FT                   /db_xref="GOA:A6LPZ3"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ3"
FT                   /protein_id="ABR32423.1"
FT                   /translation="MNRSSGIIMHIASLPGKYGIGTFGKEAYKFGDFLKKAGQKYWQIL
FT                   PLGPTSFGDSPYQSFSAFAGNPYFIDFDILRQDGFLDESDYYSVNFGESSEDIDYGLIF
FT                   KEKLRVLKIAYEKFKLRQDKDLIKFQEAEAYWLDDYALYMSIKKHFDLKSWYEWDEDIR
FT                   LREPEAINRYKILLEDEIGFWKFLQYEFYKHWNNLKAYINNLGIEIIGDMPIYVAEDSA
FT                   DVWGNPEAFLLNKNTLKPLKVAGCPPDIFAATGQLWGNPIYDWCYMGKTDYKWWVDRIR
FT                   QSLNLYDVLRIDHFKGFESYWSIPYGDLTAENGEWVKGPGIKVFNAIKDELGEVNIIAE
FT                   DLGTLTEETIKLRNDTGFPGMKILTFGFDSDSSNPFLPHNYEKNFIVYTGTHDNDTVRG
FT                   WIEKTAPKEEVQRAITYLGLNKEEGYNWGFIRGAWSSIANISMAQMQDFLNLGNEARIN
FT                   LPSTLGNNWRWRVRKDALTDQLAEKIHQITRTYGRCDN"
FT   gene            265991..266992
FT                   /locus_tag="Cbei_0234"
FT   CDS_pept        265991..266992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0234"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: cpe:CPE0417
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32424"
FT                   /db_xref="GOA:A6LPZ4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ4"
FT                   /protein_id="ABR32424.1"
FT                   /translation="MKVTIKEVAREANVSPSTVSRVISDSSQISEETKERVRDAIKRLK
FT                   YKPNAIARSLANKKSRILGVVLPNEAQDLITNTFFIQAMKGMSKYAQNKKYYITYAFSE
FT                   DEKAELEYINNFITSNLVDGICLLRARTDDRSIKYLKETQFPFVVIGRPEESENLLWVD
FT                   NDNFQATYNLVNELVKKGHKSIAFLGAKKEWNVTKDRFKGFKVACEINGISIHDKNFAI
FT                   MDDFNEQEGIDGTIKLLENITPTAIIAEDDVLAFGTLKVLNERKINNIDVVGFNNSPLA
FT                   ELQVPSLSSVDIKSEELGYYATKILIDFLENNDTAINHYIIDTKLVKRESFK"
FT   gene            267230..268435
FT                   /locus_tag="Cbei_0235"
FT   CDS_pept        267230..268435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0235"
FT                   /product="encapsulation protein CapA"
FT                   /note="KEGG: ctc:CTC00542 encapsulation protein CapA"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32425"
FT                   /db_xref="GOA:A6LPZ5"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ5"
FT                   /protein_id="ABR32425.1"
FT                   /translation="MNDKNSKISHGETYIRDKKKKSDYLKYITFILVTILVLTSSLIYL
FT                   KYREGLSNKKNTANDKVNGETDKSIDDNYKTNQLKEPIKKTIVISFAGDFTLGTDTKFP
FT                   YDGSLPAAFIGSGKNYSYFMQNVSSVFSKDDYTLVNLETTFTDSKDKAHKDGEVFYNFK
FT                   GPKEYVDILTSGSIEGVTIANNHIYDYGKQGINDTINTLKEKNIDICGEGYKILKDIQG
FT                   IKFGFLGYTGWEYSNNLKSKIISDISELRKRGAEVVIPYFHWGVERKYEPDDVQKSLAR
FT                   FSIDNGADAVIGSHPHVIESMEDYKGKFIAYSMGNFCFGGNSNPSDKRTFILQIKVNIE
FT                   DDKLSSLEYKVIPAMISSRNDKNDYIPTLAGGENRAEILGKLNELSPTLNGNIKDEFFK
FT                   IK"
FT   gene            268865..270301
FT                   /locus_tag="Cbei_0236"
FT   CDS_pept        268865..270301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0236"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dsy:DSY3620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32426"
FT                   /db_xref="GOA:A6LPZ6"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ6"
FT                   /protein_id="ABR32426.1"
FT                   /translation="MPKLDVKKLKPKGISLKGMKLKKKPSKKVVLICTIFIIIGAIIIG
FT                   KFLMPKSAPQVKSTVLCKGKIVNSVNVLGEIKSKESTNIYSTLNNPVQELKVKEGDKVK
FT                   AGDVLAVLDSNGLEKDIEQAIATADATEANAKTQLDSAQKEYNDELNLYNNNSNADIKN
FT                   AEETLSLAQITLDDKAKIYDKNKALFNAQAISESDLNKIKIDYDTAKSDYEKAKTALEN
FT                   AKVKVDQALNKAKSDYETAQTNYNNKSQRIAIEKQKQQLDDCTIKATSDGIVTNVNAVV
FT                   GNSGNGVLFQIENLDNIEITVPIKEVDIANVKVGQRAEIKTDATGDETFAGEVESVSPA
FT                   AKKGGGSVPQAQSENSQSQSQGASSDAGFEAKIKVDDTNENMKVGMSARINIITNEKSD
FT                   IYTVASNSIVESGDTKSIYVAEKSSEKPNEYIIKELPVDTGLESDFSVEISGGGISDGI
FT                   IIIDDPSTHKVGEKIRISGR"
FT   gene            270307..271044
FT                   /locus_tag="Cbei_0237"
FT   CDS_pept        270307..271044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0237"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dsy:DSY3619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32427"
FT                   /db_xref="GOA:A6LPZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ7"
FT                   /protein_id="ABR32427.1"
FT                   /translation="MNDNIIEMRNIVKSFYIGTPNQLDILKNIDITIKEGEFVSIVGAS
FT                   GSGKSTLMNIIGALDRPTSGTYILSGTNVGEKTDNGLSEVRNKKIGFVFQTYNLIPRSS
FT                   ALKNVELPMLYYGMGKQERKERAEKLLELVGMKDRMKHLPNELSGGQKQRVAIARALAN
FT                   DPSIILADEPTGALDSSTGRLVMDLFHKVHEMEKKTIVFITHNYELAGETERIITLKDG
FT                   KIVSEEHNDKYTRRFQNGEKLCL"
FT   gene            271035..272306
FT                   /locus_tag="Cbei_0238"
FT   CDS_pept        271035..272306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0238"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dsy:DSY3618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32428"
FT                   /db_xref="GOA:A6LPZ8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ8"
FT                   /protein_id="ABR32428.1"
FT                   /translation="MFIKENIALAIAGIKSSKMRSLLTMLGIIIGISSVIGIVSIGTAI
FT                   TSTVSSQMDKMGANNIDIGIAVKKEDGTASGNGTSKQPEDSDLITMEQINSFNEVFKDK
FT                   INNISVQEQLGQGKVKDGYSYANVSTTGVNEGYKQVKNLKLISGRFITDRDVKANSKVA
FT                   IVSDKLVNNIFKGRTDPLGKEIKVYANDDIQTYVIAGVYQYENSSLFGMGEGSTSEKDR
FT                   RTSLYIPITTEKALQKNKNFEYFTVVPKMGIDKGKLVSDMQKYGNKMYKNNKNWTLMVQ
FT                   NNEADAAEITSVLGMISMGISVIAAIALLVGGIGVMNIMLVSVTERTREIGTRKALGAK
FT                   SSHIKMQFIIESVIICTIGGTIGIILGIGMGIIACIVLKSPISISIPTILISFTFSMAI
FT                   GVFFGYYPAKKAASLDPIEALRYE"
FT   gene            272922..274070
FT                   /locus_tag="Cbei_0239"
FT   CDS_pept        272922..274070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0239"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: cac:CAC0390
FT                   cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32429"
FT                   /db_xref="GOA:A6LPZ9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6LPZ9"
FT                   /protein_id="ABR32429.1"
FT                   /translation="MTLKKSFETIAVSGVSGGDKETGAISFPIYQSATFKHHGLNNSTG
FT                   YDYARAQNPTREEAEKTLAVLEGGKSAIGFSSGVAAITACIHLFKSGDHIILSDDLYGG
FT                   TYRLFDDIFRDFGLEATFVDTTITKNILNSIKENTKAILIETPSNPMMKVTDIKAVAEI
FT                   TKANKLLLIVDNTFLTPYYQRPLELGADLVVHSGTKFLGGHHDLLAGFIVANDEEILEK
FT                   LRRIHMSTGATLSPFDSWLILRGIKTLHIRLERSQENTLKIAKFLEGNPKVEKVYYVGL
FT                   EGFEGYELNKKQSTGFGATLSFRVKEKELVAKILERVKVIRFAESLGGVETLITYPFTQ
FT                   THSEIPEEIKQRLGVDEYLLRLSVGIENVEDLLNDLESAIGK"
FT   gene            274105..275241
FT                   /locus_tag="Cbei_0240"
FT   CDS_pept        274105..275241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0240"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: cac:CAC0391
FT                   cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32430"
FT                   /db_xref="GOA:A6LQ00"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ00"
FT                   /protein_id="ABR32430.1"
FT                   /translation="MNFGTKLIHASGDIDPTTGSVSTPIYQTSTFHQFDIENFGKYDYA
FT                   RSGNPTRDVVEKLIAELEGGECGFAFASGMAAICSVLSIFSAGDHIIICGDVYGGTYRA
FT                   TTKLFSRFNIEFTFVDASNIEEIEKAFKENTKGLYLETPSNPLLKVIDLRTASKLAKEN
FT                   GAITIVDNTFMSPYLQRPIELGVDIVVHSATKFLGGHSDVIAGLVVTKTKELGDRVYQI
FT                   QNTFGAVLGPQDSWLLVRGIKTLKVRLDALQKSAQKLAEWLESREEVEKVYYLGLPSME
FT                   GRELHLEQADGAGAVLSFKFKTFERTKIFLNNVKNVAVAVSLGSVETIVSYPAKMSHAS
FT                   IPKEEREELGITDTLIRVSVGLEDIDDLIESFREAMEK"
FT   gene            complement(275427..275912)
FT                   /locus_tag="Cbei_0241"
FT   CDS_pept        complement(275427..275912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0241"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: cpr:CPR_0493
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32431"
FT                   /db_xref="GOA:A6LQ01"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ01"
FT                   /protein_id="ABR32431.1"
FT                   /translation="MEKENLFKVADSLINFLWIIQSNIFKVQDISKIFQSLHENNKQCC
FT                   SDFSIPPSHARVIFYLFHSNSSPISQIADNIGISKSNMTPIIDNLINYELVNRYPDPND
FT                   RRILRVELTPKAYDLLNSLRNAICSSFAEKISSLSDDEVITLDDSIINLINILKKLK"
FT   gene            276262..277668
FT                   /locus_tag="Cbei_0242"
FT   CDS_pept        276262..277668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0242"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphotransferase system, EIIC; phosphotransferase
FT                   system, lactose/cellobiose-specific IIB subunit; KEGG:
FT                   cac:CAC0154 PTS system, mannitol-specific IIBC component
FT                   (gene MtlA)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32432"
FT                   /db_xref="GOA:A6LQ02"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ02"
FT                   /protein_id="ABR32432.1"
FT                   /translation="METNKSSLKGSVQRLGSFLSGMVLPNIGAFIAWGLITALFIPTGW
FT                   IPNEYFGKMVGPMLSYLLPLLIGYTGGKMVYGQRGAVVGAIATTGVVIGASIPMFLGAM
FT                   IMGPFGGFVIKKVDQFLEGKVPTGFEMLVNNFSSGIFGGIVALIGYTCIEPVVTAFSNT
FT                   LGSLATIVTNMGLLPLIDIFIEPAKVLFLNNAINHGILSPLGIQQAQEVGKSIFFLLEA
FT                   NPGPGLGILLAYTFYGKGNAKQSAPGAIIIHFLGGIHEIYFPYILMKPALILAAIAGGI
FT                   CADLTFVLTHAGLAAPASPGSIFAVLAMTPKGSYVSVLAGVVVGAIVSFLVGSIILKAS
FT                   KDNGEQDIDEAQAKMKDMKAESKGAKASETAANVSKADVKLIVFACDAGMGSSAMGESI
FT                   LKKALKDAGITDVGVKHSSVDSIPQEADVVFTQENLVERARKSARTANIITVKNFLDRS
FT                   KYDEFINTLK"
FT   gene            278207..280258
FT                   /locus_tag="Cbei_0243"
FT   CDS_pept        278207..280258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0243"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: PRD domain protein; KEGG: cac:CAC0155 putative
FT                   regulator of the PTS system for mannitol (gene MltR)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32433"
FT                   /db_xref="GOA:A6LQ03"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ03"
FT                   /protein_id="ABR32433.1"
FT                   /translation="MNNLTPRQQFILSTVLNEGTFNIKRLHKDLDISERTILRELSSIN
FT                   KRLKKNSITIFNDENMNLSISGNKENIEEIKKSLDMVPIPWLLSKEQRQIVIICELLVS
FT                   NEPLKASYFCHKFNVVMGSISLDIDNIEERLISKNLCVIRKRSYGISIQGSEWNKRNAL
FT                   VELFFDFKPFEDLIAFLYDEKVDPIVKTLFNIVFGNEAIQLVKDILKDIDFDYLKGNDV
FT                   KYFSLFIQVLLSIKKTKNGEIIYLPQEIKNSILSLEEYKKIQYLGSVLQKNNIDICEDE
FT                   LVYLCLYLSDYKYFFNNKHLIESDINYENIAKEVTEEISTKIYVDITKDEQLIRDLTQH
FT                   FKQTFYMLNLGLKVINPLINEIKEHYSELYKIIKNTCRLIFSRYNFKIPPEEVGYITMH
FT                   IAVAVQKQQAMSKNIKALVLCPSGIGTARILCSKVKSIFNEINVIDVVSLHDINSIIDK
FT                   NKYDLILSTVPVNLKTKHNLIVVSHFMTEVDIENISNFISNFKASNNERELELFAQTKD
FT                   NTVTNHEYELANTMVKNFQLKKSDSDSFINLINYIVDDIHKIDIGTDKEVIRDLIFKRE
FT                   ENGNVVIPGTHVALIHTRSDTITAPFVGVYRINKPLSMKSIGFSTEDVDTFIVMFARNT
FT                   ESNYILKILGKISVSLIEKKEFVEMLRLSNTIDIRDYLINIINNEEED"
FT   gene            280258..280698
FT                   /locus_tag="Cbei_0244"
FT   CDS_pept        280258..280698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0244"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; KEGG: cac:CAC0156 PTS
FT                   system, mannitol-specific IIA domain (Ntr-type) (gene
FT                   MltF)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32434"
FT                   /db_xref="GOA:A6LQ04"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ04"
FT                   /protein_id="ABR32434.1"
FT                   /translation="MEKGILVKEGIVLNVASESKDKAIERVGKLLINGGYVKDNYIEGM
FT                   KAREEEVTTYMGNGVAIPHGMNEYKKEILETGIVIAQYPNGVDFGEGNTAYIVIGIAGK
FT                   GDEHMEILSKIALTIQYEENVERLRKAKTPEEIMEIIEEGEM"
FT   gene            280700..281845
FT                   /locus_tag="Cbei_0245"
FT   CDS_pept        280700..281845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0245"
FT                   /product="Mannitol dehydrogenase, C-terminal domain"
FT                   /note="PFAM: Mannitol dehydrogenase, C-terminal domain;
FT                   Mannitol dehydrogenase rossman, N-terminal domain; KEGG:
FT                   spt:SPA3538 mannitol-1-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32435"
FT                   /db_xref="GOA:A6LQ05"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ05"
FT                   /protein_id="ABR32435.1"
FT                   /translation="MKAIQFGAGNIGRGFIGALLSKAGYHVVFADVNKEVIDKINEDKK
FT                   YTIHVMDVNCEEIVVENISGVISINDEILDEIKEAEIITTAVGLVVLPRIAPTIAKGIQ
FT                   LRKEAGIKTPLNIIACENAIKASSQLKAEVEKCLSEEEKAYLEEFVGFPDCSVDRIVPP
FT                   VKSENILDVVVEKFYEWNVEEKAFKGSIPAIEGMNLADNLMAYIERKLFTLNTGHAITA
FT                   YIGNLKGYGTIDESIADEKIYNVVKKAMTESGMGLVEKHKFDKEAHFKYIDKIIGRFKN
FT                   PYLKDDVSRVGREPLRKLSDSDRLIKPLMTARGFDLSVDNLLLGVGAALHYNNQEDTQS
FT                   VKLQELIKEKGVKGAIAEVANIDDNDLLEKIEKAYNDVLAI"
FT   gene            282511..284337
FT                   /locus_tag="Cbei_0246"
FT   CDS_pept        282511..284337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0246"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   cpe:CPE2327 glutamine-fructose-6-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32436"
FT                   /db_xref="GOA:A6LQ06"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ06"
FT                   /protein_id="ABR32436.1"
FT                   /translation="MCGIVGYLGSRSAKSFLVDGLSKLEYRGYDSAGIAVVNDGKVSIE
FT                   KHKGRLTNLTDNLGQGKAEGTLGIGHTRWATHGEPSDINSHPHQSSKGDITVVHNGIIE
FT                   NYLELRQWLKGEGYEFVSQTDTEVIPNLIHYYYEGDLFKAVVKATERLEGSYALGVVTG
FT                   AEPDKLIAVRKDSPLIVGLGQDETFIASDIPAIISYTRDIYLLEDREFVVISKDGAKIL
FT                   SADGSEIKKDVFKVTWNEDAAEKGGYDSFMLKEINEQPKAIRDTMASRLSMSHDITFGD
FT                   FKLSKEDLNNIDRIFIVACGTAYNAGLMGRVAIEKLARIPVEVDIASEFRYKDPLVTDK
FT                   SLVITLSQSGETADTLAVLRDCKKAGAKTLAITNVVGSTISREADDVLYTMAGPEIAVA
FT                   STKAYTTQVVVMYMMAMYFSELKGLMTKELEKELKEALLLVPEKVQVILDKASEVEEIA
FT                   NLLTDETDVFYLGRGADYALSIEASLKLKEISYIHSEAYAGGELKHGTIALIEEGTKVI
FT                   ALLTQKSLREKMVSNIVEVKARGAEVIAIAYENDVLDESIFDKVIRIPELLNLVSPIVA
FT                   VVALQLLAYYTARNKGCDIDKPRNLAKSVTVE"
FT   gene            285666..286319
FT                   /locus_tag="Cbei_0247"
FT   CDS_pept        285666..286319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0247"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   mta:Moth_2485 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32437"
FT                   /db_xref="GOA:A6LQ07"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ07"
FT                   /protein_id="ABR32437.1"
FT                   /translation="MKEDLKAILDRDPAARNILEAILCYPGFHSIILHRIAHKLYRLRF
FT                   KLLARIISMINRFVTGIEIHPGAKIGKGVFIDHGIGVVIGETAEIGNNVTIYQGATIGG
FT                   TGKETGKRHPTIGNNVVISSGAKVLGPFRVGNNSKIGAGAVVLKEVPDNSTVVGIPGRI
FT                   IKRKRKKNKLCEKISIDLDQVSLPDPISDQLKSFEERLEKLEKMIEDLIIKKVI"
FT   gene            286746..287459
FT                   /locus_tag="Cbei_0248"
FT   CDS_pept        286746..287459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0248"
FT                   /product="Oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /EC_number="3.1.2.14"
FT                   /note="PFAM: Thioesterase; KEGG: bcz:BCZK1713 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32438"
FT                   /db_xref="GOA:A6LQ08"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ08"
FT                   /protein_id="ABR32438.1"
FT                   /translation="MENIRLFCLPCAGGSSQMYSGWKKYLNECIILHNVELSGRGTRFG
FT                   SDLYNCFNDAVDDVYNSIKDYLDKGPYAFFGHSMGGWLVYELACKIKEEHHTSPAHIFI
FT                   AAQEAPHILQDRHFFLHKLPMNSFKNEIIKLGGIPKELCENKEIFDFYLPIIKSDYKIT
FT                   ENYVWRERKDKLDCDFTVLYGNKDNIEIDKVLKWCELTEKESKTYSFDGGHFFIVEYVE
FT                   KVTDLINYRLVNNIN"
FT   gene            287536..288549
FT                   /locus_tag="Cbei_0249"
FT   CDS_pept        287536..288549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS2541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32439"
FT                   /db_xref="GOA:A6LQ09"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ09"
FT                   /protein_id="ABR32439.1"
FT                   /translation="MINIKNNEIKRKISKKIYWSPSVFWEILDNKLKIEMFLYDEFAMN
FT                   LFPEFFFLTQRGIEVNNLLNEFPEVDQKRLNLLIKDLIKKRILVSNLLTPQEVFFPQSR
FT                   IFETEYGDELLYDANALKEFKKKQLNRTFEASIDKKIYFNDNFEFPENIADRKSYRKFD
FT                   EENKISFDDFSKMISIFKQIRNENETRYYYASAGGLYPIDVFLYIKKDRIENINQGIYY
FT                   YNPNENCIQLVNDHSIISEEAHLFFNKDIFKSSAFSVYLIYNVDANMAKYKSDGYFYAC
FT                   LDAGIMISALTQAAELVNVGLCSIGEMSFRKIEKYFKLNERQIYLHTIEGGLKPLE"
FT   gene            288600..300704
FT                   /locus_tag="Cbei_0250"
FT   CDS_pept        288600..300704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0250"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; phosphopantetheine-binding; Non-ribosomal peptide
FT                   synthetase; KEGG: bat:BAS2540 AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32440"
FT                   /db_xref="GOA:A6LQ10"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ10"
FT                   /protein_id="ABR32440.1"
FT                   /translation="MLTKKSLSKVLQDKVSVSHRGFTVIDDEKKEKFISYQDLFTTSQK
FT                   VLFNLQVQGFKKGDEVLFQVEREEDFIYFSWACILGGMVSVPLSCNNTHENIMQVSRVW
FT                   KILQKPKLISTKEQLKSIVDILNNENCGDIADEIKQNTLLDKDILVSNGIGEIACGDIS
FT                   DTAFVVFSSGSTGEPKGIVLTNEKILCAIESMSSHLDVNSSDVFLNWMPLTHVIGLVLF
FT                   HVLPVAYDLNHVVMSKNLFIKNPVLWLEKADQYKATIMISPNIGFRQFLNCFDSNTINM
FT                   NLSHVRTIMVSAEPISGDLSEQFMTVLSKFGIRKNVLSNLYGMSESCLGITCTLPSEDM
FT                   KYNCLNRNFLAVGDKIKYGQPGDEDCSIFVNSGTPIKDCFVRISDDTGNILGDDCIGHV
FT                   QVTGKNIINNYYTEEATARSFTSDGWLITGDIGFLENGHLTITGRAKDMIIVNGQNFYV
FT                   NDIERVAEGIEQIEFGKVAACGIFDSKSQSEKAVIFVENNEPIDEFVSLLLKIKNELSY
FT                   KMGIEISRVIPVREIPKTGSGKIQRYKLAKEYNSGIYDEIQEDLDVFIDKHLSENVGSK
FT                   AESYLQEKLLNICREVLHYENIGIDHNLFDYGLHSITMAGIVGKVNNALNYDLNFADFI
FT                   SNQSVRELEKVILKKSNKKINELYPECIPNPKEMYEPFPLTGIQEAYLIGRNEDIEMGG
FT                   VCTHFYQEIETEYEISLLNSCLQKLIKAYPMMRAVITKTKSQKILEKVPEYKIEEVDLR
FT                   HLNKTEQQEAISSERERMSHYVFETDKWPLFEFKSFKLTDDRNYLFVSYDLIIADAASI
FT                   LNIGKSLVDLYKSPDTKICTPEFSFRDYVISYNDFKQSDIYKRDHDFWQKKIADFPYSP
FT                   ALPYKTSPENIRKPRYERIGKRFSSNQWAKIKSIAQGKRITASSVLCTTFMQVLSNWSN
FT                   QKDFAISLTSFNALPFHKDVSSILGDFTSVLPLEVHFDSNNSLWDRCIKVQNEIMELLE
FT                   HRNYDGIDVIRDISRYKNIGIGKAVLPIVFSSILFEEGRFGWSEIGEIKFSVSQTPQVF
FT                   IDVQVMEDNGELSVTWDYAEELFDKTIIEKMFEQYVWMLEEIVQGEESHCLTIGEEEQK
FT                   IVQEYNSTSEAIPEKTLHGIFVEQVSENPENVAVIYENESITYEELDKKSNQIAKCLNE
FT                   HGVIRGDYIGVLAYRRIETIVNILGILKAGAAYIPLNPDHPEDRRDYILENAGAKMQLV
FT                   PETYEEKEIYKYDDRKLENNIHPDDIAYVIYTSGSTGRPKGVVIKHKAAANTIIDINNK
FT                   FNVNEEDRFIGLSSMCFDLSVYDIFGALSSGAALIMINDQRDVKNINEIIEKHGITIWN
FT                   SVPAIMDMLLDSIGIKDEVEIDYRQSSYKNEVAVEYSNYSDSDSLRLVLLSGDWIPLTL
FT                   PEKIKNQFSDAEVISLGGATEASIWSIYYPIEEVRREWKSIPYGMPLSNQSFYVLNYEN
FT                   QICHIGVMGELCIGGLGLAEGYLNDEDKTTESFINHKELGRLYKTGDYGVLHKEGYIEF
FT                   FGRKDQQIKINGYRLELGEIENCILEYEGVRNSVVVDRTHDNGRKYLCAYIVGEKEIST
FT                   TELREYIVELLPDYMVPSYFVMVDEIPLTANGKVNRKELPEPEVSVETEEEYAAPTNEI
FT                   EVKLTAMWQDLLEVDQISINNSFFELGGNSVMMVQIITKIDKEIGVEINFREFLKENTI
FT                   AKLARLILSKGVSNIGKVVYPEIIPDIEKVNEPFPLTGIQMAYLMGRDDKFELGGVSTH
FT                   VYIEYETKLEAERFNKSINKVISRHPMLRAVILPSGQQKILDEIPEYKMEIVDLRHMDS
FT                   KDQEVYILKEREEKSHQVFKTDKWPLFEFKMFRITDETNYLFFGLDMLIADGASILMIF
FT                   NQIMKHYENPELNVPEIKCTFRDYMLAYNDFKNSEIYKKDKEYWIKQLDSFPQAPVLPY
FT                   KTDPSNVGEPHFDRCYKSFNREEWNQIKRKAQESSITPAAVLCTAYAQVLGYWSNQDRV
FT                   AINSTVFNRYPFHEDVNRIIGDFTSVMLLGIDLKIGSTFWEKAKYVQDVFAEALEHRHY
FT                   DGIEFIRDLTKYHNLGNKAVMPIVFTSMLFGNSVDVAESGTNAFGNVKMSVSQTSQVFI
FT                   DQQIIEVDGGVTITWDYVEQLFDKEMMNNMFEQYIGILEEVSSRNENYCLTIKEKDQKL
FT                   LDEYNSTSEAIPEKTLHGMFVEQAAENGESIAVIYEDETITYEELDKKSNQIAKYLNEQ
FT                   GVIRGDYVGVLAYRKIETIVNILGVLKAGAAYIPLNPDHPEERRNYILENASARMQLLP
FT                   ETYVEKEISKYDIKKLKNNIYPDDIAYVIYTSGSTGKPKGVMVKHKAAANTIIDINNKF
FT                   NVNEEDRIIGLSSMCFDLSVYDIFGALSSGAALVMINDQRDIKNINDVIKKHDISIWNS
FT                   VPAIMDMLLDNIGIDYGTEVDYRQSSYGNEVAVDYSSYSDNDSLRLVLLSGDWIPLTLP
FT                   EKIQNKFSNAEVISLGGATEASIWSIYYPVEEVQMDWKSIPYGIPLANQKFYVLNYNKD
FT                   ICPVEVIGELYIGGDGLAEGYMNDEEKTNNAFINHPDLGRLYNTGDYGVLHREGYIEFF
FT                   GRKDQQIKIRGYRVELGEIQSGILEYKGIKNAVVVDKTHENGRKYLCAYIVGEKEVSIT
FT                   GVREYLEELLPDYMVPSYFVMVDEIPLTANGKVDRKALPEPDGNVELGTAYAAPTNEME
FT                   NKLAVIWQSLLGLDQVGINDGFFELGGNSVMMVQMITKIDREIGVEINFREFLEKNTIA
FT                   KLAGLISSRYTSNGSASSTVKIVYPEIVPDKEKMYEPFPLTGIQMAYLMGRDDKFELGG
FT                   VSTHVYTEYETKLEEERFNNSINKIISRHPMMRAVILSNGQQKILDKVPEYKMEVVDLR
FT                   QLDSKDQEKYILKERKQKSHHVFKTDEWPLFEFKMLKLTDETNYLFFGLDMLIADGASI
FT                   LMIIHEIMKYYDDPKLNLPEINCTFRDYMLAYNDFKNGEVYKKDREYWLQQLDSFPQAP
FT                   VLPYKTDPSNIGQPHFDRCYKAFNSNQWNKIKGKVQENGITPAAALCTAYAEVLGYWSN
FT                   QDRVAINSTIFNRYPFHGEVNSIIGDFTSVMLLGIDLKIGATFFEKAKYVQNVFAEALE
FT                   HRHYDGVEFIGELSKYHNIGNKAAMPIVFTSMLFGNTVDIGESATNTFGDVKMSVSQTS
FT                   QVFIDQQIIEVDGGISITWDYVEQLFEKDLIENMFEQYIGILESIIEEKEYRLEAKSSD
FT                   LEVINEYNATEQEIGKETLHGLFIKQAEKTPNNIAVMFEENTLTYKELDEKSNKVANFL
FT                   KEKNIGRNDYVGVIAERCIESIVNILGVLKAGAAYVPINPEHPEDRRKYILENSNCKME
FT                   LLPDSYKKDNIASYSNERVYTKEYPEDMAYVIYTSGSTGKPKGVIITHKAAANTIIDIN
FT                   QKFDVNEEDKIIGLSSMCFDLSVYDIFGALSSGAALVMIEDQRDVKNIQKVIDNNGITI
FT                   WNSVPAIMDMLIDNMSEDGDSDEVDYWNSHNSGNLVEYNANESLRVVLLSGDWIPLTLP
FT                   EKIKDKFADAEVVSLGGATEASIWSIYYPIDEVNEEWNSIPYGMPLANQKFYVLNYEKE
FT                   VCPIGIAGELYIGGEGLAEGYMNDEEKTNNAFINHPDLGRLYNTGDYGVMSREGYIEFL
FT                   GRKDHQIKIRGYRVELGEIENRILEHQSIKNVVVIDRSHSNGRKYLCAYVVSDVDISVG
FT                   ELREHLGKTVPDYMIPSYFVILDKIPLTANGKVDRKALPEPEVDSLETGVEYVAPNSGI
FT                   ETKLAEIWQNLLNAEQVGINDNFFELGGNSVLLVKMHKQLEQEHPNKIKIVDVFSHPTI
FT                   AKLAQLLEKIEEKKRDLPIYPLQMPVEFFTVDSGLEDQFYQLSIEGRLFEKLELISKNE
FT                   HVSKYDILFALYSNLIAQITENNQIEIQTLFRENFVYSLGLSLEKVDDFSELLKIIKEK
FT                   MSQIEPKRLFEVKDLNSYQGKKQAMSSALLLFYDNSLLTEQINLVDFYDLILEVEENES
FT                   NMIISCSYNNFKINSKKVGELVSQYNQIIELLVENY"
FT   gene            300965..304642
FT                   /locus_tag="Cbei_0251"
FT   CDS_pept        300965..304642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0251"
FT                   /product="Erythronolide synthase., Aspartate racemase"
FT                   /EC_number="2.3.1.94"
FT                   /EC_number="5.1.1.13"
FT                   /note="PFAM: condensation domain protein;
FT                   phosphopantetheine-binding; Beta-ketoacyl synthase-like;
FT                   KEGG: smu:SMU.1343c putative polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32441"
FT                   /db_xref="GOA:A6LQ11"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ11"
FT                   /protein_id="ABR32441.1"
FT                   /translation="MNLDILTLKSNKADDRTQIESISSKDIAIIGIAGKWPLANNVEEY
FT                   WENIKNGKDCIQNFPYSRKKDIEPFCEKNKEYFECGFLNEIDKFDYSFFHISPKDANLM
FT                   DPHHRLFLESAYEAIEDAGYGGKKIIGTNTGVFVGMSDLGDIQYIDLINKSEPEFLVQA
FT                   LSSNTKAILPSRVSYTFDLHGPSMLIDTACSSSLVALSTACKSLRENECEMALVGGAKA
FT                   YLLPLKERPMLGIESSDARTRAFDESSDGTGVGEGTMAVLLKPLHKALKDRDHIYGVIK
FT                   GIAINQDGRSIGISAPNPVAQADVIEKAWKDARIDPTTINYIEAHGTGTKLGDPIEIDG
FT                   LTKAFSKYTDLKSFCAISTVKSNIGHLYDLSGLSSLIKVIMEFKYKELAPSIHFNVPNQ
FT                   RIDFERSPVYVNDKLRKWEAVDSVRRCGISSFGFSGTNCHVVLEEAPKTVNSICPAKST
FT                   EVLAVSAKSQEVLIELLKSYLGYLEKDKTINFHDFCYTANTGRGQYECRVVFLPKDQAE
FT                   LIDLLKNCIKKQPLDDEQTKKLKKIFFGSYNLLSGKNVSKSGNYISNNEKLQFSEEANS
FT                   KLKYYNTVKKEDISILQSVCDLYIKGGDVNWDELYRGEKRSRVSIPVYPLKRERCWLDM
FT                   PNKKYNVGMSNINGLLEVENLPDEARKKIAMILKEYEINEKQDESIDEHLKVVLAGRED
FT                   GMYTETEKILAKIWYKVLGANKINIFDDYLELGGDSISGAKIVNLVNSKMNKNIAITNL
FT                   MENRSIIDFAQYIDSELSESSLPDILPIEEKQYFPVSSSQKRIFITSLMSKNVYNVPGV
FT                   LILEGKIDFNKFKDTLKRVADRHEILRTTFDYKEKKIVQLVHEEAVISLEWHEVKENNI
FT                   DEIIKSFIKPFDLKQLPLFRFHILKVDEQRHYLFYDFHHIITDGTSHGVFLNDFIHLYS
FT                   NLPLPEITIQYKDYAFWQNKILNENHLKKQEKFWLKRFSKQNTLLQLHYDYTRPDIRSY
FT                   KGKNSFFTINKDLKSRLKQFAYENNCTLFVPLLSAYSILLSKNSGQDKIVIGTPVAGRQ
FT                   NKKLENLVGVFINSVAIVTKPKAGYLLADFVKKINKEVLKVFKNQEYPFDILVEKLGWH
FT                   NNPSRNPLFDTMFQYQNMVMPKMNCTEVKVDRYEIENEIALFDLTLEIIEHDSVLNCRF
FT                   KYCRDLFKSETIDRWREEYLEILNYIVENKELKLEQLVSDKHDDSIGDLKLDCVEFNFD
FT                   "
FT   gene            304777..306954
FT                   /locus_tag="Cbei_0252"
FT   CDS_pept        304777..306954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0252"
FT                   /product="Male sterility C-terminal domain"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   phosphopantetheine-binding; Male sterility C-terminal
FT                   domain; KEGG: smu:SMU.1339 putative bacitracin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32442"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ12"
FT                   /protein_id="ABR32442.1"
FT                   /translation="MSKIEVNCNKSINKFVGFKSFVNESNKPSMLTERKCIAKSIPISV
FT                   SEMIRKIANRSQLGIYMILLSGVEFLAYKYSDLTDGILGMPVNGKNFSNISENRMVPIR
FT                   YKLDTHWTYKDMLTNVKKTVSENLECQTKNSIQDEFSYCKTIIVLENIHQVSEEDLKGI
FT                   DTVFSFKAEENEILIKLEYIDGLNIELAENLLNQYINFLTIVTNQPNICISKIDLGTKS
FT                   ESWVLDEKNTIDSYVEPRTEVEWTIARVWGDILGIEKVGVEDNLFELGASSYTIVQIAM
FT                   ELSSDFIFDINDIFEFPTISSLANRVKYKKDNWKTLMKQNKELAYTARQNKESKYVLEN
FT                   DMEIYKNNVLKYEDVDVETKNNYQHILLTGATGFLGIHLLHDLLTNSQYELYLLVRGNT
FT                   KSDAEKRLEELYKYYFGNGFNSVKERVHIINGDLAKDNFGVSKEEYNKLSDTIDCIINS
FT                   AANIKHYGLAEDFYSINTDGVKRLIEFSLKGNKKDIHQISTGGVAALAERTDYYLFTEY
FT                   VDELECKLNNIYLKSKYEAERLIIQAREKGINGNIYRVGEIFYNKRTKKCQKKYEEIGI
FT                   YRLIKSFIQLGVIPNDKNKYMDFSFVDYVSEAITLIFDKKNILNETFHLYNSNYICLDE
FT                   LGDFLVEEGINLNRLEFSTFYETLFQENGDIEINNDLLAILLFLHPSRMLTLLQCGKTT
FT                   KILEKFNFKWPVVQQDDIHTMMEIFKQIEFI"
FT   gene            307058..308176
FT                   /locus_tag="Cbei_0253"
FT   CDS_pept        307058..308176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0253"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: mja:MJ1657 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32443"
FT                   /db_xref="GOA:A6LQ13"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ13"
FT                   /protein_id="ABR32443.1"
FT                   /translation="MKYFSIPADFINDTIDKYNELNNIYEDSKLIETYGQLTDFGEFNK
FT                   IGSGRSLRILPQVDMKELEKYVKYSLDKKIKFNYTLNSSCMGNNELSKSGMNQLYNFLK
FT                   ELSNIGVTSLTVAMPSVIELINTFGFDFKIKTSAICQVSSANKALFYKKLGVERVVIDE
FT                   DISRKFDSIKEISSVFGDGVEVIVNSLCMKNCAYKMFHYNHESHNHEEISNKASGYYYN
FT                   RCIYQISKDIRNPLKLNWIRPEDLKHYTNIGVNYFKIQGRQSVHKGNPVETLKCYFEEN
FT                   YNGNLIDLFTLFRKDNNYESNLPYIDNKSLNGFLEPFLNKNFCKENCSSCDYCLKYAEK
FT                   AINIAQAEDLNRQIQEHHKISDSYINMLKEVY"
FT   gene            308234..309694
FT                   /locus_tag="Cbei_0254"
FT   CDS_pept        308234..309694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0254"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vch:VC0249 RfbL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32444"
FT                   /db_xref="GOA:A6LQ14"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ14"
FT                   /protein_id="ABR32444.1"
FT                   /translation="MEQTLISVVMKHTIRFPSKIALIVNNKKITYGELGQSILNAAQIM
FT                   REYGVCPGSRVILSATPSPAFVFGYFATHILGAIAIPVDPQISDKNLNMIIEETNAKQL
FT                   FLAKGKTASSISIEELMLPAIYNDKEFNVIPVGEDVADILFTTGTTSRSKGVVLTHKGI
FT                   LSAAQNINQFIGNTADDREIVPLPLSHSFGLGRLRCNMLVGGTIIMCESVANIKNIFDN
FT                   MKIWKATGFVSVPAGFALLLKLSGNKLGEYAHQLKFIEIGSAPMEMKMKQRLMELLPNT
FT                   RICMHYGLTEASRSCFIEFHRDKEKLTSVGKAAPNVKVKIMDENKNDLSSGSEGSIFVS
FT                   GDHVMKQYLNKPELTSHILNDGWLDTGDYGKLDDEGYLYLKGRKKEIINVGGRKVSPDE
FT                   IEEYLNEIDYIKESACVGVSDPLGISGEIIKAFIVLDEKKVNAFSKTQIIAYLRNRVEP
FT                   YKIPTQFEVIEKIPRTSSGKMQRQLLKV"
FT   gene            309974..310747
FT                   /locus_tag="Cbei_0255"
FT   CDS_pept        309974..310747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0255"
FT                   /product="BAAT/Acyl-CoA thioester hydrolase-like protein"
FT                   /note="PFAM: BAAT/Acyl-CoA thioester hydrolase-like; KEGG:
FT                   cac:CAC3407 acyl-CoA thioesterase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32445"
FT                   /db_xref="GOA:A6LQ15"
FT                   /db_xref="InterPro:IPR014940"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ15"
FT                   /protein_id="ABR32445.1"
FT                   /translation="MKWRKAMEYRTEELYGDFYENDEKPLVIVIGSVQPGIPIISKELL
FT                   EYLKSKFNVLLLAYFGVGDLPKRLERIPLEYFIKAINHFKNKLNLNDEDIVLMGSNKGG
FT                   ELVLLLISKYINPSVAIACVPSCYVWQAIPKGIMNILIPKSSWTFKNKDIPFVRFRYNR
FT                   EVINDIKNKKYNSSHLFSIQTNKNKNALIKVDQYKGRLLLISTEKDHYWPSKGMCEFIE
FT                   KSRKGYTKHIVFNCDGDQLLKYKEPSMEIMDFLEL"
FT   gene            310972..311670
FT                   /locus_tag="Cbei_0256"
FT   CDS_pept        310972..311670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0256"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   cth:Cthe_0737 phosphopantethiene-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32446"
FT                   /db_xref="GOA:A6LQ16"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ16"
FT                   /protein_id="ABR32446.1"
FT                   /translation="MFSIYCVSIKNFKEEDKLVYLLRYISKEKADKLMKFRKIDDRKRG
FT                   LISEILARYFICDMLKVKNSEIILSTNKYGKPFVKNYSQIEYNISHSNEFIVCAIGNQP
FT                   VGIDIEQISNIDLILSKKVFSVQEYEAFRKIGNSKKREYFYLLWTLKESFIKAKGFGLY
FT                   MPLNSFNINIVNENNIYCLYEDNKYYFKEYKLDPCYKLSVCSNKKEFPKRIEIFDFEEF
FT                   YNLVDCNLVQ"
FT   gene            311848..313116
FT                   /locus_tag="Cbei_0257"
FT   CDS_pept        311848..313116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0257"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: cac:CAC3575
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32447"
FT                   /db_xref="GOA:A6LQ17"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ17"
FT                   /protein_id="ABR32447.1"
FT                   /translation="MRDYAILLPGQGSQYIGMGKELYDGYGIVRKIYDDANEILNFNIR
FT                   DLCFNGNIEELSNTENAQPAILLAGVAAFKVFMEEMKKKPKFICGHSIGEITALTCSGA
FT                   IKLENAIKIVKKRGELMGMASYNKKGIMAAIIGSNLEKIQAICKTTTDENDYVGIANFN
FT                   SYDQIVISGYEKSVKSVISKLNEMNEDGIILNVKGAFHSPLMEPVVEEFKEELEKYEFN
FT                   DIDINVISNVDALPYIDKNEIKQKLVNQIVNPVKWIQTMEYLKRNGVDCAVDLGPKSIV
FT                   KNLLKKSELNIKSYAFEGGKDEAIEYLTRGEKKNHNSVNDYMNTIVTKCIAIAVCTQNK
FT                   NLNDAEYEDGVVKPYRKMKEMQGNIEKENRKPSKEECLESMNLLKNIFETKKTPIEEQT
FT                   DRFSEILQVTSNKDFNVSINEIN"
FT   gene            complement(313653..313924)
FT                   /pseudo
FT                   /locus_tag="Cbei_0258"
FT   gene            complement(314078..314692)
FT                   /locus_tag="Cbei_0259"
FT   CDS_pept        complement(314078..314692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0259"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: smu:SMU.134
FT                   putative transcriptional regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32448"
FT                   /db_xref="GOA:A6LQ18"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ18"
FT                   /protein_id="ABR32448.1"
FT                   /translation="MELNKAIRIPKQKRSIITNEKIIKTAFKLFCEKGYYKTTTNEIAK
FT                   IAGVSIGSFYSYYKDKDTIFMKILDDYNKLFLEINNESELAINLYKSDKKKWLQKLINK
FT                   ILNIHESSKQLNKEIKILSYSMPEIAEINKKHHEIIIKVILEYLHMCKNDIKISDLYVA
FT                   SIISYNIISSTVDHIAFEETIISRERLIEATVEAVYKFLFK"
FT   gene            314846..316297
FT                   /locus_tag="Cbei_0260"
FT   CDS_pept        314846..316297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0260"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   chy:CHY_0588 drug resistance transporter, EmrB/QacA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32449"
FT                   /db_xref="GOA:A6LQ19"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ19"
FT                   /protein_id="ABR32449.1"
FT                   /translation="MSKIESNKMAFTLLALAIGTFMSALDSSVVSIVIPVIQKYFNVNI
FT                   AFVEWVITAYLLVVSSVLLTFGKLSDLYGHKKIYLMGFTAFTLGSFLCGISLNIQMLIV
FT                   FRIFQALGAGMMFSTSSAIITASVPSNKRGKSFGIIAIAISAACCAGPVIGGILASMMG
FT                   WQSIFYINIPIGILGIYLSYRYIPEDKKKISVPFDLGGAVLIFITLFLILLPLDLSGSE
FT                   SISTTMFIILIVLGIALGVLFIVYEGKTNYPLLNLNLFKNKTFSAGLIATTFNYMAQFI
FT                   MAFLVPLYFQNTLQLSPMMTGVLFLPMPVSSILIAPISGSFSDKHDSRIMSSTGMGILA
FT                   IALFMLSFLNMGTSSWYIVIAMILSGVGSGLFQSPNNSAVMGSVPAQHRGVASGTLSTM
FT                   RNLGMVMGVAVSGALFSYSTNYANSIYSTQGLNGVNLSQAVSTYGLRITFTAAAIIALA
FT                   AMVASLIKGKTTTVAEAKSNIPSNN"
FT   sig_peptide     314846..314929
FT                   /locus_tag="Cbei_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.588 at
FT                   residue 28"
FT   gene            316679..318118
FT                   /locus_tag="Cbei_0261"
FT   CDS_pept        316679..318118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0261"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dsy:DSY3620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32450"
FT                   /db_xref="GOA:A6LQ20"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ20"
FT                   /protein_id="ABR32450.1"
FT                   /translation="MKKLLINKSIINKPDDNYNDLNSSSKKRFSIKTNKKLIVILVVLI
FT                   AMGIGTKIAITLLADQGLEKSKYTVLQAGGNITKVNYKGEVKSENSTNVYSNLSIPIKE
FT                   VKVELGDKVKANDVLAVLDTNKLEKQINELEATISTADASNKVELANAESEYNTALTQS
FT                   NDENNGDIKNAEVALEGAKLDLENKKKIYENNKLLFENGAISKQDMDTYEISYKNAQNT
FT                   FDNCTVSLKNIKTKVQQNLTTAKNKYDEARVKAEDKSQHVSIENLKNDLKDAVIIAPVD
FT                   GIITAKNASVGNPSTGALFEIKDEDNTTVRLDVKEVDIEKIKVGQKAEVKTDSTGADII
FT                   NGEVVSIQPIAEAEDKSSLTLNNDSNDEEAKFEVKIKITDTNYKLKIGMKAQADIIVDE
FT                   KDGTYTVPIESIIKDKDNNDCIYIAEKQEKDYVVKQIRITKGAETDINAEISGKDIKDG
FT                   LIVLNSPSDYEIGSIIKINGR"
FT   sig_peptide     316679..316858
FT                   /locus_tag="Cbei_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.568 at
FT                   residue 60"
FT   gene            318130..318828
FT                   /locus_tag="Cbei_0262"
FT   CDS_pept        318130..318828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0262"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dsy:DSY3669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32451"
FT                   /db_xref="GOA:A6LQ21"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ21"
FT                   /protein_id="ABR32451.1"
FT                   /translation="MFLEVRDAKKAYGQGDIKVQVLNGVNFNLEEKKICTILGPSGSGK
FT                   STILNVIGGLESIDSGDVTVDGITTSSLNSKDLAFYRRDKLGFIFQFYNLVPNLTVKEN
FT                   IEVCEYLTKTPLDIEELLKTLGLCEHQDKFPRQLSGGQQQRTAIARALIKNPKLLLCDE
FT                   PTGALDYKTSKEILELLESVNRKYGTTMIIVTHNDAIKYMSHKVVKVRDGIIEDEYENE
FT                   AIMEAKDITW"
FT   gene            318869..321079
FT                   /locus_tag="Cbei_0263"
FT   CDS_pept        318869..321079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0263"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cac:CAC1534 predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32452"
FT                   /db_xref="GOA:A6LQ22"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ22"
FT                   /protein_id="ABR32452.1"
FT                   /translation="MVLNKRILREFVGNVSKYSGLTILILISSMLIVGFSNSVDCIMST
FT                   CQNAALQNNLEDGEFYVKSELSDMTLEKIKSLGVDIEENFYVDYKLFENQTIRIFKDRK
FT                   NINKISIKKGNNLNGSNQIVIDEHFGEANDYKILNNLIIEKKNFKVVGYATASDYTRII
FT                   KKTSDLTPTPKNFGIGFMNEEDFKNLRDKSYSYVFKLNGVPVDKVKNIVSNNSTVTEFI
FT                   KISDNSRAIGYIDDIKVNKNMSILMGFVICIMIAYMISMMIINTIDEESAIIGALYSLG
FT                   YVKKEIVKHFMILPTIIVSIGAIIGTSLGFVIKDLLEKATTNTYSMPNITRIYPPYLIF
FT                   IGVIIPILIVIIVNYFIISKKLNSTPLQLLRKEKKASKLNNVKINHFSFITKFRLREFL
FT                   REIRGNIILFCGIFFATFGLAFGVCIYRTGDDYVKIIQDQINYNYMYILNRPIEVTENK
FT                   GLEKITSKGLSIYSKDIEMDMDVILQGINEHSNFYSFSIPENDSGLYISDSVQGKFNLN
FT                   VGDIITLKDKGENKIFNLKIKGVVKYKSGLNVFMNRSQLNRLLKEDKYYFNGYLSKNKL
FT                   DINDDYVNSEVTYKNTIKSAQDNTYNMYPTIAFIVISSSAILIISMYLLLKAMVDKSIS
FT                   SISLVKIFGFNQKEINKLYLGSLLYTVLFSIVISIPISVKIIKLMYPGMTADVQAYYSI
FT                   SLEPKDYCLVVIMVMVGYFISDVLLKRHIKTISLSEALKNRD"
FT   gene            321201..321362
FT                   /locus_tag="Cbei_0264"
FT   CDS_pept        321201..321362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32453"
FT                   /db_xref="GOA:A6LQ23"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ23"
FT                   /protein_id="ABR32453.1"
FT                   /translation="MYAKSNLIKRRQNMGKNINKLVTLAIGISVMSGSVIPAFADDEVQ
FT                   NVATVTNV"
FT   sig_peptide     321201..321323
FT                   /locus_tag="Cbei_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 41"
FT   gene            321510..321644
FT                   /locus_tag="Cbei_0265"
FT   CDS_pept        321510..321644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32454"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ24"
FT                   /protein_id="ABR32454.1"
FT                   /translation="MTSGYKKDLNSDTRDNTLNQLKQQRDFDEDSLTQQTTTEYNGYL"
FT   gene            321631..321885
FT                   /locus_tag="Cbei_0266"
FT   CDS_pept        321631..321885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32455"
FT                   /db_xref="GOA:A6LQ25"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ25"
FT                   /protein_id="ABR32455.1"
FT                   /translation="MDTYDKVINGYTGVLSARLACLNSKSDVYKQLANLDQNKKQLKNQ
FT                   LKTLYTNLLTTEDSITTLKKNIDLNNKRLVMQNLNMTWR"
FT   gene            322475..323302
FT                   /locus_tag="Cbei_0267"
FT   CDS_pept        322475..323302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0267"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: fnu:FN0219 autolysin response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32456"
FT                   /db_xref="GOA:A6LQ26"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ26"
FT                   /protein_id="ABR32456.1"
FT                   /translation="MQTGELQQIIDESYIDERLYKIGGEILYSIILVEDEFTQREILKK
FT                   MILSVCNFIKIYEADSESTALDIVKNNDINMFLIDINLKGSSGLNLAMNIRSIPKYEFS
FT                   QLIFLTTHMDYMLQAFKQTHCYDYILKPYNKDDIQSMLNKLIDRAICNLNKVEEKEFII
FT                   KIRKSIFVRVKVNDVLFIEVKGRDCEVNTVRGIYTYINISLKKILDLIDCDYIVQSHRA
FT                   FAINKNHIFKIEKVDIRLSCVYFENYPQTALIGIKFRNNIIPEFKKAGKYYDN"
FT   gene            323292..324539
FT                   /locus_tag="Cbei_0268"
FT   CDS_pept        323292..324539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0268"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: dsy:DSY2529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32457"
FT                   /db_xref="GOA:A6LQ27"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ27"
FT                   /protein_id="ABR32457.1"
FT                   /translation="MITSFFINSLDTINIIYLWAILNKKNNSLYRLLFSIITCSILVTA
FT                   VEYFELNFILSYIVLITGITITCKKKLKDIILEFFLILFIEMSFQLVISLIMNVYSCND
FT                   DIKAIIVELITLGTIFIFSKLNLSDNISFEKINNDISMYLISTFSMDVIIFKIILVYDD
FT                   SLISNNLPITAIIVSTSVISQILIYTSIIKEMKENEKFKVSMEYDEVIGEIVQEIKQRQ
FT                   HDFINYKNTIKGIVEVVDGDKVGEEIRNYIKDEDIYDDKINELIYINNVVMRSIIYRNM
FT                   CKAKKYNIDFKYKVNNNVLDDILSYNELSNVLNNLLNNAFEEVMKYDCIKKNIEIEIFK
FT                   KNETSHLIVKNQIADSNNINLNEMLKRGYSTKNTDTRGYGLYNVEQVITSHKGCLEVKL
FT                   ELKEIIFNIYFNNSSG"
FT   gene            complement(324594..325196)
FT                   /locus_tag="Cbei_0269"
FT   CDS_pept        complement(324594..325196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0269"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B; KEGG:
FT                   cth:Cthe_2358 accessory gene regulator B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32458"
FT                   /db_xref="GOA:A6LQ28"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ28"
FT                   /protein_id="ABR32458.1"
FT                   /translation="MIASIANFLTEYLNKNNSSLSKNDVLKIQYSLQIILGDLTKSLVI
FT                   LSIFLFVGQLPLFFLIFIILNSTRPLMGGIHCKTFKSCLVFSIMYFLIILLFSIFSSGL
FT                   NTYFSVFFFIISFIITFINAPCCNEKRPIKNKKILKILSLISLTFWCMLFFILRNTQLC
FT                   NCIFLSLLIQITQLIIVNMKGVISNAKINENFFNFTN"
FT   gene            325559..326391
FT                   /pseudo
FT                   /locus_tag="Cbei_0270"
FT   gene            complement(326930..327541)
FT                   /locus_tag="Cbei_0271"
FT   CDS_pept        complement(326930..327541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0271"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bce:BC4570
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32459"
FT                   /db_xref="GOA:A6LQ29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ29"
FT                   /protein_id="ABR32459.1"
FT                   /translation="MLQNKHDIRTKRTHQQIRDALIDLIFEKHFDNITVSDITNRAMIN
FT                   RSTFYRYYQDKYDVVLKIFEDAMERLKKDLGPPKESLKNLNENQRSDPWVKLFDHFAEN
FT                   KRLYLAMLDDSCNIWFMSRLRSNIISMLREREKLRSSFLVSDKDCSPEIQEMAFLFTAN
FT                   ALIGTIDWWLKSNCTPDSEKMSYLFRSYFKNGHIGMLNKD"
FT   gene            327671..328876
FT                   /locus_tag="Cbei_0272"
FT   CDS_pept        327671..328876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0272"
FT                   /product="dipeptidyl aminopeptidase/acylaminoacyl-peptidase
FT                   related protein"
FT                   /note="KEGG: cac:CAC3402 dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32460"
FT                   /db_xref="GOA:A6LQ30"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ30"
FT                   /protein_id="ABR32460.1"
FT                   /translation="MNNLIFKDDQFASKVLGLLGDTSFKAADIGEVVSTAEKIKEGDYQ
FT                   SWCEEWTKTAKRLQKVAEDSYSDGHLISARKAYLRASNYYRIAEFYLHENPENPKIDEL
FT                   YNASLDCFSHVMKLNKPVIEEVKIPYENTTLTGHFYKLEDSEEPKPVLIAMTGFDGTKE
FT                   AFCGMAMDALEHGMHCIAFEGPGQGEAVHKQQLFFRHDYEKVITPVVDYLLTRKEVDPK
FT                   KIVLWGQSLGGYLAPRAAAFEHRLAGCIANGGVYDFLGGFTSIFNMPREEFLNFALSDS
FT                   EGFNKAVKEKVELNSKAKWSFSHGMYVFGVNTPAEFILKVGDFYMKGLAEKIQCPTLIV
FT                   DSENDKLLRDQARQLYEEITCYKDFILFTAEEGAEFHCQAGAKLIANERIFSWIEKILR
FT                   NM"
FT   gene            328919..329467
FT                   /locus_tag="Cbei_0273"
FT   CDS_pept        328919..329467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0273"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   cac:CAC3495 multimeric flavodoxin WrbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32461"
FT                   /db_xref="GOA:A6LQ31"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ31"
FT                   /protein_id="ABR32461.1"
FT                   /translation="MSKVVIFKGSPRKKGYATKLLDQVAKGAKSKGAEVIEFDLNDTGI
FT                   RGCQGCFYCRTHDGCAVNDYLQPMYKAIDEADAIVFGSPIYMYQITGQAKIWLDRTFPM
FT                   VEELPDKFIPRHPGKKLITVFAQGSLDPKKGAEAIKYVNNIFDVFGWNLEDCIHYCGTD
FT                   DEVFNELSLRAFKDGENLV"
FT   gene            complement(329683..331002)
FT                   /locus_tag="Cbei_0274"
FT   CDS_pept        complement(329683..331002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0274"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cac:CAC0161 ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32462"
FT                   /db_xref="GOA:A6LQ32"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ32"
FT                   /protein_id="ABR32462.1"
FT                   /translation="MNQLRNEHTQNPHPHSRRSIQIILIIGITFTAANLRAPLTAVGPL
FT                   IDEIRRSLHISNTLAGMITTLPLFAFAGFSPFAPNLARKFGTKLVLFWSLIFLTLGIIL
FT                   RSLFGDLGLFLGTVIIGLSISVGNVLIPSLIKHEFPERIGVMTGIYTASMGLFGAIASG
FT                   ISVPVASESGLGWGVALSIWASLSFLSIVLWIPQIIRRKQRLSIVQRTVHSGIRTKAKD
FT                   VHEKKDEMEIVEANSINKINLWKSPLAWQVTVYMGLQSMLLYCMVAWLPAILVHQGMDS
FT                   SKAGWMLSLYQLVSLPTSFVGSVLAGNKANQRPLVITASLCVLVGLLGIFLGETGLTAL
FT                   WIVILGIGGALTFCLALIFFSSRTRNADEAARLSGMAQSGGYLLAAFGPMLFGFLHDAV
FT                   NNWTLPLIILIGAAGLCLLAGLGASRNLYVSKNTDNKATI"
FT   gene            complement(331035..331430)
FT                   /locus_tag="Cbei_0275"
FT   CDS_pept        complement(331035..331430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0275"
FT                   /product="iron dependent repressor"
FT                   /note="PFAM: regulatory protein, MarR; iron dependent
FT                   repressor; KEGG: dsy:DSY3767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32463"
FT                   /db_xref="GOA:A6LQ33"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ33"
FT                   /protein_id="ABR32463.1"
FT                   /translation="MYQNRRYSQKKLSPSKEEYLKAIYKLSEKTQSVRSIDLAAYLGFS
FT                   KPSINNAVAILQEAGLVVKPLGGEIQLTDEGRKQGQIITTKFQLIKQFLIAYCNVNEQT
FT                   ASEDACKMEHIISDEATFALKKYLNQV"
FT   gene            complement(332155..332628)
FT                   /locus_tag="Cbei_0276"
FT   CDS_pept        complement(332155..332628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0276"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: cac:CAC0162
FT                   transcriptional regulator MarR/EmrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32464"
FT                   /db_xref="GOA:A6LQ34"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ34"
FT                   /protein_id="ABR32464.1"
FT                   /translation="MDKFINNKHKIAYDSLDLAFALIDLDKKTRYFGTDVPIFHSEIHI
FT                   IKAIAEHPGIHVGGLADILGVTKGSVSEILKKLERKALVIKEIDNLNLSRYSLSLSEKG
FT                   KKAHSSHMYYHSILNSMFEDELQNASEYELEFLSNFLSSMINKVKSFNENFDE"
FT   gene            complement(332858..333436)
FT                   /locus_tag="Cbei_0277"
FT   CDS_pept        complement(332858..333436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0277"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: ctc:CTC01896
FT                   putative polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32465"
FT                   /db_xref="GOA:A6LQ35"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ35"
FT                   /protein_id="ABR32465.1"
FT                   /translation="MKIDLSFKIKKEMLDEIHATTKATNEAAEKSGHIGTHLDVMNGEF
FT                   SIDNIITNGKIFDISHIKTGEVKLEDLDLSGIKENDFVLFYSGILKQYGYGTKEYFSTY
FT                   IELSDELVDYLIDKKVSFIGVDMAGAKKPKDHPRIDLHCAEKGIFIIENLVNLDLLLKE
FT                   APKKSFTVYTFPTNMNGFSGISCRVIADI"
FT   gene            333631..334092
FT                   /locus_tag="Cbei_0278"
FT   CDS_pept        333631..334092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0278"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bat:BAS0708
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32466"
FT                   /db_xref="GOA:A6LQ36"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ36"
FT                   /protein_id="ABR32466.1"
FT                   /translation="MDLTINKLVAVFEHINNSMDSHGDEIKNLLIQYNHKDLYDMGLML
FT                   SEIHVIDCIGKNQLINATFISKELNMTKGAISKITSKLLKKELIKGNHLENNKKEIYYT
FT                   LTAQGKEVFKVHEILHKIESEKFVKILSKYDKEELSIINSFLEDLISEL"
FT   gene            334109..334639
FT                   /locus_tag="Cbei_0279"
FT   CDS_pept        334109..334639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0279"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bca:BCE_5181 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32467"
FT                   /db_xref="GOA:A6LQ37"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ37"
FT                   /protein_id="ABR32467.1"
FT                   /translation="MQENNDLINNGETQAKECIETISNLLNEVRGNISFSEEVANRGDE
FT                   VNSFIETFEELLAHTKFIENISSEINNVASRTNLLALNASIEAARAGDAGRGFSVVADE
FT                   VKKLSIGTKELVLSMNDTLKKMYCLTEDANDEIEKLKNRLKSIQQSRNNFSKLSNEIDI
FT                   IVSKFDELKKITY"
FT   gene            335111..335536
FT                   /locus_tag="Cbei_0280"
FT   CDS_pept        335111..335536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32468"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ38"
FT                   /protein_id="ABR32468.1"
FT                   /translation="MKKNLIAKITLGALLCASIIPAAASSHYKTLKLNSSNAILQPHQQ
FT                   ATDMGYRVKNHDDKEVAILAKSMQNTTKVDMRALDANKNVILDWKKIDTYAYWQNWSID
FT                   PVDGTVIQKGSSIDMQLRDHYDHKNTSYITDGELDYQ"
FT   sig_peptide     335111..335191
FT                   /locus_tag="Cbei_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.647 at
FT                   residue 27"
FT   gene            335615..336412
FT                   /locus_tag="Cbei_0281"
FT   CDS_pept        335615..336412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32469"
FT                   /db_xref="GOA:A6LQ39"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ39"
FT                   /protein_id="ABR32469.1"
FT                   /translation="MKNELKMEFSRCLNSKKFKYCFSILFGLTILSYAMLFKQTFQRNS
FT                   LQLGKTTDYSMIISSSDIRTIFLTFVLIAPLICTLMYSDSFIEQRENNMYSIFLMRSGK
FT                   KRYIIAKTITIFTVTFVSIFFILGFNEILTWISIPDVGINNGQPAYLIIQNNKAEYFLQ
FT                   DIYDRFPHLYNFIIIIITALFCSISSLIAFNLSMIFKINKIIMVIITFLIVNGTEMFLS
FT                   DDYQMQMYIQTWPAEFKKFLMVLSIWILLTVITFVIGIKKEII"
FT   sig_peptide     335615..335731
FT                   /locus_tag="Cbei_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.460 at
FT                   residue 39"
FT   gene            336442..337140
FT                   /locus_tag="Cbei_0282"
FT   CDS_pept        336442..337140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32470"
FT                   /db_xref="GOA:A6LQ40"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ40"
FT                   /protein_id="ABR32470.1"
FT                   /translation="MSIYLKKALLDIKSIFLFLFIFAVLIYNFSIGTTANYSNFDIYDI
FT                   GVGFFSRIGAIMLAYLLLLSILIDYYDKDYIIIRFQTIEKWRLSIIKNQIFLAIIFTLI
FT                   LNVIPVIYIVLNSSVIKYDNWKMYLAINTITQAAAFMSVGFFATLVYFKTLNLKFAITI
FT                   PFIIYSILNLIDNFLLNQYLNISASFSIPCGSNDFIIYEVCRKTLIIALIFYIISTSIK
FT                   KKRDMFNFEG"
FT   gene            337152..337787
FT                   /locus_tag="Cbei_0283"
FT   CDS_pept        337152..337787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0283"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cth:Cthe_2290 ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32471"
FT                   /db_xref="GOA:A6LQ41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ41"
FT                   /protein_id="ABR32471.1"
FT                   /translation="MSYIELKNVSKVVKDSKILDSISLSLEKGKIYGFLGSNGSGKTML
FT                   FRTISGLIRPTSGEVSINDKVIGKEIDFPESCGITIENTGFWNDQTGFDNLKNIASIKN
FT                   IVDDRAIMESMQRIGLNPQDKRKFRKYSLGMKQKLALVQAFMESQDLIILDEPTNSLDE
FT                   ESAIRVRNILREERSRGATILIASHISEDIDRLVDKKFKVDLGRVYEI"
FT   gene            337777..338484
FT                   /locus_tag="Cbei_0284"
FT   CDS_pept        337777..338484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32472"
FT                   /db_xref="GOA:A6LQ42"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ42"
FT                   /protein_id="ABR32472.1"
FT                   /translation="MKFKSEKNLFYLIIFLIICIGIISSLILRSSIINYDYNKFLSEKN
FT                   QYSYYPYKDLRYSGGVFTDISDENNIDMSNFSDYIVEGVATGKHEILNSAVLTQIKITK
FT                   VIKGNINKESIYIYEPVSIEIGENHSKRLESMLGYNLIKNDEEYVFCINDFSNIADHVY
FT                   TDKEKNSYIYKNPFLGKFPIKNDSSDFRIVEENEFYNNINYNEYANYEQIFSSKKSMDT
FT                   YFKCKEQLMQIIN"
FT   gene            338773..341034
FT                   /locus_tag="Cbei_0285"
FT   CDS_pept        338773..341034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0285"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="TIGRFAM: glycogen/starch/alpha-glucan phosphorylase;
FT                   PFAM: glycosyl transferase, family 35; KEGG: spd:SPD_1932
FT                   maltodextrin phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32473"
FT                   /db_xref="GOA:A6LQ43"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ43"
FT                   /protein_id="ABR32473.1"
FT                   /translation="MLEKNLNEILKKRFNKIVREASNEEIYLALLELTKGTIKKKSVNR
FT                   GKRKLYYISAEFLIGKLLSNNLINLGIYEDVKDVLTKNGKELAEIEEIELEPSLGNGGL
FT                   GRLAACFIDSIATLGFNGDGVGLNYHFGLFKQVFEDHKQKAVKNPWITSESWLNKSDIK
FT                   FEVPFAGFTVISTLYDIDVTGYDQEVSNKLRLFDVDTIDETLVKEGIDFDKEDIKKNLT
FT                   LFLYPDDSDEAGRLLRIYQQYFMVSNAAQLILLEADENGYDLHKLHEHVVVQINDTHPS
FT                   MVIPELISLLGERGIPMSEAIEIVSKTCAYTNHTILAEALEKWPIAYLQKVVPHLLPII
FT                   RELDNQVKLKFKDEKVAIIDKDMRVHMAHMDIHYGYSVNGVAALHTDILKEEELKPFYD
FT                   IYPEKFNNKTNGITFRRWLIHCNNKLASYISELIGDGYKKDAAKLEELAKFINDKIVLS
FT                   KIGEIKKENKIALKEYLKETQGVEIDENSIFDIQIKRLHEYKRQQMNVLYIIYKYLDIK
FT                   KGNRPTTPITMIFGAKAAPAYVIAQDIIHTILCLQEIINNDPEVNKYLKVIMVENYNVT
FT                   KASKLIPACDVSEQISLASKEASGTGNMKFMLNGALTLGTEDGANVEIHELVGAENIYI
FT                   FGESSEKVIEHYKNADYVSNEFYKKPEIKELVDFIISDEMIKVGDEENLTRLHKELVNK
FT                   DWFMTLLDVEDYINTKDMVFKDYEDREAWNKKVLMNISKAGFFSSDRTIAQYNEDIWKL
FT                   "
FT   gene            complement(341168..341839)
FT                   /locus_tag="Cbei_0286"
FT   CDS_pept        complement(341168..341839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0286"
FT                   /product="helix-turn-helix-domain containing protein, AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: btl:BALH_2808 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32474"
FT                   /db_xref="GOA:A6LQ44"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ44"
FT                   /protein_id="ABR32474.1"
FT                   /translation="MDNSFISDMSIFNNDISFLIKLRAKPQILEIVKKKHLDEISDEIS
FT                   IQDKKNDLLIWNAMYTREIVENGILTRYLHPIYNKFYTLIPTLNTIDDLQTIEIQMIDT
FT                   YINLLINDVEVKDNFVINRILKHLHLNIESQISLKKLSGELNLSEGYISDCFKKHMGMT
FT                   IMKYAKKIRIDRAKVLLVTTTSSILEIGLTLGFHDQSHFHKVFKSFTGVSPSEYRNNNF
FT                   G"
FT   gene            342176..344179
FT                   /locus_tag="Cbei_0287"
FT   CDS_pept        342176..344179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0287"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   cac:CAC2547 possible membrane-associated methyl-accepting
FT                   chemotaxis protein fused to HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32475"
FT                   /db_xref="GOA:A6LQ45"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ45"
FT                   /protein_id="ABR32475.1"
FT                   /translation="MKTKKFRVNTIRSKLVISLIGICVIPLIILGYGANIQAKSILNEK
FT                   LKLTSQQTLLEVNDGISSYFDGFSNMITMTSTDYNFVNSDKSEQAAYIPESLKNLKESN
FT                   SNIFSSYFATTDGKFDIYPSSKMPEGFDPRERPWYKQAVDNKGKVIITLPFTDAQTGKN
FT                   VVSIAKTVERDGKVIGVCAMNVSLETLTEKISMKKIGRTGYVFISDVEGKSMIAHPNKD
FT                   LLGTDAASKQSFWNDAKTNEKGFITYTFNNTKKFGVYETNNITGWKLVATLDEKELSND
FT                   TNSILTTTLIIIVVICFISIVLSLLLSKGIAHNIKKLKEVFEKASSGDLTVSITSSTKD
FT                   EFMDLANSFNEMLKNISELMNNVTKSSKTVLETSSNLASMSEEVTASIGEVAKAIEEVS
FT                   EGATNQSQNAQNGVTEMNDLSNRLDKISVNSNEMDKLSASTKELGAKGLSMIDTLIEKS
FT                   KKTKIATGEVDSIVRDMDESTRKINTISETISQITEQTNLLALNASIESARAGEAGKGF
FT                   AVVAEEIRKLAEQSKSSTEEIKVIITNIQSKSDTAVKAIKSTESVVTEQDLAVGKTQEI
FT                   FSEILRSIETMISKVDEIKTSIIDVDEKKKKAVLEIENISLISQETASASEEVTASTEE
FT                   ITAVMDRFTKYADELQLLAEKLDEEISKFRMT"
FT   sig_peptide     342176..342292
FT                   /locus_tag="Cbei_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.554 at
FT                   residue 39"
FT   gene            344332..344919
FT                   /locus_tag="Cbei_0288"
FT   CDS_pept        344332..344919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0288"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: cpf:CPF_0133 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32476"
FT                   /db_xref="GOA:A6LQ46"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ46"
FT                   /protein_id="ABR32476.1"
FT                   /translation="MKSLKGSKTAVNLMKSFAGESQARTRYTYYSSIAKKEGFVQIANI
FT                   FLETAEQEKEHAKRFYKFLKDDYVDEQIEIQASYPVSFHESTLKNLLAAASGENEEWTD
FT                   LYPSFAKTAEEEGYPEIAVVYRKISEVEARHEARYKKLAKNIEDGTVFKKDEVTLWKCG
FT                   NCGFIYEGKEAPAACPACSHPQAYFEVFVENY"
FT   gene            345077..345493
FT                   /locus_tag="Cbei_0289"
FT   CDS_pept        345077..345493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_1932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32477"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ47"
FT                   /protein_id="ABR32477.1"
FT                   /translation="MIKAKLEKNKSGKIIFKLKIDSDYKENILFKRAIMESKEIKGRYQ
FT                   YEVPLRFFIPICKNVGRENLVLDKRCILSYLEFSDYYDENYYTDIDATAKYMKKWREEG
FT                   CPDIYRITIDKDSYEITKEVVFKKPKVVIKDFSL"
FT   gene            complement(345579..346196)
FT                   /locus_tag="Cbei_0290"
FT   CDS_pept        complement(345579..346196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0290"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   ctc:CTC00834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32478"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ48"
FT                   /protein_id="ABR32478.1"
FT                   /translation="MNYDVELIREKSYKPTFWSGGMATELITYPVDSDYASRNFLWRLG
FT                   IAKIDIPESTFSDLTNVSRKFMVTEGKITLDHENKYRKLLKAFEQDSFMGDWKTKTYGK
FT                   ASVFNLMTRENYNGELVHLNITPRKKCVFKYQVPLDKELIAICFYVVSGSFKFTINNKI
FT                   FKANTNDLLLLKSLNLSSIHEFLLSSNSLEITNIIASVIYSQ"
FT   gene            346478..347068
FT                   /locus_tag="Cbei_0291"
FT   CDS_pept        346478..347068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0291"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   cpr:CPR_2319 5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32479"
FT                   /db_xref="GOA:A6LQ49"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ49"
FT                   /protein_id="ABR32479.1"
FT                   /translation="MESFINKKILRKEILDKRKKIDVTEKEKMDERILETVYSSEYYKL
FT                   AKNIFVYISFDTEINTRDFIKESLNNNKRIYVPRTEIKTRLMDAVEIKSLDNLSESSYG
FT                   IPEPSINDPYIDPNELDLIIVPGVAFDKRGGRVGYGAGFYDRYFKKVNKDNIKRITKLA
FT                   LAYDFQVLDKVPTSYHDVPVDYIITEKEFIKLE"
FT   gene            347103..349712
FT                   /locus_tag="Cbei_0292"
FT   CDS_pept        347103..349712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpf:CPF_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32480"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ50"
FT                   /protein_id="ABR32480.1"
FT                   /translation="MEYIESNFGYLKGTKIEKYYDHLIKAEFLCEYYPIVTKIIVRKVM
FT                   EMLLRDIAQDSGMDMNVSALTLLNGIKLKSNISFSEEIYNNIEIILANGYENISKRDRN
FT                   RKIPKHPIEILKIAQKVLYYYLKEKENLMLDIKNLSFSAPSTIEYMKKELLKINNDIAQ
FT                   RENLINNLRKKILEVDSSPKRISEINNIIILIKEEKAYLEEIQDILNRKVEMQNKCVLN
FT                   METDYKTYEKKLNEMKIKFNENEELLLEKEGQLLKAEIQNQELKISTEELDDEDESIKR
FT                   MKVSLDEELRTLRHAYESLLNLTEEYNDIVETIEFSYDNELRKELEAKKNSIQIKINFE
FT                   DAVFNENIIIYNKNIVEYKRKALIFKELVNENIKREIRHEKFYDGFLRLSGKELKIVYT
FT                   IINNITSSFNLISKPKELLGRYNEDKFLELLNRNLENLKNINDNEIKLILYYKLISLSN
FT                   APYGKIYNRRKFVQTLDYMVEKAYAVLVTKKDFKARARKLDAINEYYMNRTISALKNKG
FT                   SNTHITEELIEKIYDIITKLRQRPENKEKRLYYEKLDLDVMTESAIKAAIKSQPYTFLY
FT                   MIADLASIDSYKDMSSIIFQIENLIEKRSLIKNFSNTYFMVLLYLSSDAIVVSQNQQEE
FT                   LVPLAVMLITSVSLVSDNDFINLEGYNDLVKLWKQKQQKYNDICMKKEEKESSLALLMR
FT                   EKLELEINQKELSEAYDSLLRRYGSYENEFKNLVMNSEKRVLLPSYFYYDDLCNKKKLA
FT                   EKHINESKNKIGTLKSMFSIEVWKDQANKFINESNMLEAEKLLIKEAKQKPYFKKEYSV
FT                   FLELEDQIQKVNESIQKNKEMLRSKDALVDNIGGKIIDLQKQLTTMKNAYIDIESGY"
FT   gene            complement(349863..351794)
FT                   /locus_tag="Cbei_0293"
FT   CDS_pept        complement(349863..351794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0293"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); TGS domain protein;
FT                   Anticodon-binding domain protein; Threonyl/alanyl tRNA
FT                   synthetase, SAD; KEGG: cpr:CPR_2317 threonyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32481"
FT                   /db_xref="GOA:A6LQ51"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ51"
FT                   /protein_id="ABR32481.1"
FT                   /translation="MIKVTLKDGSIKEFEASLSIYEIAKSISEGLARNACCGIVNGKVE
FT                   DLRKEINEDVELSICTFDSQEGKDALRHSISHVLAYAVKRLFPETKLAIGPSIATGFYY
FT                   DFDRESAFTAADLEKLEAEMQKIIKENPEISRFELPRNEALELMKDEPYKVELINDLPE
FT                   NEIISFYKMGDFTDLCAGPHLMSIKSVKAIKLTRSAGAYWKGNEKNKMLTRIYGTAFLK
FT                   KSDLDAFLEALEEAKKRDHNKLGRELKLFTTDENVGQGLPLLMPKGAKIVQLLQRWVED
FT                   EEEKRGYLLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDDEVFALRPMTCPFQYT
FT                   IYNAEQHSYRDLPLRYGETSTLFRNEASGEMHGLIRVRQFTLADGHLVVTPEQLEEEFK
FT                   GVLELIQYLMGTLGIAEKITYRFSKWDPNNTEKYINDPDAWNKTQDTMRNILDHLNINY
FT                   VEADDEAAFYGPKLDLQFRNVHGKEDTLFTVQIDFALAERFDMSYVDKDGEKKRPYIIH
FT                   RSSIGCYERTLAMLIEEYAGAFPTWLSPVQAKVLPISDKYNDYAEAVTKALKNKGIRVE
FT                   TDYRAEKIGYKIREARLERTPYILVVGEKEAANNEVSVRSRKNDDEGAVKLDAFIERIV
FT                   KEIENKEL"
FT   gene            352392..354869
FT                   /locus_tag="Cbei_0294"
FT   CDS_pept        352392..354869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0294"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   ctc:CTC00924 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32482"
FT                   /db_xref="GOA:A6LQ52"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ52"
FT                   /protein_id="ABR32482.1"
FT                   /translation="MNRSIKSIKVKIIMFLIPMLLIAFIALSGIGYRFASKSLKESNLN
FT                   VMEEMTKTAASRADDQIKSEIRNLEVIASNPIITDKNVQIEEKIQILKPALKTVGQLEM
FT                   SISDKDGNSIDTLGNKKSIKTTQSFMKSINGENSITNPYIDPVTKKKVISYSVPIKDSS
FT                   NSIIGIITSIKDCKDFASLNKETNFLKTGNLLIVDSNGNFIVSEDESLVNENKNITNMT
FT                   SDKENLQDLNNIGKSMTIGTQSGTGKYTYEGKERYISYSPIGKTGLAIGITVEEKDLLS
FT                   ALNSLAFIDIIVTVIMTLLILTIIIGFTIIVVNRLLGAKYYVDSIAKGDFYTKVDDKYT
FT                   KGNDEISEICLSVSQAKESVGKMIEAVREDSNIVREGSVSLNQIAEELSILTEEISASI
FT                   GEVSNNTNKQSNDFVQISTKLENFGENITEVKNNVHSINEDIAIINDKSLKGTKDIEEL
FT                   NGGIISVNDSFEKFLISIEYIQGDMKNVNGITNIINGISEQINLLALNAAIEAASAGDA
FT                   GRGFSVIALEVKKLSDKSKESAQNIYKIINRLINIINKLVEESKNMESELHEQKEMIYN
FT                   ASSSFSEIALLVKEIAPKVSNIDSVFNNINHSKDLIVETVYELSGEITETSNSLEQVTN
FT                   SSVQLARLAEKVNSSSDILLDRADDLLQKVNQFKTKEEDLTKDTDISEQNSKANNQYEK
FT                   KSYSSGGGELDTKNKRLEKANLLNKFEDSIDSYQYERNLDLDLEEELKELSMSPEEEIN
FT                   LEFSNCGTSDLDLSLAEHFVDLSVSPLEKLEVDTSTKDFGWGCSKITEIKEYIKQKDEG
FT                   ECPEDDLGRYNIS"
FT   sig_peptide     352392..352499
FT                   /locus_tag="Cbei_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.509 at
FT                   residue 36"
FT   gene            354960..355044
FT                   /locus_tag="Cbei_R0032"
FT                   /note="tRNA-Leu5"
FT   tRNA            354960..355044
FT                   /locus_tag="Cbei_R0032"
FT                   /product="tRNA-Leu"
FT   gene            355049..355123
FT                   /locus_tag="Cbei_R0033"
FT                   /note="tRNA-Gly1"
FT   tRNA            355049..355123
FT                   /locus_tag="Cbei_R0033"
FT                   /product="tRNA-Gly"
FT   gene            complement(355244..355648)
FT                   /locus_tag="Cbei_0295"
FT   CDS_pept        complement(355244..355648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_2310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32483"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ53"
FT                   /protein_id="ABR32483.1"
FT                   /translation="MSLCEICNAEADIHHIVHRSEGGFDIELNYKYLCPSHHRGKYGPH
FT                   QSKEVDYRYKLDLQNKLYDMLKKDYYSFKELALELNIPRNTLKRITRNLKLYKEGYKKS
FT                   EVIFKIMGEKFYSEEMIVNLTLDKLIEDNY"
FT   gene            355919..356674
FT                   /locus_tag="Cbei_0296"
FT   CDS_pept        355919..356674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_2309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32484"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ54"
FT                   /protein_id="ABR32484.1"
FT                   /translation="MSYNIIREQKITINNIFYKILVGKVSKVWEVYNSFNYWENVISRN
FT                   KTIRGHMFMQKPPTERSIYFHTLIFGNNNGINNIWGYFPNRKCLIGYLQYSFLQEAFYK
FT                   WIYGKEKLITRIPHLTVDKIIREGEKLKKIDKEVASNMRRDYDFLSSLWNIPSEKAQAR
FT                   LDKFPAEFNKKWMGDNTEFLYIKIFKTPEELGEFVISSSLLTNTKEELENRIGMSIDEW
FT                   EDICKNAISDPNKGEVFREILLKKLSEVF"
FT   gene            complement(356778..357254)
FT                   /locus_tag="Cbei_0297"
FT   CDS_pept        complement(356778..357254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0297"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; PFAM: MECDP-synthase; KEGG: cno:NT01CX_0736
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32485"
FT                   /db_xref="GOA:A6LQ55"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQ55"
FT                   /protein_id="ABR32485.1"
FT                   /translation="MRIGLGYDVHRLVENRKLILGGVEIPYEKGLLGHSDADVLIHAII
FT                   DSLLGACALGDIGKHFPDTDSRFSGISSIILLEETGKLLLKSGYAINNIDATIIAQKPK
FT                   MLPHIENMRKNISIALNIDINKINIKATTEEGLGFTGEMLGISSQSISSVESII"
FT   gene            357636..358667
FT                   /locus_tag="Cbei_0298"
FT   CDS_pept        357636..358667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32486"
FT                   /db_xref="GOA:A6LQ56"
FT                   /db_xref="InterPro:IPR024449"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ56"
FT                   /protein_id="ABR32486.1"
FT                   /translation="MENLGFSKDKYVFSSMPSMFLIGDTAEDIRKKQISLFINELSSYN
FT                   VLLKDLVNFPIKEADRNIALNIAYYIASDEDLLRIINEKRVLPIAKISKLTRIKSEIIN
FT                   KLRDYIIAYCIIITNSNYKFIQDYLRIKLKEDNKVVSISSKNQQLYKGIVIKAFKNSAY
FT                   ILTSKGEFLKIKTFNRSKVGDVCEGKEKKGIRGYKIHISILLFILILIGSGITIEYRTT
FT                   QSIIVIETTSNIKIHINKFHKVIYAYSPTDKGKELIGNIDVLNKDVDDAISEIFEYALD
FT                   NEMLDLSRKTLITINGQALKYGELTKTNKFIYEHNIPIAINNAGNQQKLPKYSTEDSKE
FT                   EKK"
FT   gene            complement(358683..359642)
FT                   /locus_tag="Cbei_0299"
FT   CDS_pept        complement(358683..359642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0299"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: ctc:CTC00229
FT                   putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32487"
FT                   /db_xref="GOA:A6LQ57"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ57"
FT                   /protein_id="ABR32487.1"
FT                   /translation="MLKGTLPPRNISYKRLFKNKTSLSILVFSLLFVMFSIYLITHNIS
FT                   YKNSIASNHGSDNTSIDENHVGSENILKKDPSNVDKSTLQNERSFNNSNLITDNRGVPV
FT                   LYYHSVREPAENEVTITPENLRIQLEYIKNQGYTTLTLDELKNYLLNNSPIPEKSIVIT
FT                   FDDGYMDNYYNAFPILKNLNMVATIFCITSDLDGSYYLSKEAIKEMSDYGIDIESHTVS
FT                   HPKLNQLPYDKQLNELKESKETLESITGKKVEAVAYPFGDFNDDSVIAAKNSGYTLAFT
FT                   TKRGLSDRDDNILKLDRIYISSKYDINTFKEVLAQTKK"
FT   sig_peptide     complement(359517..359642)
FT                   /locus_tag="Cbei_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.891 at
FT                   residue 42"
FT   gene            360049..360804
FT                   /locus_tag="Cbei_0300"
FT   CDS_pept        360049..360804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32488"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ58"
FT                   /protein_id="ABR32488.1"
FT                   /translation="MGIIANITGLLIVSSMLSTACPQEMFITNKMQSESKIKIVDKSIT
FT                   KNLNYLKLDINMPQLVGGNDEKRINLINNVINQDILPRAEESEKTAKEYFGEKGQETPR
FT                   FPYEIYSRYTTSEDNNQILSLYNDYYEFLGGAHGMTTRTSYTIDKKKEALLTLKELFSE
FT                   GYNYSDIINKEIENQIKENPENYFDSGNVFKGISENQSFYIRDDNLVIYYQLYDIAPYV
FT                   FGIPEFKIPLKLFDKDFVYYKNWDSGSKK"
FT   sig_peptide     360049..360111
FT                   /locus_tag="Cbei_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.883 at
FT                   residue 21"
FT   gene            complement(361045..362091)
FT                   /locus_tag="Cbei_0301"
FT   CDS_pept        complement(361045..362091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0301"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cpr:CPR_2462 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32489"
FT                   /db_xref="GOA:A6LQ59"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ59"
FT                   /protein_id="ABR32489.1"
FT                   /translation="MNKIIEKAKITHELNKDEILELLQSDDINEELFKAADEVRQKYLG
FT                   EYVHLRGLIEFTNICKRNCLYCGLRRDNKNLERYRLTEEEILDFAKKAVSYGYKTLVLQ
FT                   GGEDDYFTKERMTNIVKEIKKLNVALTLSLGEKTYEEYKAFKEAGADRYLIRIETTDKK
FT                   LYEDMDPNMSFEERLNCLKNLRDLGYEVGSGILVGLPNQTLESIASDILFFKEINADMI
FT                   GIGPFIPNEDTPLKDAQGGNLTLALKVMALTRLILPDINIPATTAMESLTPNGRIVALQ
FT                   SGANVVMPNVTEGEYRKLYALYPGKICTGDTPAHCRGCITGKVTGIGRIISDGYGFRGN
FT                   QNTSAYNN"
FT   gene            362304..362738
FT                   /locus_tag="Cbei_0302"
FT   CDS_pept        362304..362738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0302"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mma:MM0116
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32490"
FT                   /db_xref="GOA:A6LQ60"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ60"
FT                   /protein_id="ABR32490.1"
FT                   /translation="MIEKHFEYIANYLWQQSMNNINLILSTEEKKQFNITDYYYLTTIY
FT                   NMENPNLGEIAEKLKLTKPAISALAKRLIKNELVEKVKSEEDGRIYYLKVTKKGIKIIE
FT                   GDNAIYKQFANLISEITSEEKLEELSILFSKVVKVLKSKE"
FT   gene            362859..363248
FT                   /locus_tag="Cbei_0303"
FT   CDS_pept        362859..363248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS3106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32491"
FT                   /db_xref="GOA:A6LQ61"
FT                   /db_xref="InterPro:IPR020348"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ61"
FT                   /protein_id="ABR32491.1"
FT                   /translation="MKILKQFFLVTDIGFIVYWFITLFHLIPESLLFKDYENPILVSWN
FT                   WSFLPLDLLISLTGFISLYMYYTTNELWKKFSLISLVLTFCSGLQAISFWTMRYDFDLL
FT                   WWIFNLYLMIYPLFFIKSLLTDAIE"
FT   gene            363257..363583
FT                   /locus_tag="Cbei_0304"
FT   CDS_pept        363257..363583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0304"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   cac:CAC3666 membrane transporters of cations and cationic
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32492"
FT                   /db_xref="GOA:A6LQ62"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ62"
FT                   /protein_id="ABR32492.1"
FT                   /translation="MISWIYLIFAIIFEVSGTISMKLSEGFTNIKYAIVMLGFYILSLS
FT                   MLTLALKKVQIGVAYATWSGIGIILLSAIGIVFFKESINLQKTVFIGLIIIGVIGLNLT
FT                   STIH"
FT   gene            363882..366476
FT                   /locus_tag="Cbei_0305"
FT   CDS_pept        363882..366476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0305"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   aldehyde dehydrogenase; KEGG: cpe:CPE2531 alcohol
FT                   dehydrogenase / acetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32493"
FT                   /db_xref="GOA:A6LQ63"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ63"
FT                   /protein_id="ABR32493.1"
FT                   /translation="MRVTNPEELTKRIEQIREAQREFAKFSQEEVDEIFRQAAMAANDA
FT                   RITLAKMAVEESGMGIVEDKVIKNHFAAEYIYNQYKDTKTCGVIERDEMFGITHIAEPI
FT                   GVIAAIVPTTNPTSTAIFKTLIALKTRNGIIISPHPRAKNSTIAAAKIVLEAAERAGAP
FT                   KGIIGWIDEPSIELSRNVMAESDIILATGGPGMVRAAYSSGKPAIGVGAGNTPAIIDDT
FT                   AHIKMAVNSILLSKTFDNGVVCASEQSIIAMESVYDEVLKELDERGAYILRGEEIDKVR
FT                   SIILDSKGSLNSEIVGQSAYKIAKMAGVEISEAVKVLIGEVESPELEEPFSHEKLSPIL
FT                   GMYKAKTFDDALRLASRMIELGGFGHTSILYTNQMESVDRIEKFGVAMKTARTLINMPA
FT                   SQGAIGDIYNFKLAPSLTLGCGSWGGNSISENVGPKHLINVKRIAERRENMLWFRVPDK
FT                   IYFKFGCLPVALEELNAMKKKRAFIVTDRVLFDLGYTHKITNILSENHIEYKIFSDVEP
FT                   DPTLKAAKLGADAMRDFNPDVIIAIGGGSPMDAAKIMWVMYEHPDVRFEDLAMRFMDIR
FT                   KRVYEFPPMGEKAILVAIPTSAGTGSEVTPFAVITDQQTGVKYPLADYALTPNMAIIDA
FT                   ELMMSMPKGLTAASGIDALVHAIEAYVSVLASEYTNGLALEAIRLTFKYLPDAYNGGAT
FT                   NIKAREKMAHASSVAGMAFANAFLGICHSMAHKLGAFHHVPHGIANALLIDEVIRFNAT
FT                   DAPRKQAAFPQYKYPNAGWRYARIADYLNLGGNTEEEKVELLIKAIDDLKAKVGIPKSI
FT                   KEFGVSEEKFYASMDEMVEQAFDDQCTGANPRYPLMSEIKDMYIKSYNGSNK"
FT   gene            complement(366579..369242)
FT                   /locus_tag="Cbei_0306"
FT   CDS_pept        complement(366579..369242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0306"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein domain protein; Haloacid dehalogenase domain
FT                   protein hydrolase; cation transporting ATPase domain
FT                   protein; E1-E2 ATPase-associated domain protein; KEGG:
FT                   cpe:CPE0333 probable cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32494"
FT                   /db_xref="GOA:A6LQ64"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ64"
FT                   /protein_id="ABR32494.1"
FT                   /translation="MKKYFSKTVEESLKTFDVTLKGLTSEKANKILDSVGENTLNEKKK
FT                   KSILSVFLEQFKDLLVIILIAAAIISAMTGNMESTFVILAVIAMNAILGTVQYVKAEQS
FT                   LASLKALSAPNAKVIRNGVKIEIPSKTVVPGDILILEAGDLVVADGRILENFSLKVNES
FT                   SLTGESESVDKFSDVIDKDEVALGDQKNMVFSSSLVTYGRATVLVTNTGMNTELGKIAT
FT                   LMEETQEKSTPLQISLDEFSKKLAFGIIGICVIVFGLSMYRGIDLLDSLMFAVALAVAA
FT                   IPEALSSIVTIVLAIGTQSMAKENAIIKKLKAVEGLGCVSVICSDKTGTLTQNKMTVKK
FT                   IFVDNNLIDSTKIDFKNFDSNFLLTSSILCNDSTSKDGAEIGDPTEVALVNLGHKYSLN
FT                   EIECRNNYPRLKEIPFDSDRKLMSTLHKIDGKYIMVTKGALDVLLDRVTSIKTSNGVAN
FT                   FTNNDKININNVNRELSSQGLRVLAFAYRELNENKELTLDDEYDYTFLGLISMIDPPRE
FT                   ESKAAVSDCIKASIKPIMITGDHKITASAIAKEIGILQEGDLAVEGLELDKMSDDELNS
FT                   KLKHISVYARVSPEHKIRIVRAWQNKGKIVAMTGDGVNDAPALKQADIGIAMGITGTEV
FT                   SKDAASMILTDDNFATIVKSVTNGRNIYANIKNSIKFLLSGNTSGILAVLYSSIFALPV
FT                   PFAAVHLLFINLLTDSLPAIAIGMEKSKKDVLKDKPRDAKESILTKDFIIDISCQGLLI
FT                   GIFTMISYHIGLATGSHGLAMTMAFSTLCLARLFHGFNCRGKKSIFALGVFNNKFSWIA
FT                   FISGVVLVNAVLLIPALQTLFEITPLTTNELMLVHLFAFIPTLIIQAIKVVRDFIEENN
FT                   EKNRNRDANDSTMRAA"
FT   gene            369830..371539
FT                   /locus_tag="Cbei_0307"
FT   CDS_pept        369830..371539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0307"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cac:CAC0443
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32495"
FT                   /db_xref="GOA:A6LQ65"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ65"
FT                   /protein_id="ABR32495.1"
FT                   /translation="MRLKKVKDVKIIRSIIIIVILSLISTITIGVLGYLNTSKMYDANL
FT                   TMYNNVIPKLSDWGDVNGSMGVLRNTLTKIIDRPFDEANEKTMLELNTNITEIVNRQAK
FT                   ESENNSEEHQLVMKFKEEYEQYYSYIPDIIDQRKQDLTPDKKITNDAMGVYGNQIAQDN
FT                   KALVQLQKDKATNEINKSMSAYRKNIFMFISILSVSILALAFMSTYIIFMIKNSIKEFV
FT                   HKVSILSEGNFTVKFDTESANEFGVMQNALSKTITSIASIIYTVKEDSSLVTEQSIELS
FT                   RVSEKMKHYIGDVSSSIHDIAEGSNEQSERLMSINNNLSSFSDKLDSITRSVEKVDKST
FT                   INISNEANISDERLRNIGISINEIAESYNEAQRKVNKLSLSVNKITEITNMINEIADET
FT                   NLLALNAAIEAARAGEAGKGFSIVADEIRKLAEQSKSSSEDINNLLGDISSETKLVEET
FT                   TGIANKKLEEQIRTIASTIVSFKEIVESIGDIVPQVHEINDAIVDINNRKNNIVENVEL
FT                   SSAVSEENSAASQEISASANEMDNSAYKVSKSAEELKDIMQQITSQIEKFVL"
FT   sig_peptide     369830..369931
FT                   /locus_tag="Cbei_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.657 at
FT                   residue 34"
FT   gene            371774..372616
FT                   /locus_tag="Cbei_0308"
FT   CDS_pept        371774..372616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0308"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: cpf:CPF_1546 phospholipase,
FT                   patatin family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32496"
FT                   /db_xref="GOA:A6LQ66"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ66"
FT                   /protein_id="ABR32496.1"
FT                   /translation="MIGLVLEGGAFRGLFTAGVLDAFLDIKAEIKYIVGVSAGATNAYS
FT                   YVSRQRGRNLEIMERFMDNKRYISYRNLIRCKSLMDLEFVFDEIPNKHCPFDYKAFYEF
FT                   DGKMLAGAFNIETGKNEYFDKDLLDKRNSILRASIAIPLVFPFEKIEGQYYADGGLSEP
FT                   IPINKSIEDGNDKHIIVLTRNEGYRKTKSKANEVTYRLYKNKYPKLADVLKNRHIKYNE
FT                   QLDYCKELEESGKAFIIRPSISMDISRFERNKSKLKAIYQNGYDLIIQNKEKILKYIG"
FT   gene            372800..373501
FT                   /locus_tag="Cbei_0309"
FT   CDS_pept        372800..373501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0309"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: cpr:CPR_0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32497"
FT                   /db_xref="GOA:A6LQ67"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ67"
FT                   /protein_id="ABR32497.1"
FT                   /translation="MFTSNSKTPKVYHQVIEQIKNNIKSGKLKKGDRLPSEREMSESLG
FT                   VSRASIREALRALEVVGLVESRQGAGNYIKTNFDNSLFEPLSVMFMLQESSIEEMYDLR
FT                   ETLELRCARLSAKNIENNELELLTAILDRMYIAENEDESLELDIKFHYLIAKTSRNTLL
FT                   INVLEVISQLMDEFIRKSRAQILHTGKTRENLLEIHENLVRALKCRDASKAHNAMVEHF
FT                   DLIRGSYGYKK"
FT   gene            374026..374814
FT                   /locus_tag="Cbei_0310"
FT   CDS_pept        374026..374814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0310"
FT                   /product="Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like; KEGG: cpe:CPE0311 electron
FT                   transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32498"
FT                   /db_xref="GOA:A6LQ68"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ68"
FT                   /protein_id="ABR32498.1"
FT                   /translation="MNILVCIKQVPGTSKVEVDPVTGVLKRDGIDSKMNPYDLYALETA
FT                   LKIRESEGGTVKVLSMGPNQALSVIKEAYTMGADEGTLLSDRKFGGADVLATSYTIAQG
FT                   VKKMGDFELIICGKQTTDGDTAQVGSEMAEWLNIPHVANVKDIVKVEDSTITVEMDMPE
FT                   SIETVKIAYPCLITVDKGIFEPRLPSYRKKLSTKDREIKILSLKDFDDKDEKNYGLNGS
FT                   PTQVERIFPPEVNNDREMWTGSSGELSGKMGEKLKELKFI"
FT   gene            374870..376060
FT                   /locus_tag="Cbei_0311"
FT   CDS_pept        374870..376060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0311"
FT                   /product="Electron transfer flavoprotein, alpha
FT                   subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like; Electron transfer flavoprotein,
FT                   alpha subunit-like; KEGG: ctc:CTC00974 electron transfer
FT                   flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32499"
FT                   /db_xref="GOA:A6LQ69"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ69"
FT                   /protein_id="ABR32499.1"
FT                   /translation="MAKLVVNQEKILDIDELIKICPFGALENNNGVVEISGACKMCKLC
FT                   VKKGPKGAVEYIEEEVKEIDKSIWNGIGVYVDHVDGEIHPVTYELIGKARELAGKINHP
FT                   VYAVFIGSNISHKAEELLHYGVDKVFVYDDEELKYFRIEPYTAAFGDFINNVKPTAILV
FT                   GATTIGRSLAPRIAARFKTGLTADCTILDMKENTDLVQIRPAFGGNIMAQIVTPNSRPQ
FT                   LATVRYKVMTAPKRNDDISGEIVECSIDKEKLLSKITALSIKKKDAEVGISDAEVIVAA
FT                   GRGIKSEKDLELVKELAKLLGAEFACTRPLIEAGWVDAKRQIGLSGRTVRPRLIIACGI
FT                   SGAVQFTAGMNNSDYIFAINADDKAPIFKVAHYGVVGNLYEIIPELIEKIKMAKEA"
FT   gene            376064..377467
FT                   /locus_tag="Cbei_0312"
FT   CDS_pept        376064..377467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0312"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   cac:CAC2542 FAD/FMN-containing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32500"
FT                   /db_xref="GOA:A6LQ70"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ70"
FT                   /protein_id="ABR32500.1"
FT                   /translation="MSYKEVELKDYEYILSIAENDLERVFFREEINEDYSHDELGGIKK
FT                   MPDIVIQTISADEVSKVMKYAYENNIPVTPRGSGTGLVGAAVPLKGGIVIDLSRMNKIL
FT                   ELDEENLTLTLEPGVLLMEIGKYVQEFDLFYPPDPGEKSATIGGNISTNAGGMRAVKYG
FT                   VTRDYVRGLEVVLPNGDIVNLGGKVVKNSSGYALKDLIVGSEGTLGIVTKAILKLLPLP
FT                   KKALSLLIPFESLERAIETVPKIIKSKSIPTAIEFMQREAILAAEEFLGKSFPDKSSDA
FT                   YLLLTFDGNSTEEIEKDYENVANICLEAGALDVLISDTEERQESIWSARGCFLEAIKAL
FT                   TTEMDEVDVVVPRNQIGKFVTFTHELERTANIRIKSFGHAGDGNLHIYILRDDLDQEAW
FT                   ESKLKEVMQIMYNKAKELDGQVSGEHGIGFAKKGYLKESLPSECIGIMQGIKLAFDPKN
FT                   ILNPGKVCE"
FT   gene            377805..378377
FT                   /locus_tag="Cbei_0313"
FT   CDS_pept        377805..378377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0313"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   sth:STH169 RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32501"
FT                   /db_xref="GOA:A6LQ71"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ71"
FT                   /protein_id="ABR32501.1"
FT                   /translation="MDIEEIVTRCKLGEKEAFRELFQIVEKKALATAYFLSGNRGIAED
FT                   ILQETYMKCFMEINKLQEPQAFKVWFFKILMRTGWKMTKKRSELVPLEITSENEGLFFD
FT                   ENQEKENIIDRYEIKHVMRSAINKLSPNLKTVVILYYYNDMTMEEISKVTGCFKATVKS
FT                   RLFYARAALKKQLANCFEVESGMSIVK"
FT   gene            378396..379307
FT                   /locus_tag="Cbei_0314"
FT   CDS_pept        378396..379307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32502"
FT                   /db_xref="GOA:A6LQ72"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ72"
FT                   /protein_id="ABR32502.1"
FT                   /translation="MKDKGYLDKVIKSAIDDSIFNIKASRDIFNEAWNNKEKEMGKKKY
FT                   FSIKNIRKEVLVPICCVLFAIIGVFTFSPGARAAAQEALKTIFLLDKSGNIIEKSEDEA
FT                   VDDVTVGGFETTDKNKNEIEGKFGFEFDFPEEVGNFSITEIAGYPVSPVAMMTVKDLKY
FT                   KDEENSLDKFRKAVGDDQIFNELSKDYKIIRNICESYEDSEKHKFFIYLSKFSEDSEMN
FT                   SVKETTIDNIKCRVLEENRAKYERSENGDDVTKKPISVNKIYYMVWDYNGVSYRIYIGE
FT                   NSADIDVATQFAKDYIKILKQE"
FT   gene            379586..381940
FT                   /locus_tag="Cbei_0315"
FT   CDS_pept        379586..381940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0315"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="TIGRFAM: pyruvate formate-lyase; PFAM: formate
FT                   C-acetyltransferase glycine radical; pyruvate
FT                   formate-lyase, PFL; KEGG: sdy:SDY_3786 formate
FT                   acetyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32503"
FT                   /db_xref="GOA:A6LQ73"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ73"
FT                   /protein_id="ABR32503.1"
FT                   /translation="MDELIMSQRIKNLKQKMLSEKRYASIEQALIITETYKENEDKPVI
FT                   IKRALALKNSLSKLEIGVDDEELIVGNRTKGVRYGVVFPESGSSWIDKEFESLPTRPQD
FT                   KFNVNLNDIETFRKVIKPYWDGHSLEDVIRQRYGKEIDEIAKVVKINQKDHAQGHICPN
FT                   CREWLALGPEGIKQRAIEKMKNSTKESKEFYESVIIVMEGAQEFMMRYHDLMKEKAESI
FT                   CEEELVADMLQVAEICKNISRRPAQTFHEAVQAIWFLFVILHMESNASSFSPGRMDEFL
FT                   YPYYKRDIHLGNIDDKKALEIIECLWLKFNEIVYLRNSHSAKFFAGFPIGFNIAIGGQD
FT                   EKSNDFSNELSFLFLKAQEHLGLPQPNLSVRLHKNTSEKLLKESIKVVAKGSGMPQFFN
FT                   DESVVPSMIDLGIKEKDARDYAIVGCVELTTQGNNLGWSDAAMFNLNKVLEITLNGGKC
FT                   LISGDSLSQDLGNLTTYEKYEDLEEAFAKQIDYFIDRMILACEQVEKAHIDVLPSPFLS
FT                   SVIDDCIEKGVDVTAGGAVYNLSGIQMIQVANLADSLAAIKLLVYDEKRISKEELLKAL
FT                   QNNFEGYEVIRAMLLNRAPKYGNDIQWVDEIGAKWARYFNGKLKSYTNYRGGKYHTGMY
FT                   TVSAHVPMGENVGASADGRYAKAPLADGGMSPVYGRDIAGPTAVLKSVSKLDNVLTTNG
FT                   GLLNMKFLPEFFKHEIGRDKFARFLRTFVDLEIPHIQFNVLRKEDLLAAQKDPENYRSL
FT                   TVRVAGYTAYFTELAGELQNEIIARTSYGDI"
FT   gene            381944..382879
FT                   /locus_tag="Cbei_0316"
FT   CDS_pept        381944..382879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0316"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="TIGRFAM: glycyl-radical enzyme activating protein
FT                   family; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Radical SAM domain protein; KEGG: tko:TK0290
FT                   pyruvate-formate lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32504"
FT                   /db_xref="GOA:A6LQ74"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ74"
FT                   /protein_id="ABR32504.1"
FT                   /translation="MEKDYSSLTGKIFDIRRFSTHDGEGIRTTIFLKGCPLKCVWCQNP
FT                   EGISPKEQLIHFENKCINCDLCIKKCSNQSVIRENNKICVVQDKCIDEQNEIVTDICPT
FT                   GALTMDSKNYTLDEVIEIALKDKAFFKYGGGVTLSGGEPLYQKEFVVVLLKMLKEAGIN
FT                   TAIETSLFVPTEYIMEALPYLDTIFADLKVFDNDKHKIFTGVGNELIKKNIKFILESNK
FT                   KDNVIIRTPLIPQFTANKINIHDISGYISSIYSKVRYELLNYNPLAKSKYNLINNLDYC
FT                   FEENPKMYTETQMEEFYDIAYSAGIRNLVK"
FT   gene            383097..383774
FT                   /locus_tag="Cbei_0317"
FT   CDS_pept        383097..383774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0317"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="PFAM: Transaldolase; KEGG: vpa:VPA1569 putative
FT                   transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32505"
FT                   /db_xref="GOA:A6LQ75"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ75"
FT                   /protein_id="ABR32505.1"
FT                   /translation="MLMLIDDANLDEIKRIYEFYPCDGVTTNPSILKKQGGNPMEVLKA
FT                   IREFLPEGAQLHAQVVSLTAEKMVDEAQHMIEVLGKDTYIKIPVTPEGIKAMKLLSKEN
FT                   VNITATAIYTSMQAFMAAKAGARYTAPYVNRIDNMGADGVQVAKDIHDMFKMHGLNSDV
FT                   LAASFKNSQQVLNLCKYGIGSVTAAPDVIEGLIKHDATKNAVDVFTKDFYSLVGEGNTM
FT                   EGL"
FT   gene            383890..384957
FT                   /locus_tag="Cbei_0318"
FT   CDS_pept        383890..384957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0318"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: cpr:CPR_2294
FT                   mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32506"
FT                   /db_xref="GOA:A6LQ76"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ76"
FT                   /protein_id="ABR32506.1"
FT                   /translation="MIYGLILAGGKGSRLYPLSRADQPKQFLKLINDKSFLVNTVDRIM
FT                   PLIDRDNIYIVTNMDYKEKVKDELIGIREENIFVEPANKETATCIGLSAVKLLKQDANA
FT                   VMVVLPSDHYIQGEKNYIDTLSQAIEMANRRRCIVTLGIEPSRPETGYGYIEMGERTAG
FT                   SIPTYRIARFTEKPNSEVAKDFILKGTYLWNSGMFIFRADVILREIEKYLPKLHKSLME
FT                   IYKNLGEENEESVIKDQYELIDGISIDFGVMQRTRKAYVIKCDFSWDDMGSFGALSRLL
FT                   STYRNNSISKNVYIDDCENCSIFGDKNLIIGFGIKDLVVVDAGDVILVMDKNKDQEIKH
FT                   LLNRLNENKEYNKFL"
FT   gene            385287..385868
FT                   /locus_tag="Cbei_0319"
FT   CDS_pept        385287..385868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_2292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32507"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ77"
FT                   /protein_id="ABR32507.1"
FT                   /translation="MINTHKIMAENIIKYANTKSIYLINNKRFIWGNVKPDCAPKYKFK
FT                   KHYFNESINMIIEKIIHLSSLSLEEIYYDMTIGKFSEELGVICHFLCDFFCAPHYYRWE
FT                   FKSTSAVKHHMMYEKNLAKVAKSFDPTGIINTHVDSSNIEEFIMQLQKQYDGTINYYND
FT                   LTFSYYVCDSVLNMILNNVFINENKVIKVI"
FT   gene            386403..387038
FT                   /locus_tag="Cbei_0320"
FT   CDS_pept        386403..387038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0320"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: cpf:CPF_2586 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32508"
FT                   /db_xref="GOA:A6LQ78"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQ78"
FT                   /protein_id="ABR32508.1"
FT                   /translation="MEKHKNISMAVIKRLPKYHRYLEELMKNEVDRISSKELGEKIGFT
FT                   ASQIRQDLNCFGDFGQQGYGYNVKELYTQISAILGLDRGYEAALVGAGNIGQAVSNYSR
FT                   FENLGFKITAIFDANPKLIGMKIRDVEIMDIDEMESVLEEHKIDIGIICVPRKNAQVVA
FT                   DELIRGGVRAIWNFAPVDLVVPDHVKVENVHLSESLLTLIYLLNESES"
FT   gene            387416..388201
FT                   /locus_tag="Cbei_0321"
FT   CDS_pept        387416..388201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0321"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   cpr:CPR_2287 3-hydroxybutyryl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32509"
FT                   /db_xref="GOA:A6LQ79"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ79"
FT                   /protein_id="ABR32509.1"
FT                   /translation="MELKNVILEKEGHLAIVTINRPKALNALNSETLKDLNVVLDDLEA
FT                   DNNVYAVIVTGAGEKSFVAGADISEMKDLNEEQGKEFGILGNNVFRRLEKLDKPVIAAI
FT                   SGFALGGGCELAMSCDIRIASVKAKFGQPEAGLGITPGFGGTQRLARIVGPGKAKELIY
FT                   TCDLINAEEAYRIGLVNKVVELEKLMEEAKAMANKIAANAPKAVAYCKDAIDRGMQVDI
FT                   DAAILIEAEDFGKCFATEDQTEGMTAFLERRAEKNFQNK"
FT   gene            388286..389425
FT                   /locus_tag="Cbei_0322"
FT   CDS_pept        388286..389425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0322"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   cpr:CPR_2286 butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32510"
FT                   /db_xref="GOA:A6LQ80"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ80"
FT                   /protein_id="ABR32510.1"
FT                   /translation="MNFQLTREQQLVQQMVREFAVNEVKPIAAEIDESERFPMENVEKM
FT                   AKLKMMGIPFSKEFGGAGGDVLSYIISVEELSKVCGTTGVILSAHTSLCASVINENGTN
FT                   EQRAKYLPDLCSGKKIGAFGLTEPGAGTDAAGQQTTAVLEGDHYVLNGSKIFITNGGVA
FT                   ETFIIFAMTDKSQGTKGISAFIVEKSFPGFSIGKLENKMGIRASSTTELVMENCIVPKE
FT                   NLLSKEGKGFGIAMKTLDGGRIGIAAQALGIAEGAFEEAVNYMKERKQFGKPLSAFQGL
FT                   QWYIAEMDVKIQAAKYLVYLAATKKQAGEPYSVDAARAKLFAADVAMEVTTKAVQIFGG
FT                   YGYTKEYPVERMMRDAKICEIYEGTSEVQKMVIAGSILR"
FT   gene            389439..390218
FT                   /locus_tag="Cbei_0323"
FT   CDS_pept        389439..390218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0323"
FT                   /product="Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like; KEGG: cpe:CPE2299 electron
FT                   transfer flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32511"
FT                   /db_xref="GOA:A6LQ81"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ81"
FT                   /protein_id="ABR32511.1"
FT                   /translation="MNIVVCVKQVPDTTAVKIDPKTGTLIRDGVPSIMNPEDKHALEGA
FT                   LQLKEKVGGKVTVISMGLPMAKAVLREALCMGADEAVLLTDRALGGADTLATSKALAGV
FT                   IAKLDYDLVFAGRQAIDGDTAQVGPEIAEHLNIPQVTYVQDVKVEGNTLIVNRALEDGH
FT                   QVVEVKTPCLLTAIEELNETRYMNVVDIFETSDDEIKVMSAADIDVDVAELGLKGSPTK
FT                   VKKSMTKEVKGAGEIVREAPKNAAYYVVGKLKEKHYI"
FT   gene            390241..391248
FT                   /locus_tag="Cbei_0324"
FT   CDS_pept        390241..391248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0324"
FT                   /product="Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like; Electron transfer flavoprotein,
FT                   alpha subunit-like; KEGG: cpr:CPR_2284 3-hydroxybutyryl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32512"
FT                   /db_xref="GOA:A6LQ82"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ82"
FT                   /protein_id="ABR32512.1"
FT                   /translation="MNIADYKGVWVFAEQREGELQKVSLELLGEGRRIADELGVNLTAL
FT                   LLGSNIEGLAKTLAEHGADEVLVADDKNLEHYTTDAYTKVICDLANERKPGILFVGATF
FT                   IGRDLGPRIAARLSTGLTADCTSIDVDVTNGDLLATRPAFGGNLMATIACPEHRPQMAT
FT                   VRPGVFAKITTDQSKCKIEKVDVKLADSDVRTKVLETIKAKKDIVDIAEADFIVSGGRG
FT                   VGNKENFQLLKELAEALGGTVAGSRAAVEKGWIDGAYQVGQTGKTVRPQIYIACGISGA
FT                   IQHVAGMQDSDLIIAVNKDDSAPIMKIADYAIVGDLTKVVPELIAQVKEIKSAE"
FT   gene            391440..392288
FT                   /locus_tag="Cbei_0325"
FT   CDS_pept        391440..392288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0325"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   KEGG: cpr:CPR_2283 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32513"
FT                   /db_xref="GOA:A6LQ83"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ83"
FT                   /protein_id="ABR32513.1"
FT                   /translation="MKKIFVLGAGTMGAGIVQAFAQKGCEVIVRDIKEEFVDRGIAGIT
FT                   KGLEKQVAKGKMSEEDKEAILSRISGTTDMKLAADCDLVVEAAIENMKIKKEIFAELDG
FT                   ICKPEAILASNTSSLSITEVASATKRPDKVIGMHFFNPAPVMKLVEIIKGIATSQETFD
FT                   AVKELSVAIGKEPVEVAEAPGFVVNRILIPMINEASFILQEGIASVEDIDTAMKYGANH
FT                   PMGPLALGDLIGLDVCLAIMDVLFTETGDNKYRASSILRKYVRAGWLGRKSGKGFYDYS
FT                   K"
FT   sig_peptide     391440..391505
FT                   /locus_tag="Cbei_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.513 at
FT                   residue 22"
FT   gene            392811..393740
FT                   /locus_tag="Cbei_0326"
FT   CDS_pept        392811..393740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0326"
FT                   /product="8-oxoguanine DNA glycosylase domain protein"
FT                   /note="PFAM: 8-oxoguanine DNA glycosylase domain protein;
FT                   SMART: HhH-GPD family protein; KEGG: cpr:CPR_2279
FT                   8-oxoguanine DNA glycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32514"
FT                   /db_xref="GOA:A6LQ84"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ84"
FT                   /protein_id="ABR32514.1"
FT                   /translation="MDYKSVEFYDNYLIIKELRNFKLKHIFECGQIFRFEEVAENDFIV
FT                   IAFGRLIEVKEDGNDVIIYNSTKEDFKNIWLKYFDLDRDYSVIKDELSKDVLLKQSIEF
FT                   GYGVRVLNQDPFEMLLSFIISARNNIPSIKKTVNKISNKWGKEIIYKDKTYYAFPNIGE
FT                   IKDATLEEIQETGASFRSKYIFDTIKNVYNSKTAKEDLKANDANECIKYDLDYIKNLDD
FT                   DECHNALQEFKGVGSKVADCIMLFSMEKTSAFPVDVWVKRAMIHFYGAEDASLNKIRIF
FT                   GRTKFGKLAGFAQQYLFYYARENKINVD"
FT   gene            394117..395607
FT                   /locus_tag="Cbei_0327"
FT   CDS_pept        394117..395607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0327"
FT                   /product="Ferredoxin hydrogenase"
FT                   /EC_number="1.12.7.2"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; hydrogenase large subunit domain protein; KEGG:
FT                   cno:NT01CX_0464 Fe-hydrogenase large subunit family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32515"
FT                   /db_xref="GOA:A6LQ85"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ85"
FT                   /protein_id="ABR32515.1"
FT                   /translation="MFQFENQLLALKHEVLTRVAVLAKENNISKEEIEKIPYAMIVGEE
FT                   PKYRDSVERERNVVLERAKLAAGFKPTGKHGQDLVNIEEEKQILYVIKEACDRCPTKKF
FT                   QVTDACRNCIAHKCQSACNFGAITYVDGRAYIDPDKCKECGMCKKACPYDAVAEDMRPC
FT                   KKSCPTGALSYNAEDLSAEITESKCVNCGACMSACPFGAIEDKSSLVKVINRLMDKEEK
FT                   IYAVVAPAITGQFGPKTTYGQVKNAIKALGFKDMVEAACGADAVTVHESNEFVERMENG
FT                   DSYMTNSCCPGFLSYIEKMMPDQANKISGTVSPMVATGRYIKSKDKDAKVIFIGPCTAK
FT                   KSEVLIESIKDAIDYALTFEELVALFDAFGVDPTTCEDIVVDGASIFGRNFAVGGGLTA
FT                   AIENYVQEKGVNIDFKPVKISGGAEIKKTMTMAKVGKLQGNFIEGMMCEGGCINGAAKI
FT                   VSVMKAKAPFTKLNQQTSTKSVLANTTLGEYTEINLER"
FT   gene            396015..396299
FT                   /locus_tag="Cbei_0328"
FT   CDS_pept        396015..396299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0328"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: cpf:CPF_2574
FT                   chaperonin, 10 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32516"
FT                   /db_xref="GOA:A6LQ86"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQ86"
FT                   /protein_id="ABR32516.1"
FT                   /translation="MNIKPLGERVVIKKLEAEEKTKSGIVLTGTAKERPQEAEVVAVGP
FT                   GAVVDGNRVAMEVKVGDKVLYSKYAGTEVKVDGEEYTILKQDDILAIVE"
FT   gene            396391..398016
FT                   /locus_tag="Cbei_0329"
FT   CDS_pept        396391..398016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0329"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: cpf:CPF_2573 chaperonin, 60 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32517"
FT                   /db_xref="GOA:A6LQ87"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQ87"
FT                   /protein_id="ABR32517.1"
FT                   /translation="MAKMLKFGEDARRSMQIGVDKLADTVKVTLGPKGRNVVLDKKFGA
FT                   PLITNDGVSIAREIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLK
FT                   NVTAGANPILIRTGIKMAVDKAVEEIQKISKQVDGKEDIARVAAISAADEEVGKLIADA
FT                   MEKVGNEGVITIEESKSMGTELDVVEGMQFDRGYVSPYMATDTEKMEAVLENPYILITD
FT                   KKISNIQEILPVLEQIVQSGKKLLIIAEDIEGEAMATLVVNKLRGTFTCVAVKAPGFGD
FT                   RRKEMLQDIATLTGGTVIAEELGRELKDVTIDMLGTADSVKVSKENTVIVNGKGDSNAI
FT                   KERINQIKAQIEETSSEFDKEKLQERLAKLAGGVAVIKVGAATETELKEKKLRIEDALA
FT                   ATKAAVEEGIVAGGGTAYVNVINEVAKLTSDVADTQIGINIIVKSLEEPVRQIATNAGV
FT                   EGSVIIEKVKNSEPGIGYDALHGEYINMIKGGIVDPTKVTRSALQNAASVASTFLTTEA
FT                   AVADIPAKETPMPGAPGMGMDGMY"
FT   gene            398340..398816
FT                   /locus_tag="Cbei_0330"
FT   CDS_pept        398340..398816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0330"
FT                   /product="Type II secretory pathway pseudopilin PulG-like
FT                   protein"
FT                   /note="KEGG: cno:NT01CX_1958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32518"
FT                   /db_xref="GOA:A6LQ88"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ88"
FT                   /protein_id="ABR32518.1"
FT                   /translation="MISLYIKCKFRFKDSMSKKRFCKKRKREAFTLIEMIAVIAIIGIL
FT                   AVAILPKVNGYINEAKKVKVVDQCRKVIMAVESYNLKNDSPLSESTSVSSAISNKGISK
FT                   YLDGVEFGNLNTSSTSLKNCYDVVNGAEFDFTENTDILNPTTIDNGSTKDDVKK"
FT   sig_peptide     398340..398507
FT                   /locus_tag="Cbei_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.528 at
FT                   residue 56"
FT   gene            399174..400631
FT                   /locus_tag="Cbei_0331"
FT   CDS_pept        399174..400631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0331"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: inosine-5'-monophosphate dehydrogenase;
FT                   PFAM: CBS domain containing protein; IMP dehydrogenase/GMP
FT                   reductase; KEGG: cpf:CPF_2558 inosine-5'-monophosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32519"
FT                   /db_xref="GOA:A6LQ89"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ89"
FT                   /protein_id="ABR32519.1"
FT                   /translation="MGKIIKTAYTFDDVLLVPNKSDILPREVSTKTKITKTIELNIPLM
FT                   SAGMDTVTESKMAIAVAREGGIGIIHKNMTIEEQAKEVDRVKRQENGVITDPIFLSQDH
FT                   LIQDAENLMAQYRISGVPITTQDGKLIGIITNRDIIFETNYQRKISEVMTKDNLITASE
FT                   NTTVEEAKEILKKHKVEKLPLVDSEGRLKGLITMKDIEKVRKFPNAAKDKKGRLLCGAA
FT                   VGVTGNMMERVDALVKAQVDVITLDTAHGHSKGVLDAVSQIKKVYPDLQVIAGNVATAE
FT                   ATEDLIKAGADCVKVGIGPGSICTTRVVAGVGVPQLTAVMDCAEVGKKYGVPIIADGGL
FT                   KYSGDIVKALAAGASAAMMGSLFAGCEEAPGEMEIYQGRSYKVYRGMGSLAAMECGSKD
FT                   RYFQEGNKKLVPEGVEGRVAYKGFVSDTIFQLLGGIKSGMGYLGAKNFEILYETANFVV
FT                   QTASGQRESHPHDINITKEAPNYSVGQ"
FT   gene            400819..402351
FT                   /locus_tag="Cbei_0332"
FT   CDS_pept        400819..402351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0332"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; KEGG: cpr:CPR_2260 GMP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32520"
FT                   /db_xref="GOA:A6LQ90"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQ90"
FT                   /protein_id="ABR32520.1"
FT                   /translation="MKRDLVLVVDFGGQYNQLIARRVRECGVYCEIIPYDYTIEKIKAK
FT                   NPKGIIFTGGPNSVYGEDTPTVEKEVFELGVPVLGICYGDQLMAHLLGGKVATAPVREY
FT                   GKTNVKVDKSSKLFEGIETDGIAWMSHTDYIEEAPKGFKVIATTEVCPVAAMENEEKRL
FT                   YGVQFHAEVEHTQFGQKMLENFIHNICGLENSWSMGSFAEEKIKEIKELVGDKKVLCAL
FT                   SGGVDSSVAAMIVHKAIGHNLTCIFVDHGLLRKDEGDTVERVFKKEFDMNIKRVNVADR
FT                   FLGKLAGVSDPETKRKIIGEEFIRVFEEEAKKVGQIDYLVQGTIYPDIVESGTKTSATI
FT                   KSHHNVGGLPEDMQFELIEPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLG
FT                   EITEEKLEIVREADAIFREEIANANLDESIWQYFACLPNIRSVGVMGDERTYSHTIALR
FT                   AVTSSDAMTSEWARIPYEILDLVSRRIVNEVKGVNRIVYDITSKPPATIEWE"
FT   gene            402770..403093
FT                   /locus_tag="Cbei_0333"
FT   CDS_pept        402770..403093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32521"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ91"
FT                   /protein_id="ABR32521.1"
FT                   /translation="MENRNNRNCRRCNCEEERGEMDSRNCNPCGNGTLGANANNDCLAD
FT                   ALEDAYNDGYKDGYRDGYEDGNTAGETAGETAGYKQGYCAGYEKAKQEVLDYIRRNRCC
FT                   RCC"
FT   gene            403535..405460
FT                   /locus_tag="Cbei_0334"
FT   CDS_pept        403535..405460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0334"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: regulatory protein, DeoR; M trans-acting
FT                   positive regulator; PRD domain protein; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: pac:PPA1482 putative
FT                   regulator of sorbitol operon"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32522"
FT                   /db_xref="GOA:A6LQ92"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ92"
FT                   /protein_id="ABR32522.1"
FT                   /translation="MKYFYTENRSTRILKLIERRHSISVDAIAEKFEVSSKTVKNDVKE
FT                   LNSLLKGSALIDNKQGIYKIYIIDNSKFEEIKTNIYNQKEFLNSPQRRMAFILYKLMNS
FT                   EEPYLTDDLACEMNVGRTTVISDLKKMREILNNYDLKIIGKTNNGLALKGTELNIRFLV
FT                   LENLYEMIYGEYELDEDVIDLVKEITDQYQFDTTTFESFIHSLVVTLDRLLNGHTINTL
FT                   SEKYGELLRSWEFTLVNTISDAVEKRLTISIPIKERIFLALPIIGMNTPTNIEGISPHV
FT                   EITEEVSNLVNHILERIKYDMGLNITLDDILKDFVYHMAFLVNRLKYGVHIHNPIVDEI
FT                   RKKYKVAYKMAELARDVIEKSLDVKMTQDEVGFIAAYFGVFISEQQIEKSKIYKVAVIC
FT                   GTGRVTARLVASQLKGIFDANTVIDLYSDSTVTSEILDKYNLVLSTVQANFKTTATVIY
FT                   LEKIFDEEALKKRIKSIKYIDKLDMPSMQGMDSILLSILDEDTFFILDNQLSYLENVDH
FT                   MIDNLYSKGYVDDGFKERIRKREEKSTMVFNESIAFPHTINYENDEIVVSLGIIPEKAG
FT                   ENNQRKLVFLVGLPEQTKDDTLLVKIYDEIIAIANDKNTIEALSKVKSYKELILHFTKE
FT                   NDIFDL"
FT   gene            405475..405927
FT                   /locus_tag="Cbei_0335"
FT   CDS_pept        405475..405927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0335"
FT                   /product="Glucitol operon activator"
FT                   /note="PFAM: Glucitol operon activator; KEGG: bld:BLi03867
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32523"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ93"
FT                   /protein_id="ABR32523.1"
FT                   /translation="MNFWFLIICFGIAFILQYILTFAQMKSFTAYYSKLRRRGRVAIGK
FT                   VKGGFRAGCIAMFAIDQNGIILEGGYMQGITVLARVKKLNGFEGKDVGRLTQADCKNLA
FT                   KPLTKAVLEASSNYNVIMGGGEVVESQSPLQRLGNIFTAKKLKAHN"
FT   gene            405943..406491
FT                   /locus_tag="Cbei_0336"
FT   CDS_pept        405943..406491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0336"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, glucitol/sorbitol-specific, IIC
FT                   subunit; PFAM: PTS system protein II sorbitol-specific
FT                   factor; KEGG: lsl:LSL_1891 PTS system,
FT                   glucitol/sorbitol-specific IIC2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32524"
FT                   /db_xref="GOA:O32332"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/Swiss-Prot:O32332"
FT                   /protein_id="ABR32524.1"
FT                   /translation="MDAIVYFAKGFMYLFEVGGNTFVSWVTGIIPKVLLLLVFMNSIIA
FT                   FIGQDKVDRFAKFASRNVILAYGVLPFLSAFMLGNPMALSMGKFLPERMKPSYYASASY
FT                   HCHTNSGIFPHINVGEIFIYLGIANGITTLGLDPTALGLRYLLVGLVMNFFAGWVTDFT
FT                   TKIVMRQQGIELSNQLKAN"
FT   gene            406509..407519
FT                   /locus_tag="Cbei_0337"
FT   CDS_pept        406509..407519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0337"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIBC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, glucitol/sorbitol-specific,
FT                   IIBC subunit; PFAM: Sorbitol phosphotransferase protein II
FT                   domain protein; KEGG: pac:PPA1485 PTS system,
FT                   glucitol/sorbitol-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32525"
FT                   /db_xref="GOA:O32333"
FT                   /db_xref="InterPro:IPR004702"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="InterPro:IPR011638"
FT                   /db_xref="UniProtKB/Swiss-Prot:O32333"
FT                   /protein_id="ABR32525.1"
FT                   /translation="MEKYNAIKIVKGSGGFGGPLTVKPEEGKDTLLYITGGGAEPEIVE
FT                   KIVNLTGCKAVNGFKTSVPEEQIFLVIIDCGGTLRCGIYPQKRIPTINVMPVGKSGPLA
FT                   KFITEDIYVSAVGLNQISLADSSAEPIKSTKVPEEGKREFKYSADKKVSQSLAENSKSS
FT                   IVQKIGMGAGKVVNTLYQAGRDAVQSMITTILPFMAFVAMLIGIIQGSGFGNWFAKILV
FT                   PLAGNGIGLMILGFICSIPLLSALLGPGAVIAQIVGTLIGVEIGKGTIPPSLALPALFA
FT                   INTQCACDFIPVGLGLAEAEPETVEVGVPSVLYSRFMIGVPRVAVAWVASIGLYQ"
FT   gene            407570..408316
FT                   /locus_tag="Cbei_0338"
FT   CDS_pept        407570..408316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0338"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="PFAM: Transaldolase; KEGG: lsl:LSL_1888
FT                   transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32526"
FT                   /db_xref="GOA:A6LQ96"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ96"
FT                   /protein_id="ABR32526.1"
FT                   /translation="MHQGKYIVDLDARSGIKGGLSIVKLIIDDVNIEKIKDVFSIFQID
FT                   GVTSNPSILHKYGKQPYEILIKIREFIGENSELHVQVISESSEGMLKEAHKIIKELGKN
FT                   TYVKIPVTRDGLKAIKILRKEEINVTATAIYTQMQAYLAGKAGAQYAAPYVNRIDNLGA
FT                   NGVQVAKDIHDIFEKNNFKTEVLAASFKNSQQVLELCKYGIGAATISPDVIEGLIKNDC
FT                   VDVAVENFKKDFEILCGQGNTMLNCR"
FT   gene            408381..408749
FT                   /locus_tag="Cbei_0339"
FT   CDS_pept        408381..408749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0339"
FT                   /product="PTS system, glucitol/sorbitol-specific IIA
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, glucitol/sorbitol-specific IIA
FT                   subunit; PFAM: PTS system glucitol/sorbitol-specific IIA
FT                   component; KEGG: efa:EF3305 PTS system, sorbitol-specific
FT                   IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32527"
FT                   /db_xref="GOA:A6LQ97"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR018454"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ97"
FT                   /protein_id="ABR32527.1"
FT                   /translation="MSSKIIYENKVKDLGDLAETFLEEGMIIFFGDNAPDTLADYCYSI
FT                   NIKEVKETIKPGQVFMIDGIAFEITAVGDVAEKNLVSLGHITVAFNGSKVPTLSGTICV
FT                   EKKEIPKLKIGSELSILA"
FT   gene            408832..409647
FT                   /locus_tag="Cbei_0340"
FT   CDS_pept        408832..409647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0340"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   lca:LSEI_2729 3-oxoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32528"
FT                   /db_xref="GOA:A6LQ98"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQ98"
FT                   /protein_id="ABR32528.1"
FT                   /translation="MKNTWLNLEGKTAIVTGGASGIGKAVAQEFLNNGANVVVCDMNPN
FT                   KPEFDDHNGHMEYIVTNVADRDSVEKMIEKAKEITGTIDIIVNNAGINIPRLLVDKKEP
FT                   KGKFELDENVWDKVMNVNVKGVFLCAQVAAREMASQGKGVIINMSSESGLEGSEGQSVY
FT                   AASKNAVNSLTRSWAKELGKLGIRVIGVAPGILEATGLRTLEYETALAYTRGITVEELR
FT                   AGYSKTSTTPLGRSGKLSEVADLVCYLASDRASYIHGVTYNIAGGKTRG"
FT   sig_peptide     408832..408915
FT                   /locus_tag="Cbei_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.971 at
FT                   residue 28"
FT   gene            410062..411411
FT                   /locus_tag="Cbei_0341"
FT   CDS_pept        410062..411411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0341"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   cpr:CPR_2252 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32529"
FT                   /db_xref="GOA:A6LQ99"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQ99"
FT                   /protein_id="ABR32529.1"
FT                   /translation="MNKGISLDLSKVSPYLEEAELENMESMVKAVHEDLHNKTGAGNDF
FT                   LGWVDLPVNYDKEEFARIKKAAEKIKSDSDVLIVIGIGGSYLGARAAIEMLTNNFHNVL
FT                   GSDKRKVPQIFFAGNNISSTYMAELLQVIEGKDVSLNVISKSGTTTEPAIAFRILKSYL
FT                   EKKYGVEEARKRIYATTDKARGALKTLADSEGYETFVVPDDVGGRFTVLTAVGLLPIAA
FT                   AGIDIDEMMKGAADARTAYSVPSIKENDAYKYAAARNALYNKGASIEVLVNYEPSLHYF
FT                   NEWWKQLYGESEGKDHKGLFPAAVDFSTDLHSMGQYIQDGRRIMFETVVNIEKPKYEIN
FT                   IEEADNDLDGLNFLAGKTMDFVNKKAFEGTLLAHNDGGVPNMILNVPEISAYYFGYMVY
FT                   FFEKACGISGYLLAINPFNQPGVEAYKKNMFALLGKPGYEDMKAELEKRL"
FT   gene            411419..411850
FT                   /locus_tag="Cbei_0342"
FT   CDS_pept        411419..411850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0342"
FT                   /product="protein of unknown function DUF188"
FT                   /note="PFAM: protein of unknown function DUF188; KEGG:
FT                   cno:NT01CX_0440 emg2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32530"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA0"
FT                   /protein_id="ABR32530.1"
FT                   /translation="MKIIIDGDACPGISIIEKAAKEHNISVIIYCDIHHFIQSNYSVVK
FT                   VVDGGFQSVDMYVMNETKEGDIIVSQDYGVAAICLSKKAKVINPKGYIYDEKNIDRLLE
FT                   ERHISQKIRRGGGKTSNPKKRTDEDNIRLEKNLLKLITS"
FT   gene            412102..414507
FT                   /locus_tag="Cbei_0343"
FT   CDS_pept        412102..414507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0343"
FT                   /product="Two component regulator three Y domain protein"
FT                   /note="PFAM: Two component regulator three Y domain
FT                   protein; KEGG: cpr:CPR_2250 two component regulator three Y
FT                   motif protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32531"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA1"
FT                   /protein_id="ABR32531.1"
FT                   /translation="MEELQLKYVEIAFDKQTPQKVGTEINISGKIDGEIENLEYKFIVG
FT                   KGGVWNTIQEFSGKNYCIWKPKREGEYMVMVQARERDGKKPLDYLAKEDYSIVTEEVSN
FT                   TVDKETSIQDVTNDEEIKSACNDKESNLLASEKEDPILCNIEFKEAMNSIEDNVVFLEV
FT                   KEISRAEKEVLISNSYADEEISSSNDAKEVEDIVDNTQYNEEVLNKILIENNDQIEPSF
FT                   IKDIRIDKEEIKVGEKCCIEIKTDDENVYLYRYYIKKNNEWDIIKDYDKSNILKYTANE
FT                   SGNKEFLIQCKRMDSTETFEDHRIITLKVREIDKVEITNFKCLNNSLIAGEKLGFIVET
FT                   NIEEFVSNEDIVLLYKFYKIYKDGKSICIQDYSTKNNVYYKETEAGSYRILCLVKSIFS
FT                   NKEYDDRAILVYSVKPYKTIKINNFVADSNSPNISGSSIKFTSEIEGGNKVIYRYQVNG
FT                   PIKEDTGFIEKSEFIWKPSEAGEYDIILYVKDITYKGEYEDLKRITFNIEKKSEKPVKI
FT                   LDIVVDKEKKIIVGEPVGITVNAEGGIKLQYAFTIRKDGRRLEGVDYNKSNWINFIPNQ
FT                   AGEYEVEIRLKDKYSDKSYDAQTVIYLKALEYLPGEIDYIILPYKETHLIGEAVEFECI
FT                   VQNTQNTLLKYETKINGHSIEKTEFSKNKKLRFIPKTAGKYTIEVYAKNVKCTSEYDSK
FT                   KQINLYVSEAYPVIETNIIANTLEGHINEELTFEAISRGGKNVCYEFYLMENNEWRKVQ
FT                   AYSRKHYYSFMPFTQGKYKILALAKSYYKKVSYEDYAEVTFYVKGLKG"
FT   gene            414554..415360
FT                   /locus_tag="Cbei_0344"
FT   CDS_pept        414554..415360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0344"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   cac:CAC2677 lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32532"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA2"
FT                   /protein_id="ABR32532.1"
FT                   /translation="MAIDGLDKMSNDQLLAMNMLSNGQVTNDSDSSNSTSGEKDLAFQL
FT                   VMKNLLESSKKSKENGNAESNGNTKEVKGETTSSEKLNSKENINLNNAARVGQTYVTGQ
FT                   NLEEIPMVLTNNYIGFTRNSESALSNKSGADIKKIYSAVDDAAKKYGVDPNLILAVIKQ
FT                   ESDFDPNSTSGVGAAGLMQIMPENFSHLGITDGYDVEQNVNGGTKLLKEYLDKYNGSSE
FT                   LALMAYNGGPGTMQRRGVSSASDLYKMPQETQNYVPKVMGYYRDGI"
FT   gene            complement(415772..416488)
FT                   /locus_tag="Cbei_0345"
FT   CDS_pept        complement(415772..416488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0345"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: cno:NT01CX_0437 RNA pseudouridylate
FT                   synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32533"
FT                   /db_xref="GOA:A6LQA3"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA3"
FT                   /protein_id="ABR32533.1"
FT                   /translation="MERLDKIISNLGYGSRKDVKSFAKKGIIEVDGLIVKDSAMLVDPE
FT                   KSVIKINGEEVLYRKYIYIMMNKPDGVISATHDNRDETVIDLLNLEHQVFDPFPIGRLD
FT                   KDTVGLLLLTNDGELNHRLISPKWHVDKVYYAEIDKSVDEKDIKAFKDGITLDDGYKCL
FT                   EANLEILSSSNDGSEIRLTIQEGKFHQVKRMFEAVGKKVTYLKREEFGGLLLDPDLEEG
FT                   EYRELTDEELSLLKSY"
FT   gene            complement(416705..417370)
FT                   /locus_tag="Cbei_0346"
FT   CDS_pept        complement(416705..417370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0346"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bce:BC3321
FT                   NAD(P)H-dependent flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32534"
FT                   /db_xref="GOA:A6LQA4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA4"
FT                   /protein_id="ABR32534.1"
FT                   /translation="MNNKNKEIIDAFQFRHACKQFDPTKTVSEEDFNTILEAGRLSPSS
FT                   FGFEPWKFLVVQNKSLKEKLFPVSWGAQNSFSGASHFVILLARKKVDTIYNSEYITKIM
FT                   SEVQNLPEDVANQRKSAFESFEKNDFNLLESDRAIFDWASKQTYIALANMLTAAAFLQI
FT                   DSCPIEGFNIEKVEEILKNEGILDTEHFGVSVMASFGYRAKEPHEKTRQPLNSIVQWI"
FT   gene            417505..417849
FT                   /locus_tag="Cbei_0347"
FT   CDS_pept        417505..417849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0347"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG: bsu:BG12143
FT                   similar to hypothetical proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32535"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA5"
FT                   /protein_id="ABR32535.1"
FT                   /translation="MHEQVIYPDCPNHPCPVETTLNIISGKWKGIILYRLLGGKKRFNE
FT                   LKKLIPNVTHRTLTLQLRELERDKILKRTVYAEVPPRVEYELTVLGQSMSPIIKSMYDW
FT                   GLNYQSELKS"
FT   gene            417992..418426
FT                   /locus_tag="Cbei_0348"
FT   CDS_pept        417992..418426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0348"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: lbl:LBL_2581
FT                   transcriptional regulator (MarR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32536"
FT                   /db_xref="GOA:A6LQA6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA6"
FT                   /protein_id="ABR32536.1"
FT                   /translation="MKNKCIVGRMSIIVEASNKFLTKKIRDERLPILQNHAALFDILPE
FT                   DGSKLLFNEIASTWKISKSSLSDIINKYESQGLINKCMCSEDKRSVYISLTPEAVVIKQ
FT                   KLQVMEREFLDIILKDFGEDEKKVFEDNIDKALKNIIKML"
FT   gene            418491..418712
FT                   /locus_tag="Cbei_0349"
FT   CDS_pept        418491..418712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0349"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   pca:Pcar_2331 thioredoxin-like proteins and domains-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32537"
FT                   /db_xref="GOA:A6LQA7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA7"
FT                   /protein_id="ABR32537.1"
FT                   /translation="MKELIMKSLDKIRPMLQRDGGDVELVDVSNDGVVSVKMQGACGNC
FT                   PGAMMTIKMIIEQKLKEEVPGVTEVIGV"
FT   gene            418892..420529
FT                   /locus_tag="Cbei_0350"
FT   CDS_pept        418892..420529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0350"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cth:Cthe_3036
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32538"
FT                   /db_xref="GOA:A6LQA8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA8"
FT                   /protein_id="ABR32538.1"
FT                   /translation="MFNSIRKRLIFNFVLIAAIITLICITFFSYQMVNGIQNQMKADGI
FT                   ILVNNIKANIESVGVTNTDKIQGIIDQTYKYSDGELCYIGVISSDKTLVAGTSKESIGE
FT                   KIDSTGLDAVFKGDTGAYMYEWKGTPAYNVTVPVKDGDDIGYALSIGISVDNMQKSIRS
FT                   TIIKSIIYAIVVLILAAVVGVYIGRRIAKPIEIIKDVIEKAGNGDFTAEYKITGKDEIG
FT                   KLAAASSKTRKSMRELVRKTKVISESLAKLSKDIEIGGSTVASSSEEIATSVTNVSQEG
FT                   IKQAEALEEAVSLLESFSIDLDNVDNKLTLLADGGKVIKDDTNKGAETINKLANTIDDM
FT                   LNSFSVSRAKVENLDSTISQINSIVDVINGVAKQTNLLALNASIEAARAGEAGKGFSVV
FT                   AEEIRKLAEEVLNSSKSITQLINTVMKETHDVSNTTEAVTKIVEESKNDINTVTNSFEG
FT                   VISKVNNIPSDINMVHVVLQETMKGRNKILNTVENIASKSQEISALSEEVTAATEEQAA
FT                   ITNEFSMTAKKLVNISSVLEKDILNFRI"
FT   sig_peptide     418892..418987
FT                   /locus_tag="Cbei_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.551 at
FT                   residue 32"
FT   gene            420801..423068
FT                   /locus_tag="Cbei_0351"
FT   CDS_pept        420801..423068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0351"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: cpf:CPF_2542
FT                   ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32539"
FT                   /db_xref="GOA:A6LQA9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQA9"
FT                   /protein_id="ABR32539.1"
FT                   /translation="MDLKSLLNKEQYEGATTIDGQVLILAGAGSGKTRVLTHRMAHMIE
FT                   DLDIAPYSILAITFTNKAAKEMKDRVKALIGERAENMWISTFHSTCVRILRREIDKIGY
FT                   KSSFTIYDSSDQKTLVKECMKTLNINDKDITEQEIMGKIGKAKDRMQSVRSFMLENEAN
FT                   FREKKIADVYEMYQKRLKENNALDFDDLIFKTVELFKNNPGVLEFYQNKFKYIMVDEYQ
FT                   DTNGAQYELVKLLASKYKNICVVGDDDQCIYQWRGADIQNILDFEKDYPGAKVIKLEQN
FT                   YRSKGNILSAANVVIVNNANRKSKVLRTEQEPGNKIKIYRAYADSDEGDFVSKQILDIK
FT                   NKEDKNYNDFAILYRTNAQSRIFEESFRRKGVPYKIVGGTRFYDRKEIKDVLAYLKVIV
FT                   NPQDDISIRRIINVPKRSIGDATVAKVQEFASSFEFDLWDALAEVRSIPTLTSRNVSTI
FT                   EPFVALMENFMELSETVPVSVLIESILKDTGYLKQLQESNEIEDKSRIENLKELVSDAA
FT                   DFEKNNEDKSLSAYLERVSLVQDTDKIEEEDDAVVLMTIHSAKGLEFPVVFMVGMENGI
FT                   FPGNASFEKESEMEESRRLCYVGITRAKQTLFMTSAEVRRVFGKTVAYPQSDFINEIKP
FT                   DLKEYVGVKKESAKSREKIMQSNSYTNPHSLRNSVTGNRAYTLNNGGINNVIDRSTMNE
FT                   MAKEYISVSEATLGRKVIHEKFGKGTIVAVQDSGNDKKLTVAFDKQGVKSLLLSFAKLK
FT                   MI"
FT   gene            423088..425079
FT                   /locus_tag="Cbei_0352"
FT   CDS_pept        423088..425079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0352"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: cpf:CPF_2541 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM:
FT                   helix-hairpin-helix motif; BRCT domain protein;
FT                   zinc-finger, NAD-dependent DNA ligase C4-type;
FT                   NAD-dependent DNA ligase, OB-fold; NAD-dependent DNA
FT                   ligase, adenylation; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1; NAD-dependent DNA ligase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32540"
FT                   /db_xref="GOA:A6LQB0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQB0"
FT                   /protein_id="ABR32540.1"
FT                   /translation="MDKIERIKELVEKLNRYSYEYYSLDSPSVSDKDYDEKYYELQELE
FT                   RETEYVLPYSPTLRVGDVVLEGFRKYTHKARLWSLDKAQSLQEIIDWHNRNVKFVEEAR
FT                   GRGENLPDLKYVVTKKFDGLTINLTYNTEGILEIAATRGTGSIGEEVTAQVKTIKSIPL
FT                   KINSNDILEVHGEAIMTQEAFNKYNETSDTPLKNLRNGAAGALRNLNVKETARRNLSAF
FT                   FYDVGYKEGTPFKTYMEMMEFIKQQGLPVDDYIRVCTSIEEIEKEIDYVRDIRFDLNYD
FT                   IDGLVIAIDDIRTRELIGYTVKFPKWAIAFKFEAQEATTKLLDVEWNVGRSGRVGPTAI
FT                   LEPVELAGVTVKRATLNNMDDIARKGVRIGAEVFVRRSNDVIPEIMGIVPESLEGSEEI
FT                   SVPEVCPACGSHLVLNGAHYFCENTLSCKPQLVKTIVHYASREAMNIAGFSERTAEQLF
FT                   EKLNIKSISDLYKLKEEDLIGLEKFAAKKAQNLLEAIEKSKDCELYAFIYALGIPNVGV
FT                   KTAKDLVSRFESIEGLKNATFEELVGVQDVGDIVAQGVLAFFKEEKVLQTIEELLSLGV
FT                   SPKYEEKEVIASAFEGKTVVATGSLKNYSRTEIKDKLESLGAKVAGSVSKKTDYVIAGE
FT                   AAGSKLTKAEELGIKILSEDEFEEMLRR"
FT   gene            425521..427017
FT                   /locus_tag="Cbei_0353"
FT   CDS_pept        425521..427017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0353"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: cno:NT01CX_0428 probable peptide ABC-type
FT                   transporter, periplasmic binding component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32541"
FT                   /db_xref="GOA:A6LQB1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB1"
FT                   /protein_id="ABR32541.1"
FT                   /translation="MKRIFFYAIMLSFIILFCLGFVNKESNNLSTDDSQETISYGINEI
FT                   PEDLEKVTNLSKRHEDIICAVSKGLVSKDVDNKIVPSLAGEITKSKDGIQYEFKIRDDI
FT                   FWSDGSKITPNDIATFFKELLKEEDEENIQALLNVYGAKEFRDGKVVYETGVAIKVNEN
FT                   SVIIRLNKADDNFLNELAKPQYTLRKYLIMWRNMKNNYSKLIYSGDYKIDSFNKDQVVL
FT                   KRNENNNKSGIDTIKILNDDSVETSMASYEVKERDIVINPPESELNKLSEQKKLITLPE
FT                   TKGTYLVINSKSNSIPLQGRRDIYNDVCKATESYQNSNNKEFELAEGSFFREDKQDLTK
FT                   LQARKVISNKEGEWNKPKILTLLCEDTDENRILCRTIEDWFKNNTNITIKYSLVKEEFE
FT                   DEELKKRYDMILVNNNANSSEKTDFYNNFKKYLTEDQNKLLEKLLITKNNGDYSSLEEN
FT                   LFDNYDILPLVFYNENIAISDKISDLKLDGNGNINFATIQ"
FT   sig_peptide     425521..425595
FT                   /locus_tag="Cbei_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.723 at
FT                   residue 25"
FT   gene            complement(427158..428870)
FT                   /locus_tag="Cbei_0354"
FT   CDS_pept        complement(427158..428870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_2537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32542"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB2"
FT                   /protein_id="ABR32542.1"
FT                   /translation="MNSLSQKEISGQLFYLSKESIKTLVLNSKCGILAQTRASKKSPIE
FT                   DISILNNFSPLLCLYRKASPLFIHSKSSPSFDEASFKKEISPSTSALMTLCLLELSEYY
FT                   SHYSDGKRNIVSLEKPFKFLAREQLQFYSENLRNNEGLFVDKKNISDGNSKGFSLIDKD
FT                   DKFKFSDQAFMMAAYLLYSHYNDSDELSKDYAAFSNEILDMFKTYNSVLYDLSFSECIQ
FT                   IFLALNIHYKYSCSQNAKELILDLGDFLISKFQEKDYYMDSIDDCALFSICLMEAYKHT
FT                   EIISFKEFSKEITEKLIGLYDTDKNIFIKLSDKKDSKYSCIEINLYLLCLLMYSFQEDR
FT                   ISELRPIISGLYRKFFVNGGLLTSWPEAPTLDEVERYKKLSLRSDDMLDEIYFRMPVLP
FT                   TPKSTGLAPVFVKSLSYSKKKDSLATKRTSFDSSKNMFNFFMIIYLLKDMVEDFMEFIP
FT                   PLGLERLSDLDSSIDSNTGFATTDAKESNSNNPLATSSPESNVSNIKTQLNLSKSEDPV
FT                   DFKQPVLNSFNTFKKNTNISSLNNDSTTKINHSVRNKKLKKNKAQHPHSKKKF"
FT   gene            428994..429971
FT                   /locus_tag="Cbei_0355"
FT   CDS_pept        428994..429971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0355"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein;
FT                   KEGG: cno:NT01CX_0426 hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32543"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB3"
FT                   /protein_id="ABR32543.1"
FT                   /translation="MKEGKLDFEDLRNIILNNKTIKRKEVKIRNDVGEDCSIIDFGEYE
FT                   GIFSTDPITGASENVGKLAVHINCNDIASAGGEPIGILVTILAPTSSTLREINEIMKEI
FT                   NEEAAKINVEIIGGHTEVTSAVNKMVISVTVIGKNLKGKSVKTAGAQLGDDIIVTKTLG
FT                   LEGTYILINDHKARIEKILSKEEIEFGSNLINKLSVLREGKIGGEFGVNSMHDITEGGL
FT                   LGGLFEVAMASNKGFKIFKEKIPMLDITKKVCEEFKIDPLRLISSGSMLITTKNGTGLI
FT                   KLLNESGIEASIIGKICESGALLIDDDIEIEVEAPKRDELFNIQ"
FT   gene            430185..430799
FT                   /locus_tag="Cbei_0356"
FT   CDS_pept        430185..430799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0356"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   cpr:CPR_2239 non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32544"
FT                   /db_xref="GOA:A6LQB4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB4"
FT                   /protein_id="ABR32544.1"
FT                   /translation="MKKLILASNNKKKIKEMKEILKEIDIEVRSLEDERIDIDVVEDGK
FT                   TFEENAKKKAKEIYEYLLERKDSNFIVLADDSGLEVNYLNGEPGIYSARYAGEHGNDSK
FT                   NNEKLLNKLKGVLKSNRGAKFICQLAMFTDKGEYFKVTGEVEGYIIEELHGDGGFGYDP
FT                   LFFYEPLDKTFAELTSEEKNEISHRGKALKELKKVINKLIY"
FT   gene            430876..431355
FT                   /locus_tag="Cbei_0357"
FT   CDS_pept        430876..431355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0357"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: cpe:CPE2252 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32545"
FT                   /db_xref="GOA:A6LQB5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB5"
FT                   /protein_id="ABR32545.1"
FT                   /translation="MLIAVVSDTHRITKYINLAKRLIKDADILIHLGDNIDDAELLENT
FT                   FKGKVYAVAGNCDYSTKYPKESVIEVNGKKIFFTHGDLYGVKSSMNNIYYRGRELNADI
FT                   VLFGHTHQQLVEKEDDMILMNPGSISLPKFKGRCIGFINIDNNGEVDAYLKEIRE"
FT   gene            431481..431556
FT                   /locus_tag="Cbei_R0034"
FT                   /note="tRNA-Pro1"
FT   tRNA            431481..431556
FT                   /locus_tag="Cbei_R0034"
FT                   /product="tRNA-Pro"
FT   gene            431574..431647
FT                   /locus_tag="Cbei_R0035"
FT                   /note="tRNA-Gly2"
FT   tRNA            431574..431647
FT                   /locus_tag="Cbei_R0035"
FT                   /product="tRNA-Gly"
FT   gene            431798..431874
FT                   /locus_tag="Cbei_R0036"
FT                   /note="tRNA-Arg2"
FT   tRNA            431798..431874
FT                   /locus_tag="Cbei_R0036"
FT                   /product="tRNA-Arg"
FT   gene            431881..431956
FT                   /locus_tag="Cbei_R0037"
FT                   /note="tRNA-Pro2"
FT   tRNA            431881..431956
FT                   /locus_tag="Cbei_R0037"
FT                   /product="tRNA-Pro"
FT   gene            431973..432046
FT                   /locus_tag="Cbei_R0038"
FT                   /note="tRNA-Gly3"
FT   tRNA            431973..432046
FT                   /locus_tag="Cbei_R0038"
FT                   /product="tRNA-Gly"
FT   gene            432082..432158
FT                   /locus_tag="Cbei_R0039"
FT                   /note="tRNA-Arg3"
FT   tRNA            432082..432158
FT                   /locus_tag="Cbei_R0039"
FT                   /product="tRNA-Arg"
FT   gene            432164..432239
FT                   /locus_tag="Cbei_R0040"
FT                   /note="tRNA-His1"
FT   tRNA            432164..432239
FT                   /locus_tag="Cbei_R0040"
FT                   /product="tRNA-His"
FT   gene            432243..432317
FT                   /locus_tag="Cbei_R0041"
FT                   /note="tRNA-Gln1"
FT   tRNA            432243..432317
FT                   /locus_tag="Cbei_R0041"
FT                   /product="tRNA-Gln"
FT   gene            432325..432400
FT                   /locus_tag="Cbei_R0042"
FT                   /note="tRNA-Lys1"
FT   tRNA            432325..432400
FT                   /locus_tag="Cbei_R0042"
FT                   /product="tRNA-Lys"
FT   gene            432418..432502
FT                   /locus_tag="Cbei_R0043"
FT                   /note="tRNA-Leu6"
FT   tRNA            432418..432502
FT                   /locus_tag="Cbei_R0043"
FT                   /product="tRNA-Leu"
FT   gene            432508..432582
FT                   /locus_tag="Cbei_R0044"
FT                   /note="tRNA-Gly4"
FT   tRNA            432508..432582
FT                   /locus_tag="Cbei_R0044"
FT                   /product="tRNA-Gly"
FT   gene            432606..432679
FT                   /locus_tag="Cbei_R0045"
FT                   /note="tRNA-Gly5"
FT   tRNA            432606..432679
FT                   /locus_tag="Cbei_R0045"
FT                   /product="tRNA-Gly"
FT   gene            432685..432760
FT                   /locus_tag="Cbei_R0046"
FT                   /note="tRNA-Lys2"
FT   tRNA            432685..432760
FT                   /locus_tag="Cbei_R0046"
FT                   /product="tRNA-Lys"
FT   gene            432818..432892
FT                   /locus_tag="Cbei_R0047"
FT                   /note="tRNA-Gln2"
FT   tRNA            432818..432892
FT                   /locus_tag="Cbei_R0047"
FT                   /product="tRNA-Gln"
FT   gene            432900..432975
FT                   /locus_tag="Cbei_R0048"
FT                   /note="tRNA-Lys3"
FT   tRNA            432900..432975
FT                   /locus_tag="Cbei_R0048"
FT                   /product="tRNA-Lys"
FT   gene            432995..433079
FT                   /locus_tag="Cbei_R0049"
FT                   /note="tRNA-Leu7"
FT   tRNA            432995..433079
FT                   /locus_tag="Cbei_R0049"
FT                   /product="tRNA-Leu"
FT   gene            433085..433159
FT                   /locus_tag="Cbei_R0050"
FT                   /note="tRNA-Gly6"
FT   tRNA            433085..433159
FT                   /locus_tag="Cbei_R0050"
FT                   /product="tRNA-Gly"
FT   gene            433183..433256
FT                   /locus_tag="Cbei_R0051"
FT                   /note="tRNA-Gly7"
FT   tRNA            433183..433256
FT                   /locus_tag="Cbei_R0051"
FT                   /product="tRNA-Gly"
FT   gene            433303..433379
FT                   /locus_tag="Cbei_R0052"
FT                   /note="tRNA-Arg4"
FT   tRNA            433303..433379
FT                   /locus_tag="Cbei_R0052"
FT                   /product="tRNA-Arg"
FT   gene            434073..434348
FT                   /locus_tag="Cbei_0358"
FT   CDS_pept        434073..434348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32546"
FT                   /db_xref="GOA:A6LQB6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB6"
FT                   /protein_id="ABR32546.1"
FT                   /translation="MSYIKATEILPKELLNLIQNYIDGEYLYIPRRECNKKSWGESTKS
FT                   RTEIAIRNTNIFKDYKSGICIKVLTSKYYLSEKSIQRIISQIKKKE"
FT   gene            434495..435151
FT                   /locus_tag="Cbei_0359"
FT   CDS_pept        434495..435151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0359"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: cac:CAC0541 SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32547"
FT                   /db_xref="GOA:A6LQB7"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB7"
FT                   /protein_id="ABR32547.1"
FT                   /translation="MELEEMSSFFNSRSENYEQHMMNNVEGTNELYSEIAKLIPKINEL
FT                   NLLDLGCGTGLELDEIFKVNSTVKVTGIDLAKNMMEKIKQKHNDKLNQLNLIVGNYFEY
FT                   DIGTCVFECALSVETLHHFAHEEKIKLYKKIFRSLKQNGFYIEADYMAPNQEYEDYYFN
FT                   ENRRIRSKLGITTGFYHYDTPCTVENQMQMLNMAGFKSVEKVWKYTNTVILLAKK"
FT   gene            435678..436841
FT                   /locus_tag="Cbei_0360"
FT   CDS_pept        435678..436841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ctc:CTC00840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32548"
FT                   /db_xref="GOA:A6LQB8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB8"
FT                   /protein_id="ABR32548.1"
FT                   /translation="MNVYGNNIRLTDRVGGKMTKRGVLIFIILSMITFVFYAYNINGES
FT                   RGFINDMINKIEGKTLNSKFQTKIKSGNLSTDYNIDQVLKDIDKLQLNTLNVPVVINID
FT                   SRTSSNMTIDKGSEKRAIELFEKLRWKKINIILEPYPWIENGSIGETEWKPDNIDEFFN
FT                   NWTDNVLGNLIKDVAIPYHVDALNIGTSFVYMESNEQKMCDMVDYVRNRYKGLLTYRTN
FT                   FWVTAKDFSPEFTDKYNEKLNNKIFSKVDFISIASYFELTSNDTNTVENLISSLECTQI
FT                   YDRKQNIKQEVKNFYDKWNKPIFFGELGFPRTNKASVQPHNPLISDIVNNKEQANCFEA
FT                   YRSVFENESWNLGFSIFAIGETSDDKKYYPSDESVEIIRKWYARNES"
FT   gene            437138..439186
FT                   /locus_tag="Cbei_0361"
FT   CDS_pept        437138..439186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0361"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold domain
FT                   protein; KEGG: cac:CAC0903 sensory transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32549"
FT                   /db_xref="GOA:A6LQB9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQB9"
FT                   /protein_id="ABR32549.1"
FT                   /translation="MSTGGIRRLSKSIKFELLIEWSFFFIFMAFLIIMNNYSNLFFHTG
FT                   IELFINFIFAVVFVFAFNTYRINKNNFLLILGIGYFFVAVLGIFHMLTYTGMPFLSSMD
FT                   GLKIATQFWIASRYMGAFTCLIAIIFKISPQRNMNPYALFITYFCITIFLISSICIFKV
FT                   FPDCYVENVGLTSFKIVSEYVLCTAFLIIATVFFIFGKNIDKYLFVCFECFLILSGVCE
FT                   MFFVSYVVPSEFTTIIGHTIMILAAYFLYKGVVETGLRKPYNLMNSDLYTADNKVKLFE
FT                   EIVFNNEECLNMIINNSDNAIFVISNNKFIFANEKMAELLGAEKVEEIIGIDIEKIITD
FT                   EAKGAVYRRIDNAICNKLSTPFVESKLLRLDGKIVDIEVTNSFCMYKGQPSAMVMLRDI
FT                   TSRKQIQLLESNIEENKKLISKATELNKMMTEFFSNISHELKTPLNVLLGAVQILSLSG
FT                   NDKNKLESGKYLKTMKQNCYRLVRLVNNLIDISKFDSGYFKMNLQNYNVVSVIEDITLS
FT                   VADYANNKGIDLIFDTDVEEKDMAIDLDKIERIMLNLLSNAIKFTDKGGQILVNMYDKK
FT                   DNIVISVKDNGVGMPKDKLNMIFERFGQIDKTLARNSQGSGIGLSLVKSIVDMHNGDIK
FT                   AFSEFGKGSEFVVKLPVRFVEDKLSSDGRLYESKVEKISIEFSDIYY"
FT   gene            439289..439672
FT                   /locus_tag="Cbei_0362"
FT   CDS_pept        439289..439672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32550"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC0"
FT                   /protein_id="ABR32550.1"
FT                   /translation="MEIFIYRTYNEWFDDKPTETLEGEVNSIYNGVLVIDTLEEFKRYR
FT                   QILSLKNNFAIVYKLSYGFLSYAKEINIYSNFNSWQNSNPEITIMGEVCESESADSHLV
FT                   FITQEGFKQCISLCEIYAVTYER"
FT   gene            439679..440308
FT                   /locus_tag="Cbei_0363"
FT   CDS_pept        439679..440308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32551"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC1"
FT                   /protein_id="ABR32551.1"
FT                   /translation="MYLQDIDLRKVYTIWKSNLGPFQGFFRSTPFVSLQTYDNFILKEE
FT                   NACQCNKYILDIIVENCSKNNFFIVDLPIDEILNLAFLLNNEYFIKPILNINLLFHPFG
FT                   IIGTKENINKLINNGLNLKKISTEKFIMLIPYDRYNDNWKSDDLKDKLNNQYGMSDDDL
FT                   PSADILKILGYTKITILTINKIKDDLQDYINFINEDIEVEVIKVRG"
FT   gene            440308..440622
FT                   /locus_tag="Cbei_0364"
FT   CDS_pept        440308..440622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32552"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC2"
FT                   /protein_id="ABR32552.1"
FT                   /translation="MKDFKQIVKKNKRKALSIAVAAAFFVSGPLGFTGCYNPQKEDDED
FT                   QDGNGSNYSGGGHVGGWNSFSSGSSINSDSSSKSKASISDSSVGKSSGYSGSKGGSSSS
FT                   "
FT   sig_peptide     440308..440403
FT                   /locus_tag="Cbei_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.838 at
FT                   residue 32"
FT   gene            440698..443157
FT                   /locus_tag="Cbei_0365"
FT   CDS_pept        440698..443157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0365"
FT                   /product="Glutathionylspermidine synthase-like protein"
FT                   /note="KEGG: btl:BALH_2622 glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32553"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC3"
FT                   /protein_id="ABR32553.1"
FT                   /translation="MEKQINYTEDVLFNNYMVSSLGEEYVHSQIPFYFDKSTYEKMVFY
FT                   SEEINRISLNVLKNIKEGHSELLNYFDDFMFKEKIFNLKCPMSPMFWARYDTFRDVDGD
FT                   IYFAEFNYDKPCGQKEIDLAGKCSFDGNINVSFINNVVKELLKICKEYEMEKEKIDVGF
FT                   LMDPCHYEELHHSYYFKHILKDTNINIVQVGPNNLSVRDGYVYAYSNFKLKIILRLFPT
FT                   EFFYEISNISEILNCVDCGNLLLINDPRVIAIQAKGFFAYLWNLVKSDSKLLSIRDKEI
FT                   ITKCIPYTEILNQDDIQDVIINKDSYVVKSSLGRYSQEVYIGKLYTQEMWENKIKTVSK
FT                   SNKVHVKQKLINIRQEYTYAPGNNNMNIPVLAFGNFGIYIMDYKVEGLLVRWSRELLTN
FT                   DDYTWMCPIGVENFPVYIKEFNPKNRKEIWNEIIDESVFKYNFTGVYTNIYEYISLNSL
FT                   ILKECAYKEMLSVSSKFCEILKKIYPYIQKEIELFGPILGIPEELYKLVSTSCATSLCA
FT                   LGRIDFAIDNDGSLKILEFNSETPAGLVEAIGLNSIIKEKLNIQYQNPNVNLKENIKKS
FT                   FFNILEELKKIKKVKNIAVVTSWYYEDIYTSNLIAEILKELNEYSVVFGNIYDLKVNNN
FT                   KIYLYGNEIDAIYRHYPLDWFSYEDEMKKLIDPLSSGQYLINPGHTLITQSKALFAVIY
FT                   ELVRKKFFSRDDEEFVLKYIPYTCLEPDNVLSFDYVTKPYLSREGAGVMLSYDEMSKEL
FT                   DDIAFQDRVNIKPLYSNIYSTMKEESKYLFPVIGTYITGDIPSGVFTRMGDFITDKNAV
FT                   YVATYIE"
FT   gene            443262..443471
FT                   /locus_tag="Cbei_0366"
FT   CDS_pept        443262..443471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32554"
FT                   /db_xref="GOA:A6LQC4"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC4"
FT                   /protein_id="ABR32554.1"
FT                   /translation="MTGIVNNIVVSIIFGLIGIILLIFGYCFFDKVLTKIDFNQELKEK
FT                   NVAVAIVIAGFMISIGIIISGVVS"
FT   gene            443678..445738
FT                   /locus_tag="Cbei_0367"
FT   CDS_pept        443678..445738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0367"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13;
FT                   KEGG: mfl:Mfl241 putative membrane metallo endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32555"
FT                   /db_xref="GOA:A6LQC5"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC5"
FT                   /protein_id="ABR32555.1"
FT                   /translation="MRKITLKKITSIILVLFLSISTSLNNTPYSSEFNIISVLNSNSIE
FT                   SYSDARIEDDFYNAVNKEWLSKVKLDDGYISYGTFEEVCGRVNGDILNIISDIQKNKDN
FT                   YDKNSDELKVLNLYNNYLDMKKRDELGTKPLEKYMNQINEIKDTNDLKAILKDDEFSYF
FT                   QPLINLGVGPDYKNSNINVLYVSRSNLGLGNSFYYKDTSEKSQKIKQIYINYIAKLHML
FT                   YGENEDVARKNAETFFNIENEFAKKIPSYEEEAKDENRIQNSYNLYTVKELNKLIPNAD
FT                   IPGLLNKLNINNPKKIIVENPEELKLVNSIISEDNLENIKTYFKTNVLMNTDNYLTSKH
FT                   REACNELRKVLYGVECSELDEGSGVKFVSGQLNEIISKLYVNKHFDDESKNDVEKMSKE
FT                   IIENFEDRLQSNTWMSKSTKEKALRKLENVNVKVGYPEKWNDYSDVVINSYGEGGSLVD
FT                   NLISIYTSQSKKQFSKLNHEVDKDEWNMGPCTVNAYYNALNNEIVFPAGILQAPFYDKN
FT                   AKKEKNLGGIGVVIGHELTHAFDNTGAQFDETGKLKNWWNQNDYKEFTNRSKKVVDYYS
FT                   NINMGNEKNVNGILTVGENISDLGGMACVLDIAKKMEDPNLKDLFENYATVWREISTNE
FT                   LKEYLLNNDPHAPKKVRVNAVLSQFEDFYKTYNIKEGDKMYVRPEDRVGIW"
FT   sig_peptide     443678..443755
FT                   /locus_tag="Cbei_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.471 at
FT                   residue 26"
FT   gene            446133..447637
FT                   /locus_tag="Cbei_R0053"
FT   rRNA            446133..447637
FT                   /locus_tag="Cbei_R0053"
FT                   /product="16S ribosomal RNA"
FT   gene            447774..447850
FT                   /locus_tag="Cbei_R0054"
FT                   /note="tRNA-Ile2"
FT   tRNA            447774..447850
FT                   /locus_tag="Cbei_R0054"
FT                   /product="tRNA-Ile"
FT   gene            447938..450846
FT                   /locus_tag="Cbei_R0055"
FT   rRNA            447938..450846
FT                   /locus_tag="Cbei_R0055"
FT                   /product="23S ribosomal RNA"
FT   gene            450919..450993
FT                   /locus_tag="Cbei_R0056"
FT                   /note="tRNA-Asn4"
FT   tRNA            450919..450993
FT                   /locus_tag="Cbei_R0056"
FT                   /product="tRNA-Asn"
FT   gene            451183..452265
FT                   /locus_tag="Cbei_0368"
FT   CDS_pept        451183..452265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0368"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: cpf:CPF_0823
FT                   polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32556"
FT                   /db_xref="GOA:A6LQC6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC6"
FT                   /protein_id="ABR32556.1"
FT                   /translation="MNYSNGTSKVTEAKEAGEADESIENSDIDDNSRTNKGNSETNDIS
FT                   DNIRPFEIDEVGEEDFKGIKKRKFAILLTIVAVAIIIGIAITVQKSVMNRQTAEALNAN
FT                   GNAYSEGDKNQTDSNVYNSARSSEVEDVAFIEKYLNQQMKGQMPDGADGKKVVYLTFDD
FT                   GPSETVTPKVLDTLKAENVHATFFLVGKAIDESEANKNIVKRELAEGNAIGNHTYSHNY
FT                   GYLYPNGKINLENCMSDFEKTNQSLKNILGQDFSTRAVRFPGGQMTWDKKDPSGADAMD
FT                   KALHERDYHQIDWNSLSQDAEGAHKNAEQLKQEVIKTVSGREKAIILMHDTYGKEETAK
FT                   ALPEIIKYLKQQGYEFKIMK"
FT   gene            452554..453939
FT                   /locus_tag="Cbei_0369"
FT   CDS_pept        452554..453939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0369"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   cpe:CPE0339 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32557"
FT                   /db_xref="GOA:A6LQC7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC7"
FT                   /protein_id="ABR32557.1"
FT                   /translation="MLSKNIVAEVLAKCLVTGGDFAEIFEENSINNSIALIDGKVDDAI
FT                   GGRSYGIGIRIFKGLNSVYAYTNNNSLSGLLDTAYRAALALGDVNKNEINSIVLTEKSI
FT                   STIHPILYYPKDVAYDRKIAILKSAYNAAKNYNSDISQVITSYADKEQNILIANTEGLY
FT                   VQDTRIRTRLGISAIASKGSENQTGFEGPGRHMGIEMFDSVDPEYHGKEAARIAHTMLY
FT                   AKNCPAGNMTVAIDNGFGGVIFHEACGHSLEASAVAKGNSVFANKLGEKIASTKVTAID
FT                   DGTVPNAWGSLNIDDEGNKTQKNILIENGVLKGYMIDKLNGRRMNMEATGSSRRQSYKF
FT                   QPTSRMTNTYIAAGNDNPDDIIKSIEEGLYAKKLGGGSVNPVTGEFNFAVQEGYLVKNG
FT                   VIQEPVRGASLIGKGSEVLMDIDMVGNNLDVAQGMCGSSSGSIPTNVGQPMIRVKKMTV
FT                   GGR"
FT   gene            453942..455285
FT                   /locus_tag="Cbei_0370"
FT   CDS_pept        453942..455285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0370"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   cpf:CPF_0324 TldD/PmbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32558"
FT                   /db_xref="GOA:A6LQC8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC8"
FT                   /protein_id="ABR32558.1"
FT                   /translation="MDFELFKEELFKEAKNSGFEEFEIYYSDAESLSLSIYEGEVEKYK
FT                   LNNAFGLSFRGKINNKMGYSYTEILDEEAIKTLIRNAKEAAFAIENDDEQFIYEGDKEY
FT                   KELDCYKKDLDNIKPDELIALSLEMEKECKKQCDKVVSFQGCGIGYGKATYGIINSKGL
FT                   NLKNERNNLSAYVVPIIQDNNEKYDGTGYVMAKKIDDIDPKSLAKQGLEEALSRIGGKS
FT                   IPSGKYKIIINNEAMVSLLGTFSGIFNAEQVQKGLSLLKGKEGEIIASDVVSIIDDPHL
FT                   KDGLGTTSFDDEGVATIKKEIISKGKLNTLLYNLKTAHKAGIKSTGNGFKASYASIVGV
FT                   SATNFYINPGDKSFEELCNEVKEGVIITDFAGLHSGASAVTGDFSLAAKGFMIENGKKS
FT                   FPVEQITVAGNFFTLLKDIEEVGSDLKFPMSSIGCPSVVVKELSIAGK"
FT   gene            455331..456140
FT                   /locus_tag="Cbei_0371"
FT   CDS_pept        455331..456140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0371"
FT                   /product="protein of unknown function DUF1113"
FT                   /note="PFAM: protein of unknown function DUF1113; KEGG:
FT                   cpf:CPF_1398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32559"
FT                   /db_xref="GOA:A6LQC9"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQC9"
FT                   /protein_id="ABR32559.1"
FT                   /translation="MNIIYMYLFSFIIYSFLGWICETIYCSIIDREYVNRGFLKGPFCP
FT                   IYGSGALIVIILLAPFSDNIVILFLSAMIFTSILEYLTGFLLETIFNLKWWDYSGYKFN
FT                   IKGRVCLLNSVLFGLLSLITIKVINPIIIDLVSHISLKVSMWICDISLLYLLTDGITTT
FT                   VKVLKLGGKLKEMSALFDEIREKTESYKVVLQQNLSRFDGLIEQESEKVIHAKEQISKL
FT                   KFKLENLVLNNKAVNKRIIKAFPNIKSLKYQHSLDRLKEEIKKIKKK"
FT   gene            complement(456197..458080)
FT                   /locus_tag="Cbei_0372"
FT   CDS_pept        complement(456197..458080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0372"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: cpe:CPE2237 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32560"
FT                   /db_xref="GOA:A6LQD0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD0"
FT                   /protein_id="ABR32560.1"
FT                   /translation="MSSSNSYVVNFFKNSLENNIKKDKVIRLIFFLIALVSIVLKGIIF
FT                   QGFVTSKDPYTFSFSTGYESASSFLNYYVAFTLIFLSFSLLFKGKGRIIYTLVIDFSLT
FT                   LLILVDVWYFRGFLTVPSALILTQTANLDNMSGSILSMTSNLDFIFVFDFIILGIYAYI
FT                   TRKSFTQVHKRAFKTFFCTFVLPILFIIYVPISITVFNNTDVHNAYLFSNYDKSNTAKY
FT                   FSPIGYHIMDCYTVYKDSKPYKLTDQDKADINELFEIKKENLPDNEYLGMAKGKNLIYI
FT                   QVESLENFVIGKTVNGKEITPNLNKLVQKSLYFPNTFEQVNEGTSSDADLMVNTSMLPL
FT                   RQGSTFFRYPNTNYNSLPNLLEGEGYATSAIHPDKGSFWNYKNGLLGIGFDKFTDYYSF
FT                   NVDEQIGLGISDKRYFEQVVPMLKELKQPFYAETVTLTSHGPFDLPEKYRELGLDPELN
FT                   ESKLGGYFESLHYTDKQIGYFIDQLDKEGLLKNSIIAIMGDHTGIHKYYDDSIGQLSHK
FT                   EDWYLNTGNPTVPFIIYNPSTNEGKTFDKMYNGEIDVMPTLLYLLGVDKDKYENTILGR
FT                   NLLNTNKSFAVITNGTLKGGENLTDKEKDIYKKSLDLSDKMIRANYAHNSN"
FT   gene            458370..458942
FT                   /locus_tag="Cbei_0373"
FT   CDS_pept        458370..458942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0373"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: cpr:CPR_2206 predicted transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32561"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD1"
FT                   /protein_id="ABR32561.1"
FT                   /translation="MKEIDCRGLSYLQIIREVKKYFNSIGEGEAVVVVNNELGRSNVIR
FT                   YAAHKGYKVDMEDEKSRFLIKMEKRGCLESEDEEEIFSILITRDKIGEGNDDLGITLMS
FT                   EYFEALNEYDKLPKEILFLNSGVKLFKRDSKAIEDIRMLYKKGVKLLISDTSLDYYKLT
FT                   EQITFGEIASMYDMVVAMKKAKKLIKL"
FT   gene            458967..459923
FT                   /locus_tag="Cbei_0374"
FT   CDS_pept        458967..459923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0374"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: cpe:CPE2235 probable monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32562"
FT                   /db_xref="GOA:A6LQD2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD2"
FT                   /protein_id="ABR32562.1"
FT                   /translation="MPDYELIIIGAGIAGMTAALGAAREGITKILIIEKESNVGGIINQ
FT                   CVHNGFGKNFLDEPVTGPEYIDFIERQLGEFEIEILLDTTVLEVTEGKKVTYVNSRDGI
FT                   KDLTAQAIIFAMGAKETYSGNVIIPTNGLTGIFTVGEAHKIINLDGYLPGRRTVIIAKN
FT                   KWGFIVARRLIVEGGNIEAVVIENTFEEMVNSEIRDIIDGFDIPVIENSRVTEIEGKTR
FT                   IEKLKIVNLENEEIIEKECDSLLLSVNFLPETTVIKKTSFDINSKTSGFEVVDFATSLE
FT                   GFFACGNVIYGENAFWMEETDGIQCGIIAARFVKESM"
FT   gene            complement(460001..460564)
FT                   /locus_tag="Cbei_0375"
FT   CDS_pept        complement(460001..460564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0375"
FT                   /product="lipolytic protein, G-D-S-L family"
FT                   /note="PFAM: lipolytic protein, G-D-S-L family; KEGG:
FT                   ctc:CTC00881 putative arylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32563"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD3"
FT                   /protein_id="ABR32563.1"
FT                   /translation="MNNKLDIIFFGDSLTLGYGVTKQNSWVYKLTQERSLSSLNKACNG
FT                   DTTTSMLTRYNDDVLIYSPSKIFIMGGSNDLLLGRKIPFIISNIEIMINDGLNIGSKVT
FT                   LGIPPKIIGQMANSLFSPSHLYSYAEKELQYLKDELIKLSNKYTLQFINFYDLTFNRDD
FT                   IYLDGIHMNSLGHHLMYENALNYF"
FT   gene            complement(460586..461284)
FT                   /locus_tag="Cbei_0376"
FT   CDS_pept        complement(460586..461284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0376"
FT                   /product="endodeoxyribonuclease RusA"
FT                   /note="PFAM: endodeoxyribonuclease RusA; KEGG: cpe:CPE2233
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32564"
FT                   /db_xref="GOA:A6LQD4"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD4"
FT                   /protein_id="ABR32564.1"
FT                   /translation="MSNYAKVIIKGSPITKSNFKLHNLNGRAILPHSSGKYHDRYALYE
FT                   QEIALLARNQNPDIVFSESLIALLRVYYKSEKRHPDTINITKSIFDGIEKSGLIINDAQ
FT                   ITKIFTEEYYDKENPRFELELFAESEYDFSYKVVKRTTSLKPKLYSPIRKNILSDKTSS
FT                   SATNYQKDKLDCNAENKRDKKSKKTSSNSLMSSEMIICSICNKAIISDDYVKADSGKTL
FT                   ICKKCFNKLF"
FT   gene            461761..462780
FT                   /locus_tag="Cbei_0377"
FT   CDS_pept        461761..462780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0377"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease;
FT                   KEGG: cpf:CPF_2496 O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32565"
FT                   /db_xref="GOA:A6LQD5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQD5"
FT                   /protein_id="ABR32565.1"
FT                   /translation="MDKKIILAIESSCDETAAAVVVNGREVLSNIIASQIDTHKKFGGV
FT                   VPEVASRMHIEAVDSVVKAALLEAGISIDDVDAIGVTYGPGLVGALLVGLQYAKGLALG
FT                   SKKPLIGVNHIQGHISANFIEHKDLKPPFVSLVVSGGHTFIVHVKGYRDFEVIGQTRDD
FT                   AAGEAYDKVARALELGYPGGPKIDKLAKQGNKDAIEFPRAKFQDDTLDFSFSGVKSAVL
FT                   NYLNKAKMKEEEVNKADIAASFQKAIIDVLKTNLFLTCERKGIKKIAVAGGVASNSCLR
FT                   ETLLEEGRKKGIEILFPSPILCTDNAAMIGSAAYFNYQEGAVSDLNINAKPNLKLGER"
FT   gene            462790..463791
FT                   /locus_tag="Cbei_0378"
FT   CDS_pept        462790..463791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32566"
FT                   /db_xref="GOA:A6LQD6"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD6"
FT                   /protein_id="ABR32566.1"
FT                   /translation="MKLLSHSNGVHKVEKDKTSKRSILKKCVIFFVGLFIFGFLVQILN
FT                   DFVDNTRLKSRFKYVRIDGRKMEYKLKTGGDYTVVFDGSIGTTMYEWDDVCKSLEEKKI
FT                   STFTYNREGYGFNDGGDNRTPEEQAKDLKALLRKAGAPEPYVLVGEEYGSLVLSNFANL
FT                   YSDSVAGVVLINPISEENIQTKEFKDSIKSKYYRSMFEKIGTNFSLTALLNKAGLTMEN
FT                   DTFKKYLNQNELDEFQSFENKKNYKQAVSNELENLYKGISNSQTNELLGNKPLYLITNN
FT                   EADPVKKIGNTTVTTIYKEEIKGSPMSVLDPNSVVTGVNSVLKDAKKAAKKS"
FT   gene            464057..465286
FT                   /locus_tag="Cbei_0379"
FT   CDS_pept        464057..465286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0379"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: cpe:CPE2230 probable
FT                   serine proteinase Do"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32567"
FT                   /db_xref="GOA:A6LQD7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD7"
FT                   /protein_id="ABR32567.1"
FT                   /translation="MNNNDNNEKFIDVESLPVDKGQQVAWENCFQNSNNYADPKRKKRR
FT                   GLRMLGRIAGILVLTMVGGAIGSAATYSFMKTNNVAATKQITSYIPQSFTSSTPDAMSA
FT                   ADAFNKVAPAVVIVSTKGSSNNGFMNGEVEGMGSGFIINEEGYILTNYHVIANAKEITV
FT                   TLSNNTEVSATVVNYDQDRDVAMLKLKDGTKVPAVAELGDSDEVYPGAEVIAIGTPLSK
FT                   NFAQTLTKGVISGSNRTIDDSGKSVDFIQTDAAINPGNSGGPLVNAKGQVIGINSMKIG
FT                   SDASGSSTPVEGIGFAIPINEVKNKIDALSKPILNLGIQIREIDSATAKKYDLVEGIYV
FT                   SSVEEYSPAEKGGLKIGDIIVKCDGKEAKKFDELKAIKESKNAGDTMKIEVIRDKKTVD
FT                   LSVVLEEKSN"
FT   gene            465486..465794
FT                   /locus_tag="Cbei_0380"
FT   CDS_pept        465486..465794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0380"
FT                   /product="phosphotransferase system PTS,
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS,
FT                   lactose/cellobiose-specific IIA subunit; KEGG: cpe:CPE2577
FT                   PTS system, cellobiose-specific II component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32568"
FT                   /db_xref="GOA:A6LQD8"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD8"
FT                   /protein_id="ABR32568.1"
FT                   /translation="MEEIILNIIMHSGEARTFSMEAITLAKQGNFDKAKGLIIKADEEL
FT                   GYAHNSQTSLIQGEAVNEKIEFSLLLVHAQDHLMTTMVLKDLAVELIEVHEKISSIK"
FT   gene            465807..466961
FT                   /locus_tag="Cbei_0381"
FT   CDS_pept        465807..466961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0381"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: ctc:CTC00267 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32569"
FT                   /db_xref="GOA:A6LQD9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQD9"
FT                   /protein_id="ABR32569.1"
FT                   /translation="MKNKIKYAIVFSILLLIGIVSINLFQPNKEQQVRGNIELLVNENS
FT                   YEYLVECANNFMKENDRTSISVKKLENYNHIINNNSDGSTKSKISSIAQIDRFSFDKLK
FT                   LDNYEYYNKDDKLLSEYAKNFSKYRVAQVKYGDNSIGIPLTSRPLAFYVREDLLKSYGY
FT                   ERDSLNTWDDIIRIGKDIHEKSNGKIFIINATDQDYEDLMDLLTMETLSDGDKSIDAVK
FT                   SEVQAMMKKLEDNNILNLQSGGEFLARISSINAMKEIAALDVPCTWSVNNVPSLKPGAN
FT                   KFFSSEGDNLLILNQNSENDKLIEKFITYVITNNKEAVKYVKEGKFFSSYLYTYNTKDI
FT                   EEPVKNFTGKSPLVVLSNIEEKTPIISNYDEYIKIKQEIRANTN"
FT   gene            complement(467119..468237)
FT                   /locus_tag="Cbei_0382"
FT   CDS_pept        complement(467119..468237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0382"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   cpf:CPF_2487 putative mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32570"
FT                   /db_xref="GOA:A6LQE0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE0"
FT                   /protein_id="ABR32570.1"
FT                   /translation="MKIAIDARSSTLHQGTGIGTYTSNLISEILSLDSNDEFTLFCSGK
FT                   FNKEFNKENVNIIYSSGRHGGFYEKYYIPNALNKVHADLYHIPQNGIGLDFDTKIPTIV
FT                   TIHDLIPYIMPETVGKGYLERFLNNMPNIISNSRGILTVSEYSKRDILKFFSFYPEEKI
FT                   FVTPLAANNNFKPLDKNQCKLYVKNTFKVDDPYILYIGGFSLRKNALGLIKSFCKVYKD
FT                   LNKPYKLLLGGPLKDEGEKLLSFVQENNLQDKVVFCGYIEDDILPVLYSGCDAFVYPSF
FT                   YEGFGLPPLEAMSCKAPVITSSITSIPEVTGDSAILINPYNIEELDNALVDLLNNETLK
FT                   AELSEKGYLRSLNFTWNKTAKNTLNAYRSLIS"
FT   gene            468367..469383
FT                   /locus_tag="Cbei_0383"
FT   CDS_pept        468367..469383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0383"
FT                   /product="Spore coat protein CotS"
FT                   /note="TIGRFAM: Spore coat protein CotS; KEGG:
FT                   cno:NT01CX_0586 spore coat protein S, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32571"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE1"
FT                   /protein_id="ABR32571.1"
FT                   /translation="MENNKEILKIKGYIEENYNLNVEDIEKVKNSYKVITRDERYCLKV
FT                   VKYEFSHFYFILSAMKHLQRNGFGDIPEFIMNREKKEYGNINGKYAYLTKWIPSRVSNY
FT                   DNPIELSMVSNELAKLHECSKGFTLKKEMKPRIGWFSWIDVFETRRREILDFKNRISQK
FT                   AYKSNFDLLYLDNMEKELNRAEKSIVGLQKNNYVKVMEKEVLSRGFCHHDYAHHNILID
FT                   NKKNINIIDFDYCILDSHLHDVSSLLIRSMKDGKWESDKCNLILNAYSERIEIRKEELP
FT                   IIREFIRFPQAFWQIGLQVYWEQQPWGEEFFINKLEKYLNDCEFREKFIDSYFSGGN"
FT   gene            469385..470191
FT                   /locus_tag="Cbei_0384"
FT   CDS_pept        469385..470191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC00270 putative spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32572"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE2"
FT                   /protein_id="ABR32572.1"
FT                   /translation="MDELLINQYLNKKGIAIMGQGFSYDKNMQRNDIVSQVDLIIEFHK
FT                   LLLGGNLTGLSKIKSTIGREVESYKVQIRKLQKNYSYVSSKTCTNEIENIILSNGKIML
FT                   EKANKAINYIYEHDYFGVIRRSMNREEICLGKVDKSNLRKNNEKIEVCTIKGMTYNLVE
FT                   EDLYNYIKKLQRKEINIDEEELIKLFVHGSHLSFNSFDYLRGLCSYPKDFLKFWERYRD
FT                   SRKDNTREIYNIQNEECKGSRKARNDEQLLNGLKKSLKYESKNFII"
FT   gene            470247..471302
FT                   /locus_tag="Cbei_0385"
FT   CDS_pept        470247..471302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0385"
FT                   /product="Spore coat protein CotS"
FT                   /note="TIGRFAM: Spore coat protein CotS; KEGG: cpe:CPE2220
FT                   probable spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32573"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE3"
FT                   /protein_id="ABR32573.1"
FT                   /translation="MNRTKYSEKNYLCDYDLSLKFFEELGIKVNDIVPLRKVFLVYTDE
FT                   GNKILKRVNYDVDRVNLISDSLDYVKKSYEHVITYKRFKDDLCYKEWNGQIYIVMDILN
FT                   GREASFSNPVEIDLCAENIALMHKASKGLREYLKDKYKKDFLDISLKDKIKEAYDDLIW
FT                   MKSLVDTYKYKNEFDKLFVNNVDKYLNEIKEVQNDLEKSSYDNLRQDGDTIRLCHNDLA
FT                   YHNFLTKNNEINIIDFDFMTIDLRVMDIWNFILKCIKNAAFDVDKMSTCINGYENVSIL
FT                   KKEEKELLYILIKFPKDFYTISRDYYHKRKNWEYEVYLSRFEGKLSNEDFRYEFLKVLE
FT                   NKFFIGAEVKK"
FT   gene            complement(471626..472747)
FT                   /locus_tag="Cbei_0386"
FT   CDS_pept        complement(471626..472747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0386"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ctc:CTC00272 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32574"
FT                   /db_xref="GOA:A6LQE4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE4"
FT                   /protein_id="ABR32574.1"
FT                   /translation="MKIGIDGRAAKWYRGTGIGTYTYQLISSLNNVDSNNNYLIFTPQC
FT                   DFISDLKNNFKTELIESIPSNSFWDDINVPNILNNADIELYHVPQNGVGLSENVECKKV
FT                   ITLHDIIPLRMPETVSDRYLKIFNNELPKILDNCDGIITVSNYSKDDIAKEFNFPAEKI
FT                   YVTQLAAEDIYRPMSKCRSKDFITEKYGIKEDFVLYVGGFSPRKNIIGLIEAYSKLPNK
FT                   LKESFKLVIIGRKGPSYTKYKNRADDLNISNNVIFTDFIPIEDMPLFYNAAEVLVYPSF
FT                   YEGFGLPPIEAMACGTPVIASNVTSLPEVCHESALFIDPNDIDSLSYDIERVLSNSLLR
FT                   LTMVKKSLTRSKNFSWNKTALDTISAYEAIINS"
FT   gene            472856..473854
FT                   /locus_tag="Cbei_0387"
FT   CDS_pept        472856..473854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0387"
FT                   /product="Spore coat protein CotS"
FT                   /note="TIGRFAM: Spore coat protein CotS; KEGG: cpf:CPF_2482
FT                   spore coat protein CotS"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE5"
FT                   /protein_id="ABR32575.1"
FT                   /translation="MMREFEIERQFNIKIEKIKANKGVYYLKTDKGERCLKKINYGPQK
FT                   LLFVYGAKEHLRKNGFNNLDKYYLNINGEPYALVNEDLYTLSEWLEGRECDFHNIDEVK
FT                   IAAKTLANLHEASKGYDPPENSKLKSDLGRWPHLIEKRIKSLDKMRDMVRKKSIKSDFD
FT                   MLYLKSMEFYKEIGKKSLVTLNESDYYELCAIAENEKSFCHHDFTYHNIILSDSMDVHV
FT                   IDFDYCKREVRTFDISNFMIKVLKRVEWNLEFATAIIESYDSVSKLKPEEYKVLYAYLQ
FT                   FPQRYWRLANRYYYNEVNWGQNTFAGKLESIIHEQEKYLEFLEKFKNEYKI"
FT   gene            474017..474877
FT                   /locus_tag="Cbei_0388"
FT   CDS_pept        474017..474877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0388"
FT                   /product="peptidase U57, YabG"
FT                   /note="PFAM: peptidase U57, YabG; KEGG: cpe:CPE2217
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32576"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE6"
FT                   /protein_id="ABR32576.1"
FT                   /translation="MEIGDIVVRKSYNKDITFKIIDIKDSGGKYNIILKGINIRIIADA
FT                   SLDDLEMAEEDTGSQDKILNTRVNEAIKKAMILRGDLRDKVEKSPKIKTKNELMFGRPG
FT                   KILHVDGDSEYMETCLKVYKQLSLDAVGRAIAEKDQPEVIVDLVKEIKPDIVVLTGHDS
FT                   VLREPRDYLNLDNYRNSRYYLESVKNLRNYNSSYDELVIFAGACQSCYERILDVGANFA
FT                   SSPNRVLIHCLDPVFVCEKIAYTRIDKVVSITDVIENTITGIKGVGGLQTRGKYREGYP
FT                   KSPYI"
FT   gene            475116..475655
FT                   /locus_tag="Cbei_0389"
FT   CDS_pept        475116..475655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0389"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: glutathione peroxidase; KEGG: cpr:CPR_1026
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32577"
FT                   /db_xref="GOA:A6LQE7"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE7"
FT                   /protein_id="ABR32577.1"
FT                   /translation="MIYDYLVKDINGNSVSMETYKGKVLLIVNTATGCGFTPQYEGLQK
FT                   LYDKYKDSGFEILDFPSNQFFEQAPGTNEEISNFCKLTYGTTFKTFAKIDVNGENSDPL
FT                   YVFLKKEAPIASEDDASKGLYNLLSEKGFNTSGDDIKWNFTKFLVSKEGKVIARFAPTY
FT                   EPEKIADQIEKLINEK"
FT   gene            476271..476513
FT                   /locus_tag="Cbei_0390"
FT   CDS_pept        476271..476513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0390"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   cac:CAC2904 uncharacterized protein, VEG B.subtilis
FT                   ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32578"
FT                   /db_xref="GOA:A6LQE8"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE8"
FT                   /protein_id="ABR32578.1"
FT                   /translation="MEKVKTIASIKNDIERHVGQKVTLKANGGRKKILVNDGIIESVYP
FT                   SIFVIRLKNDTQRTVTYSYSDVLTKTVQLVFPTRI"
FT   gene            476977..478539
FT                   /locus_tag="Cbei_0391"
FT   CDS_pept        476977..478539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0391"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG: ctc:CTC00280
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32579"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQE9"
FT                   /protein_id="ABR32579.1"
FT                   /translation="MADIDIVKENVQFEQLLRENNTNSVLKDEYLIPDTHPDVQEILTV
FT                   EARPMVTNKEIIGDKVVIEGKVEYTVIYLAKEEGLAVNSVNYNQNFTNNIDLNQGENRV
FT                   ICEAECNIEHIEANIMNERKISIQGIVTVDWELYKSNEFEFVKDIEGNDQVEVLKKTET
FT                   INKINATEDVELVGKSMIRVGMDKPQISKILKCSLLLHKKEIKITEDKVYLGCYCKLNI
FT                   LYKGEDSKEIIPLEDDIYLSKEEEINGITSDMIPTVSYEISNNDLMLEEDDLGEIRIIN
FT                   DELVVRANVKIFSKENIDTIKDAYSTNCLLSLKKDEHEVGILHGMNNSEAIVKYNIQLK
FT                   DNDLRPEHIISANGAIILTDKQVVKDRVIVEGIIKASILYKTTDEEKYLSSVKAEIPFS
FT                   AAIDIAGADENMKSIIKSNLENIEAAIEGNNIAIKATVILSGRVLYEMNKEFVSDVVEE
FT                   EGDIPEKKASITIYVIGKGDTFWNLAKKYNTTVDDLIKINKIEDPEHIEEGQKLIIPGR
FT                   AIF"
FT   gene            478869..479714
FT                   /locus_tag="Cbei_0392"
FT   CDS_pept        478869..479714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0392"
FT                   /product="cyanophycinase"
FT                   /note="TIGRFAM: cyanophycinase; PFAM: peptidase S51,
FT                   dipeptidase E; KEGG: ctc:CTC00281 cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32580"
FT                   /db_xref="GOA:A6LQF0"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQF0"
FT                   /protein_id="ABR32580.1"
FT                   /translation="MKKVLSGNLIIIGGAEDKEGKKEILKRVCDSIDKSKDTLLIATIA
FT                   TDYPKEAANKYKEVFGELEVKNIKVLDISERTEASDDMNVELIRDSSLIFFTGGDQLKI
FT                   TSLIGGTPVYDALEEAWKNGAFIVGTSAGASVMSDTMIVQGEDDDDPRKCTLKMSPGLG
FT                   LIKDVIIDQHFAQRGRIGRLLTGIAQNPEVLGIGIDENTGIVVNQSGMIEVIGEGAVYF
FT                   IDGSAITYTNVSELYADDILSMHNVKLHVLTDGNKFDLIKKSPFEEEKFNHEDNTKENI
FT                   "
FT   gene            479686..482328
FT                   /locus_tag="Cbei_0393"
FT   CDS_pept        479686..482328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0393"
FT                   /product="cyanophycin synthetase"
FT                   /note="TIGRFAM: cyanophycin synthetase; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase, middle
FT                   domain protein; KEGG: cpf:CPF_2477 cyanophycin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32581"
FT                   /db_xref="GOA:A6LQF1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQF1"
FT                   /protein_id="ABR32581.1"
FT                   /translation="MKIIQKRIYEGQNIYSHKKCIRIDMDLEGYSEIPSKDIPNFNFNL
FT                   VNIIPELKNHRCGIDEEGGFVKRLKEGTYLAHICEHTMIAIQNNLGIDVAYGKAREIKG
FT                   DMYYIIVQYEYKNTILEVANLAIDLMNSLIAQNPINFDGRMKIIQNILQNEQMGATTKA
FT                   ICDAAREYKLPVMQLGDSTIYQIGYGKAGRIIEASIGNKTSCVGVDISCDKLLTKQLLQ
FT                   TQNIPVADGSKVLNLIGLLQEAERIGYPVVLKPQCGNKGQGVILNIKDQKQLVDAYINL
FT                   RKNQKDIILEKYFEGSDYRVCVVNYKVVAVSLRIAPYVIGNGKDSLRMLIDVLNKDPLR
FT                   GEDHEKALTKIKIDAELISCLSKRGLELNYIPEEGEKILLRENANLSTGGIAIDCTDEI
FT                   CEENIESCINAAKTLGLDICGVDICAKDISVPLKDNNGVVLEINAAPGIRMHHFPSKGK
FT                   RRNVGKAILETLYDEEPKNIPVISITGTNGKTTTTRLISHVLRKMGSNVGMTSTDGVYL
FT                   NEKCIHKGDDSGFNSARSILMNKDVDVAVLETARGGLVKRGLAYELADVAIITNITNDH
FT                   LGLDGINSIEELSFTKALVGEAVKDDGFVVVNADDKYSKTVINRFSAEKIYFAKDKENP
FT                   LIQENIANGKIAVFVEDDKICVINNKKKYEIVSTRELPISYNGTLEYNIENAMAACAGL
FT                   VGLEVDYCMISKGFMDFGLKNEDNSGRFNMYNYLNRRVILDYAHNIEGYRAIISSLRKI
FT                   KGDNDLIGVIGIPGDRKDDIGYAIGEICANNFDKIVIKEDKDKRGRKSGEIADILEKSI
FT                   LKTNKNANLKICLDEVQALKYAIDISNKGDIIVVFYEKLDSLLEFINEEPNKQLDAFDE
FT                   EYKQYSNTL"
FT   gene            482477..483319
FT                   /locus_tag="Cbei_0394"
FT   CDS_pept        482477..483319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0394"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase, C terminal domain
FT                   protein; KEGG: cpf:CPF_2476
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32582"
FT                   /db_xref="GOA:A6LQF2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQF2"
FT                   /protein_id="ABR32582.1"
FT                   /translation="MKIKAYAKINIALDIVGKREDGYHILKMIMQTIDLYDIIEIEKTE
FT                   SEIRLNCNKHYVPTDERNLAYKAAKIFKETYSISQGVDIKLTKNIPVSAGLAGGSTDAA
FT                   GVLKLMNKMFNVNASDEELKSIGLRLGADVPYCIKGGTALCEGIGEKITQLKSFKDKII
FT                   VLVKPPFGVSTKEVYKCFDLSKVVFHPKIDSLIENMNNDDVYFVANNMKNLLENVTLRK
FT                   HRVITNIKEEMKSIGSIGTMMSGSGPTVFALFDDMLKAQLCYDEMKKKYKDVFITRTI"
FT   gene            483383..484120
FT                   /locus_tag="Cbei_0395"
FT   CDS_pept        483383..484120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0395"
FT                   /product="Sporulation stage II, protein R"
FT                   /note="TIGRFAM: Sporulation stage II, protein R; KEGG:
FT                   ctc:CTC00288 stage II sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32583"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQF3"
FT                   /protein_id="ABR32583.1"
FT                   /translation="MIKYLKLKKIVLVVLITLSINIFSGCTSIVRGNSTSLVNSLIATE
FT                   SNKNDNNMRVLNYDEVKDSLIRFHVIANSDNDDDQQLKLKVKNRVIDYLYPYLNSSQSL
FT                   DESRKIIKDKMEDVKTLAQQVIKDNNYDYDVKVELSRENFPDKSYGNITLPQGNYEAFR
FT                   IIIGSGQGRNWWCVMFPPLCFVDESKAQVEYDKTENKIKSNGKSFELESKDDSTENVGD
FT                   KQADGNNIKIKFKIVEIFRDIFK"
FT   sig_peptide     483383..483481
FT                   /locus_tag="Cbei_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.702 at
FT                   residue 33"
FT   gene            484252..484668
FT                   /locus_tag="Cbei_0396"
FT   CDS_pept        484252..484668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0396"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   cpf:CPF_2473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32584"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQF4"
FT                   /protein_id="ABR32584.1"
FT                   /translation="MKKKAIITVDSYVLDNEEDLVGVVTPGDFHEIEDGFKVEYEETKL
FT                   SGMEGTKTTIIIRNDSFDLIREGTTETKMEFRNNHRTISLYKTPYGVMDLQIDTKKLNI
FT                   DISKEGGTITAMYILEIGGQPALKTNLTIGVKLN"
FT   gene            484774..485082
FT                   /locus_tag="Cbei_0397"
FT   CDS_pept        484774..485082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32585"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQF5"
FT                   /protein_id="ABR32585.1"
FT                   /translation="MQNGLKYIEILNNICKYYGIDEENSIELLKNRDNKYILLLLLKYN
FT                   HCLDTERVKEVFNLKTSKSISNNLKLAEEKLLINRLFREKYFELEDNIGKNSMTNLL"
FT   gene            485247..486857
FT                   /locus_tag="Cbei_0398"
FT   CDS_pept        485247..486857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0398"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase; KEGG: cpr:CPR_2182 CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32586"
FT                   /db_xref="GOA:A6LQF6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQF6"
FT                   /protein_id="ABR32586.1"
FT                   /translation="MSTKYVFVTGGVVSALGKGITAASLGRLLKNRGVKISIQKFDPYL
FT                   NVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDESLTQNSNVTTGKIYSSVIEKER
FT                   RGEYLGGTVQVIPHITNAIKDKVYQVAKDRDVDVVITEIGGTVGDIESQPFLESIRQIK
FT                   SEVGAENVCYIHVTLVPYLGKAGELKTKPTQHSVKELRMIGIQPDIIVCRTEKELSDDV
FT                   KAKIGLFCNIDGRSVIQNLDAENLYEVPLMLHSEGLDNLVCEKLHLGCKDIDNSEWIQM
FT                   VQKIKNLKNNVKIALVGKYVELHDAYISVVEALSHGGYANNTNVEIKWINAENIENSNA
FT                   QELLKDVDGILVPGGFGDRGIEGKIAAIKWARENKKPFLGICLGMQCAVIEYARSVLGY
FT                   EDANSSEINPGTNYPVIDLMPDQKDIENLGGTMRLGLYPCRLAENTNSYEVYKNEIINE
FT                   RHRHRYEFNNEFRKQITEAGMKIAGTSPDERLVEIVEVEDHPWYVAVQFHPELKSRPNK
FT                   PHKLFVGFIKAALEENKSK"
FT   gene            487168..488610
FT                   /locus_tag="Cbei_0399"
FT   CDS_pept        487168..488610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0399"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; SMART: AAA ATPase; Cold
FT                   shock protein; KEGG: ctc:CTC00296 transcription termination
FT                   factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32587"
FT                   /db_xref="GOA:A6LQF7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQF7"
FT                   /protein_id="ABR32587.1"
FT                   /translation="MTKKEYESMTLTKLKDIAKDLGVKNISKYKKNELIEEILKVPSNF
FT                   IEKNGVILRENIAPKNVEETRSVMPRSNNTESNKESNDSEVKSRTNEIGNVEKKENLKE
FT                   MINESNVANGILEILENNSFGFLRCKNYLTSSEDVYVSPSQIRRFNLRTGDEVEGKVRE
FT                   AKETEKFKALLFVQKVNGEHPEKAIGRKSFETLTPIYPKERLKLETSDSNDLSSRLMDI
FT                   ICPIGKGQRGIIVAPPKAGKTTLLKKIAQNISKNYPDVKLIVLLIDERPEEVTDMKRSI
FT                   NGDVVYSTFDEEPQNHAKVAQMVLERAKRMVEQGKDVVILMDSITRLSRAYNLTITPTG
FT                   RTLSGGLDPGALIMPKKFFGAARKIEEGGSLTILATALIETGSRMDDMIFEEFKGTGNM
FT                   EVHLDRRLQERRIFPAIDIYKSGTRKEDLILSKEELEVAFSIRKKMYRDGNSDDITENL
FT                   INMLSKTGNNKEFVDVFQKKIQ"
FT   gene            complement(488651..489757)
FT                   /locus_tag="Cbei_0400"
FT   CDS_pept        complement(488651..489757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0400"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /note="PFAM: glycosyl transferase, group 1;
FT                   Glycosyltransferase 28, C-terminal domain;
FT                   Monogalactosyldiacylglycerol synthase; KEGG: cpf:CPF_2470
FT                   putative monogalactosyldiacylglycerol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32588"
FT                   /db_xref="GOA:A6LQF8"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQF8"
FT                   /protein_id="ABR32588.1"
FT                   /translation="MKKVLILTTSTGQGHNQAAASVEESFNNSGYEITKLDFLAKNSKL
FT                   LNDIIVIGYEFSASKFPKTYGFFYKLTDTNLTNKLLKLIFFMARKKVSKLINKIQPDVI
FT                   IATHSINISVISDLKKNGLDIPFILVVTDFKAHYLYVDSYVDAYITGSNYTKKSLVDRG
FT                   INPNKIYPIGIPISSKFYTEVTSANDLKDDEYFNLLLMGGSLGLTTIFTVLKELLKNPH
FT                   KLRITVVCGKNDNLKNRLISYCKENKFKNKKLHILGFTKDISYLMDYCDILISKPGGLT
FT                   VTESIVKNIPLIIPFAIPGQENENIDFLTSEGYSIYVKDLSKLNDKINYLINNPNELSK
FT                   IKLKLKELSSTYSLTKIVDIADDLISKK"
FT   sig_peptide     complement(489698..489757)
FT                   /locus_tag="Cbei_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.726) with cleavage site probability 0.313 at
FT                   residue 20"
FT   gene            complement(489971..490180)
FT                   /locus_tag="Cbei_0401"
FT   CDS_pept        complement(489971..490180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0401"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: cpr:CPR_2179
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32589"
FT                   /db_xref="GOA:A6LQF9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQF9"
FT                   /protein_id="ABR32589.1"
FT                   /translation="MREGIHPEYHHNTVVKCACGNTFTTGSVKEELKVEICSKCHPFFT
FT                   GKQKIVDVGGRVDKFNKRFNIGSK"
FT   gene            490370..490954
FT                   /locus_tag="Cbei_0402"
FT   CDS_pept        490370..490954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0402"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase; KEGG: cno:NT01CX_0551
FT                   thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32590"
FT                   /db_xref="GOA:A6LQG0"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG0"
FT                   /protein_id="ABR32590.1"
FT                   /translation="MSKLYFRYGAMNSGKSTHLMQVAYNYEERGMKVVIIKPRIDNKGG
FT                   DTLVSRLGVNRRVDLLVSDQDDIFQIISNYIKENNKIDCILVDEVQFLRESQIDQLFEI
FT                   AVKINIPIICYGLRTDFKRNGFEGSTRLLLLAHSIEEMKTICACGRKAVFNGRKINNKF
FT                   VFEGEQIAIDDEDNVEYESLCGECYYKYKEN"
FT   gene            490980..492740
FT                   /locus_tag="Cbei_0403"
FT   CDS_pept        490980..492740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0403"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; protein of unknown function
FT                   DUF1385; KEGG: cpr:CPR_2177 modification methylase, HemK
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32591"
FT                   /db_xref="GOA:A6LQG1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG1"
FT                   /protein_id="ABR32591.1"
FT                   /translation="MERRDVGGQAVIEGVMMRGSKNLATAVRTPKGNIEIDFKDNRPVT
FT                   KKYPILNIPFLRGFFVLVESMKVGMESLNYSASFLEEDNEEPSKFEKWLDDKLGEKANS
FT                   VLMAITMFISFLFAIGLFVALPTGIASVFKGAGISNVMLNLVEALIRIVILLLYMFSIS
FT                   KLNDIYRVFQYHGAEHKTIFCYEAMEELTVENVRKQSRLHPRCGTNFLFLVMFVSIIVF
FT                   SFTGWGGIIERLALRIILIPVVTGISYEIIKWLGKNDSMLAQIIAYPGLKLQLLTTKEP
FT                   DDSQIEVAIASLKAAEGIKDPNKNIEELIKTGTFTLKENGIDTARLDAELLLGNIIEKD
FT                   RVYLITHKEDEVSKEDAEKYFDLIEKRRNKMPVKYILNKCEFMGIEFYVEEGVLIPRGD
FT                   TEILVDEVLKIIEENQEMQICDLCSGSGAVGISLAHFRQNIKVDLIDYYPIPEKVSLIN
FT                   IEKNKLEDRVFFIKSDLLEESIKNNKIYDIIVSNPPYIEECEIGKLMEDVKNYEPHTAL
FT                   NGGNDGLDFYRKIIDQSQYTLRESGILAFEIGYNQGEAVKLLMENNGFTNVKIVKDFAS
FT                   LDRVVVGIKI"
FT   gene            492876..493958
FT                   /locus_tag="Cbei_0404"
FT   CDS_pept        492876..493958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0404"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   cpr:CPR_2176 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32592"
FT                   /db_xref="GOA:A6LQG2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQG2"
FT                   /protein_id="ABR32592.1"
FT                   /translation="MLLDKLEFIENKYDELSVKISDPSIMQNQNEWRKLCKEHADLEVI
FT                   VNSYREYKKVVEDLKANKEMLSGESDKEMREMLNEEITDLTNREEQLETEIQILLLPKD
FT                   PNDDKNVFVEIRGGAGGEEAALFAYNLFRMYTRYAETQRWGVEIMSLNETDLGGFKEVV
FT                   FMIKGNGAYSKLKYESGVHRVQRVPDTESSGRIHTSTATVAVLPEVDDVEIEVADKDVR
FT                   IDVFRASGNGGQCVNTTDSAVRITHLPTGLVVSCQDEKSQLKNKEKAMKVLKSRLYEQA
FT                   ERERAQGIAEDRKSQVGTGDRSERIRTYNYPQGRITDHRIGLTLYKLDTFLGGDIDEMI
FT                   NALITADQAEKMKLMGNTQM"
FT   gene            494024..494611
FT                   /locus_tag="Cbei_0405"
FT   CDS_pept        494024..494611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_2465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32593"
FT                   /db_xref="GOA:A6LQG3"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG3"
FT                   /protein_id="ABR32593.1"
FT                   /translation="MDIYKAVKKERLHLKIFLITMVIIAFFLPTVLIITGLTTIFYISY
FT                   VIFIEFLIVIAIIIKMNAYIVEYRCLNNRLIFKVGISIKEYLIICDKVVLVHTNKSDYD
FT                   LEIVLITNVVFKNKGLRPVDDGFLRRYPQIIEDYNSIKQLNSQKEYYFQVIKRGGLKKY
FT                   LLLDSIYRNCVKAIYTDESIQNIKISRGQLIV"
FT   gene            494685..495716
FT                   /locus_tag="Cbei_0406"
FT   CDS_pept        494685..495716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0406"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain;
FT                   KEGG: cpr:CPR_2174 SUA5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32594"
FT                   /db_xref="GOA:A6LQG4"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG4"
FT                   /protein_id="ABR32594.1"
FT                   /translation="MIKNVSEDEEKIREAAECIKNGGTVVFPTETVYGLGADALNEEAV
FT                   EKIFKAKGRPQDNPLIIHVSSKKLDLYAKEIPKVADELINRFWPGPLTIILSKKDIIPN
FT                   VTSANLNSIGIRMPDNEVARKLIELSQTTIAAPSANISGRPSPTDFQRCIEDLDGKVDY
FT                   ILGGEQSDIGVESTIVDCTVVPPIVLRPGGITLEMLREVDPRIEIDKAIMEKPSENLKP
FT                   KAPGMKYKHYAPNAKVTIISGERKKTIEKIREMVHYNIEKGKKVCILTVEENVDEYTEG
FT                   TSIVLGSLSDLSTVARSLFEALRKCDDLGADLVFAEGYEEKGVGVAIMNRLNKAAGFDI
FT                   INV"
FT   gene            495722..496216
FT                   /locus_tag="Cbei_0407"
FT   CDS_pept        495722..496216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0407"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /EC_number="5.3.1.26"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: cpr:CPR_2173 ribose
FT                   5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32595"
FT                   /db_xref="GOA:A6LQG5"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG5"
FT                   /protein_id="ABR32595.1"
FT                   /translation="MHVEKSQNKLGDDLIMKIAIGCDHGGLELKNEIIKFLESEKHEIK
FT                   DFGTYSTGSCDYPDIALPVAEAVAAKEYEFGILICGTGIGIGIAANKVPGIRAALCSDT
FT                   FSAHATREHNNANILTMGQRVVGAGLALDIVKTFISAKFEGDRHQKRIDKISDIEKKYT
FT                   H"
FT   gene            496366..496995
FT                   /locus_tag="Cbei_0408"
FT   CDS_pept        496366..496995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0408"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: cac:CAC2879 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32596"
FT                   /db_xref="GOA:A6LQG6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQG6"
FT                   /protein_id="ABR32596.1"
FT                   /translation="MSKVIEINHPLILHKLAILRDEKTGSKDFRKLVEEISMLMAYEVT
FT                   RDLNTEEVEVKTPVAVTKCKMLSGKKMAVVPILRAGLGMVDGVLNLIPAAKVGHIGLYR
FT                   DEKTLQPVEYFCKMPQDIAERDIIVVDPMLATGGSAIDALTMLKNRGAKNLKLMCLVGA
FT                   PEGIEAIKKAHDDVDIYLASIDEKLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            497077..497571
FT                   /locus_tag="Cbei_0409"
FT   CDS_pept        497077..497571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0409"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   cac:CAC2876 deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32597"
FT                   /db_xref="GOA:A6LQG7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG7"
FT                   /protein_id="ABR32597.1"
FT                   /translation="MERRDKKNYYLDIAETVLERGTCLRRNYGSIIVKNDEIISTGYTG
FT                   APRGRKNCMDLNSCIREKLKVPRGTHYELCRSVHSEANAIISASRRDMIGATLYLVGRD
FT                   AKTREYVRDANSCSMCKRLIINAGISNVIIRDSKQEYREISVDSWIEDDDSLRIVKDAG
FT                   Y"
FT   gene            497809..498999
FT                   /locus_tag="Cbei_0410"
FT   CDS_pept        497809..498999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0410"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   cpr:CPR_2171 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32598"
FT                   /db_xref="GOA:A6LQG8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG8"
FT                   /protein_id="ABR32598.1"
FT                   /translation="MRKIYNCLNIGGNNLSTKKIITIFGTRPEAIKMAPLVKELERREE
FT                   IESKVCVTAQHREMLDQVLELFDIKPDFDLNIMKTKQTLTGITSRVLEGLEEVFKEEKP
FT                   DMILVHGDTTTTFAGSLAAFYQQIKVGHVEAGLRTFNKYFPFPEEMNRKLTGSLADLHF
FT                   APTKGSKENLLREGINASDIYVTGNTVIDAMKHTVEDDYIFENEELNNIDFSKKVIMIT
FT                   AHRRENWGEGIQNICIALNKIVEQNEDVELVYLVHLNPVVKDVVYERLGGKERIHLLSP
FT                   LDTKETHNLMNKSFMVMTDSGGLQEEAPHLAKPVLVLRDVTERPEAVEAGTVKLVGTNI
FT                   DQIVSEANELLRNPDAYCKMSKSINPYGDGIASRRIADAILKYFGLTTREVEEFKR"
FT   gene            499121..500302
FT                   /locus_tag="Cbei_0411"
FT   CDS_pept        499121..500302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0411"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III C terminal domain protein; KEGG: cpf:CPF_2460
FT                   acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32599"
FT                   /db_xref="GOA:A6LQG9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQG9"
FT                   /protein_id="ABR32599.1"
FT                   /translation="MREVVIVSAVRTALGSFGGALKDVSAVDLGALVIKEAVNRAGVKP
FT                   ELIEEVIMGNVIQAGLGQNTARQSTIKAGLPQEVSAMTINKVCGSGLRAVSLAAQMIKA
FT                   GDADVVVAGGMENMSAAPYALDKARWGQRMGDGKLVDTMIKDALWDAFNNYHMGVTAEN
FT                   IAKQWGLTREEQDAFSAASQQKAEAAIKSGRFKDEIVPVVIPQRKGEPKVFDTDEFPRF
FT                   GTTAETLAKLKPAFIKDGTVTAGNASGINDGAAAFVVMSAEKAEELGLKPMAKILSYGS
FT                   KGLDPAIMGYGPFHATKKALEKANLTVEDLDLIEANEAFAAQSLAVAKDLKFDMSKVNV
FT                   NGGAIALGHPVGASGARILVTLLHEMEKRDAKKGLATLCIGGGMGTALIVERI"
FT   gene            501380..502069
FT                   /locus_tag="Cbei_0412"
FT   CDS_pept        501380..502069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0412"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   cpf:CPF_2458 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32600"
FT                   /db_xref="GOA:A6LQH0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQH0"
FT                   /protein_id="ABR32600.1"
FT                   /translation="MFRVEPVIPIFSPEIFGVTVDITAGIIIEWIVIAILGIGAFLLTK
FT                   NLKLKPGKTQAALEKVYQTIRDFMVGTMGEEYESFLPYIGTLMIYLLILNLVGLLGFKP
FT                   PTSDLSITASFAITTFLVVNLNAIRKNGILGFGKGLLHPFIPMLPLNIIERIILPMSLA
FT                   LRLFGNMIAAVILLELVYRGLSSISIFAQFGIPVILHAYFDLFDGLIQMIVFTMLTMIN
FT                   IKQIAEE"
FT   gene            502123..502338
FT                   /locus_tag="Cbei_0413"
FT   CDS_pept        502123..502338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0413"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   tte:TTE0631 F0F1-type ATP synthase c
FT                   subunit/Archaeal/vacuolar-type H+-ATPase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32601"
FT                   /db_xref="GOA:A6LQH1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQH1"
FT                   /protein_id="ABR32601.1"
FT                   /translation="MSLGVLAAGIAVLSGIGAGVGIGIAAGKAVEAVGRQPEASGRVMT
FT                   FFILGAALCETTAIYGLVMAFMLMGR"
FT   sig_peptide     502123..502200
FT                   /locus_tag="Cbei_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.475 at
FT                   residue 26"
FT   gene            502391..502870
FT                   /locus_tag="Cbei_0414"
FT   CDS_pept        502391..502870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0414"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   cpf:CPF_2456 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32602"
FT                   /db_xref="GOA:A6LQH2"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQH2"
FT                   /protein_id="ABR32602.1"
FT                   /translation="MEVNVSTVIFNWINFGLIILILKHFFWDKIKGIIEERQNLVNQTI
FT                   SKADEDAEKARMYLVKNEQILQSAKEEGKKITEAQRAKGDKLYEEIVQNAKVEANSVKE
FT                   RANLEIEREKEKAEYEIKKQAVDLAVELSVKALEQQVDEATHRKLIGDFIAKVGM"
FT   gene            502873..503412
FT                   /locus_tag="Cbei_0415"
FT   CDS_pept        502873..503412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0415"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: cpf:CPF_2455 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32603"
FT                   /db_xref="GOA:A6LQH3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQH3"
FT                   /protein_id="ABR32603.1"
FT                   /translation="MQEYLEKRYALALYEIAEKNNKVDEYLRDLTDICDIFDENKEFYE
FT                   VINHPKINTAKKKQLFTDLFKGKIDEELLSFMMILIEKDRILQLREILDQMEKIDLERR
FT                   NTIRGIVKTVVPLLDEELEQLKAIFEKKYEKNILFDTKIDKSLLGGVYVKVGNDIIDGT
FT                   IKSKVEEMKELMLKKE"
FT   gene            503423..504937
FT                   /locus_tag="Cbei_0416"
FT   CDS_pept        503423..504937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0416"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; KEGG: cpf:CPF_2454 ATP
FT                   synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32604"
FT                   /db_xref="GOA:A6LQH4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQH4"
FT                   /protein_id="ABR32604.1"
FT                   /translation="MNIKPEEITSIIKKEIEKYEKDIKTVDSGTIIQIGDGVSRVYGLD
FT                   NCMQGELLEFPNNVYGMVLNLEQDNVGCVLLGEEKGIKEGDTVKGTGRVVEVPVGEAMI
FT                   GRVVNALGEPIDGKGPISTSQTRAIEIPAAGIIDRSSVNEPLQTGIKAIDSMIPIGRGQ
FT                   RELIIGDRQTGKTAIAIDTILNQKGKDVICIYVAIGQKQSTVAHIFNTLTEMGAMDYSI
FT                   VVSATASESAPLQYMAPYSGCTIGEYFMHQGKDVLIIYDDLSKHATAYRAMSLLLKRPP
FT                   GREAYPGDVFYIHSRLLERAAKLSKELGGGSITALPIIETQAGDVTAYIPTNVISITDG
FT                   QIFLESDLFNAGQRPAVNAGISVSRVGGSAQIKAMKQVSGTLRLELAQYRELEAFSQFG
FT                   SDLDADSSRRLEKGKRLVEVLKQDQYSPLEVGKQIIILYAAVNDFLSDIKVSDIKRFEK
FT                   EFLEYVDTHHREIEKSIITGKTLTDEIKSMLEEAIVEFKKIFLQEA"
FT   gene            504979..505830
FT                   /locus_tag="Cbei_0417"
FT   CDS_pept        504979..505830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0417"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit; KEGG:
FT                   cno:NT01CX_0531 ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32605"
FT                   /db_xref="GOA:A6LQH5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQH5"
FT                   /protein_id="ABR32605.1"
FT                   /translation="MGAAGLLEIKKRIKSVENTRKITNAMGLVATSKLRKTKNELAVNN
FT                   KFIDITEPVVRNLATTAGEEGSNVYFEGNDSQNKLYVVITSDSGLCGGFNSSVVSQLVS
FT                   QIKDKKDTAKIVLVGSKGLGYLKRIKIEPVGEYVGIEDVPTVSEAKEIFDKALEMYLNG
FT                   DVSEVNIVYSDFISSVKQETKSVKILPISKSEGTTGSFLIEPDLDIVLEDALNIYLKGK
FT                   IRSILLSSKCSEQSTRMTAMDGATKNADDLLDKLKLKFNRIRQGAITQEISEIVGGAAA
FT                   QN"
FT   gene            505845..507236
FT                   /locus_tag="Cbei_0418"
FT   CDS_pept        505845..507236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0418"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase; KEGG:
FT                   cno:NT01CX_0530 ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32606"
FT                   /db_xref="GOA:A6LQH6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQH6"
FT                   /protein_id="ABR32606.1"
FT                   /translation="MPGKMGKVVQVIGPVIDIKFDSDSLPDLYNAIVIKAGDYELVAEV
FT                   EQHVGDDIVRTIAMSATEGLKRGMDAVDTGAPISVPVGEEVLGRLFNVLGKPIDKCGDI
FT                   EVKQEYPIHRPAPSFKDQSVEPEMFETGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIQ
FT                   ELINNIAKQHGGLSVFTGVGERSREGNDLYHEMRESGVIDKTALVFGQMNEPPGARMRV
FT                   ALTGLTMAEYFRDKGQDVLLFIDNIFRYTQAGSEVSALLGRTPSAVGYQPTLATEMGAL
FT                   QERITSTVNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPL
FT                   ESTSRILDPRIVGEEHYKVAADVKHVLEKYKQLQDIIAILGVDELGDEDKAVVARARRI
FT                   QRFLSQPFTVGEQFTGLKGKYVPVKETVRGFKEILEGKYDELPESAFLFAGTIDDVIEK
FT                   AKKLG"
FT   gene            507252..507659
FT                   /locus_tag="Cbei_0419"
FT   CDS_pept        507252..507659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0419"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: cno:NT01CX_0529 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32607"
FT                   /db_xref="GOA:A6LQH7"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQH7"
FT                   /protein_id="ABR32607.1"
FT                   /translation="MANTFLLKIITPGREVYNDQVEKVTLKSADGEFQVLANHQSLIST
FT                   TIPCIAKFKDAKGNDEELFISKSLVQINNNEMVISSDAAEFEEDIDEERAERAFRRAED
FT                   RLKNSENYNRGRAEAAFFRAKQRLALKKSNR"
FT   gene            507874..508524
FT                   /locus_tag="Cbei_0420"
FT   CDS_pept        507874..508524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpf:CPF_2450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32608"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQH8"
FT                   /protein_id="ABR32608.1"
FT                   /translation="MNIKMSIVIFILLSFFNIGAISSDIVSAQNSFNTLEMKVKDISEF
FT                   QENGVKLQYRTKNNIANEAYRIKENLPRNMALSYKDGGNDEFEAFNSDFNIDIKIWRED
FT                   VYSYVEIILTNKNPKYGTKYLKNILKNIENSKLENMQYFLYYEGKEKGLDSDYFTNGLV
FT                   SEYNIRKAQLMKISNGYSGTGYLNDGEKINFALVDYDTGSHIIIGTPIIFTTY"
FT   sig_peptide     507874..507942
FT                   /locus_tag="Cbei_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.473 at
FT                   residue 23"
FT   gene            508686..509948
FT                   /locus_tag="Cbei_0421"
FT   CDS_pept        508686..509948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0421"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   cno:NT01CX_0527 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32609"
FT                   /db_xref="GOA:A6LQH9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQH9"
FT                   /protein_id="ABR32609.1"
FT                   /translation="MEKIVVKGVKELRGEVNISCAKNSILPIIAATILCPEPIIIDNAP
FT                   RLEDVEVICKLLSELNCDVNISNVNDRLTINTKNIVEMDANEELMRKMRASFLIMGPML
FT                   ARFGYCKLSLPGGCNIGSRPIDLHLKGFKLLGAEVVIGHGFVEVRAKKIVGNRIYLDFP
FT                   SVGATENIMMVSVFAEGTTIIENAAEEPEIWDLAQFLNKMGAKIEGAGFGKITITGVKN
FT                   LKGISYTPIYDRIEAGTFMIAAAITNSKIKINGVNEEHLRPVIEKLRECGIGFSNYKDH
FT                   SIVVDGRGSKRPLDIKTLPYPGFPTDMQAQMMSLLSIVEGVSVITETVFENRFMHVAEL
FT                   QRMGANIKIDGRTAIIEGKPRLTGCEVKATDLRAGAAMILSGLVADGETVVNDVYHIDR
FT                   GYVRIEEKFRNLGAEIYRINM"
FT   gene            510516..511574
FT                   /locus_tag="Cbei_0422"
FT   CDS_pept        510516..511574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0422"
FT                   /product="Sporulation stage II, protein D firmicutes"
FT                   /note="TIGRFAM: SpoIID/LytB domain; Sporulation stage II,
FT                   protein D firmicutes; PFAM: Stage II sporulation D domain
FT                   protein; KEGG: ctc:CTC00315 stage II sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32610"
FT                   /db_xref="GOA:A6LQI0"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI0"
FT                   /protein_id="ABR32610.1"
FT                   /translation="MKIINARTTSIKISNNVKIIAAMTLIIFTILIALPIAFLENGKGK
FT                   IDSFNLSDKDIMKSSKITFPSNGKVKLYHRSEDRVEEIDLEEYVMGVVASEVPANFEEE
FT                   ALKAQAVAARTFYMSKRNNPNKEEKEKGAEICDTTHCQVYMSKDERISKWSKSEAESNW
FT                   EKIQKAVLDTKGQVLTYDGSVLEYPQFFATSSGKTEDAKDVFSMDVPYLKSEDSKGEEI
FT                   APKYKTSTQIPINDFINKINSKYKGVNANKSNLSSLIKILSFTEAGSVKEIKIGNEIVK
FT                   GTEFRTLFNLNSTNFTLDFQQDSVEVNCKGYGHGVGMSQWGANAMAKSGSKYDEILKHY
FT                   YSGVEIQEINYN"
FT   sig_peptide     510516..510635
FT                   /locus_tag="Cbei_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.551 at
FT                   residue 40"
FT   gene            511999..512751
FT                   /locus_tag="Cbei_0423"
FT   CDS_pept        511999..512751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0423"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: ctc:CTC00316 conserved
FT                   membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32611"
FT                   /db_xref="GOA:A6LQI1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI1"
FT                   /protein_id="ABR32611.1"
FT                   /translation="MEVFILDKNLKEKLKNLFRKEGFYIALFLCLCIVVTVGTISYKML
FT                   NSKNQVNKTEDVNKDLTMNSGNEGNSNNSVQNAERVENAQNNSNKDNADKTKTEKAASV
FT                   STNNTVTFVNPIDGVESRKYTYPAPVKMEEGVFRTIRGINLQSTVGSEVKAAADGVVEV
FT                   AENTGVEEGVVVEIKHANGLKTRYGNLDANLSVKKGDKVKANQVIAKVGDSAKVFSKDV
FT                   FGEFLNLQVINANGEQVNPEKYFNLKSK"
FT   gene            512859..513113
FT                   /locus_tag="Cbei_0424"
FT   CDS_pept        512859..513113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0424"
FT                   /product="Sporulation stage III, transcriptional regulator
FT                   SpoIIID"
FT                   /note="TIGRFAM: Sporulation stage III, transcriptional
FT                   regulator SpoIIID; KEGG: cpr:CPR_2156 stage III sporulation
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32612"
FT                   /db_xref="GOA:A6LQI2"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI2"
FT                   /protein_id="ABR32612.1"
FT                   /translation="MKDYIEERVLDVARYIIDSKATIRKTAKVFGVSKSTIHKDMTERL
FT                   LKINPEIAQETHSILELNKAERHIRGGKATQMKYKIIES"
FT   gene            513193..514227
FT                   /locus_tag="Cbei_0425"
FT   CDS_pept        513193..514227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0425"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: cno:NT01CX_0523 cell
FT                   shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32613"
FT                   /db_xref="GOA:A6LQI3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI3"
FT                   /protein_id="ABR32613.1"
FT                   /translation="MCFWRTGIDLAIDLGTATVLVYVKGKGVILKEPSVVAINKNNNKL
FT                   LAIGEEARKMIGRTPGNIVAVRPLRDGVISDYDITQKMLKEFIKKACGKRSISAPKVIV
FT                   CVPSQATEVEKRAVIDAAMNSGAKTVHLIEEPLAAAIGAGLDITKPNGCMVVDIGGGTC
FT                   DIAVISLGGVVERESIKVAGDKFDEAIIKYVRNEYKLMIGEKTAEDLKINIGSAFKNSR
FT                   NLTCMMKGRNLITGLPDEIEITTEEIRNAIKEPVEIIVDTVKKVLERTPPELASDIIER
FT                   GILMTGGGALIHGLDKLIEFKTGVVATIAENSVECVANGTGKVLNYIDKLDSQVNSQQI
FT                   VLIE"
FT   gene            complement(514295..514831)
FT                   /locus_tag="Cbei_0426"
FT   CDS_pept        complement(514295..514831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0426"
FT                   /product="protein of unknown function DUF1256"
FT                   /note="PFAM: protein of unknown function DUF1256; KEGG:
FT                   cac:CAC2857 spore protease GPR related protein, YYAC
FT                   B.subtilis ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32614"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI4"
FT                   /protein_id="ABR32614.1"
FT                   /translation="MSKPDIKLDPKFYYNLALEVKKFISKDTIIVCIGTDKCIGDCLGP
FT                   LVGSILTENFFPLPVYGTLSSPIHALNIDERLNEIYSNHPNASIIGVDACLGDEDDIGE
FT                   IRIRDYAIHPGKGVGKELPEVGIASVIGIVDSSDNAEFFFSRSIRLSFIMDMAKIISKI
FT                   FIDAYSLSHGKYPKI"
FT   gene            514932..515336
FT                   /locus_tag="Cbei_0427"
FT   CDS_pept        514932..515336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpe:CPE2178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32615"
FT                   /db_xref="GOA:A6LQI5"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI5"
FT                   /protein_id="ABR32615.1"
FT                   /translation="MKKVLMYLVLVPTIIINMYFLLYWQPQDENSAKEVVVQETVSYSK
FT                   PLYKINKEKALSQLSTDNKKELEKIIKKLSAFDIGKIKEYYEDTNDNESLIEIFKILKR
FT                   RLTTEDYKKIQEISSSFLDIQEINKRIKNN"
FT   gene            515496..515580
FT                   /locus_tag="Cbei_R0057"
FT                   /note="tRNA-Tyr1"
FT   tRNA            515496..515580
FT                   /locus_tag="Cbei_R0057"
FT                   /product="tRNA-Tyr"
FT   gene            515590..515665
FT                   /locus_tag="Cbei_R0058"
FT                   /note="tRNA-Val1"
FT   tRNA            515590..515665
FT                   /locus_tag="Cbei_R0058"
FT                   /product="tRNA-Val"
FT   gene            515693..515767
FT                   /locus_tag="Cbei_R0059"
FT                   /note="tRNA-Thr2"
FT   tRNA            515693..515767
FT                   /locus_tag="Cbei_R0059"
FT                   /product="tRNA-Thr"
FT   gene            515780..515864
FT                   /locus_tag="Cbei_R0060"
FT                   /note="tRNA-Tyr2"
FT   tRNA            515780..515864
FT                   /locus_tag="Cbei_R0060"
FT                   /product="tRNA-Tyr"
FT   gene            515874..515949
FT                   /locus_tag="Cbei_R0061"
FT                   /note="tRNA-Val2"
FT   tRNA            515874..515949
FT                   /locus_tag="Cbei_R0061"
FT                   /product="tRNA-Val"
FT   gene            515980..516054
FT                   /locus_tag="Cbei_R0062"
FT                   /note="tRNA-Thr3"
FT   tRNA            515980..516054
FT                   /locus_tag="Cbei_R0062"
FT                   /product="tRNA-Thr"
FT   gene            516067..516151
FT                   /locus_tag="Cbei_R0063"
FT                   /note="tRNA-Tyr3"
FT   tRNA            516067..516151
FT                   /locus_tag="Cbei_R0063"
FT                   /product="tRNA-Tyr"
FT   gene            516603..517778
FT                   /locus_tag="Cbei_0428"
FT   CDS_pept        516603..517778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0428"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   cpr:CPR_2145 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32616"
FT                   /db_xref="GOA:A6LQI6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI6"
FT                   /protein_id="ABR32616.1"
FT                   /translation="MRRLFTSESVTEGHPDKMCDQISDAILDAILSKDPMARVACETCT
FT                   TTGMVMVMGEITTNCYVDIPKVVRETVREIGYDRAKFGFDCDTCSVLTSIDEQSADIAM
FT                   GVDEAFESKKGEKDEVEAVGAGDQGMMFGFATNETEDFMPLPVYMAHKLSRRLTEVRKN
FT                   GTLSYLRPDGKTQVTVEYEDNVPKRIDTIVISTQHDEKVTLEQIQEDLKKFVIEAVVPA
FT                   ELLDSETRYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDR
FT                   SAAYAARWVAKNLVAAGAADKLEIQLAYAIGVAKPVSIEVETFGTGKVDEDKIVEVVEK
FT                   VFDLRPGAIIRDLDLRRPIYKQTAAYGHFGRNDLNLPWEQLNKVDEIRKNL"
FT   gene            518230..520458
FT                   /locus_tag="Cbei_0429"
FT   CDS_pept        518230..520458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0429"
FT                   /product="helicase, RecD/TraA family"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1; AAA ATPase; KEGG:
FT                   cpr:CPR_2143 helicase, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32617"
FT                   /db_xref="GOA:A6LQI7"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI7"
FT                   /protein_id="ABR32617.1"
FT                   /translation="MEVLNGFVENIVFKSEDTGYVVCRIRNEKTLISAVGTVPFLREGQ
FT                   NVKLTGYWTVHKQFGNQFNIQDYEELLPNSLDGIEKYLSAGIIHGIGPVTAKKIIERFG
FT                   EETLDIMENHIERLMEIEGIGEKKFQIIYESYIEQQGLKDIILYFHKHGVTNNQCVKIY
FT                   KKFGANARQIVSDNPYILCDEISGIGFKTADRIAMSIGIEKNSEFRIQSGIKYVMNQFC
FT                   SAGNTFMPKNNIIEECENNLLISKELIEKNIYDMAAQQKIIVENINGTEVGFLLQYYYC
FT                   ELGVTSKIITLGLQQIQTINSDIDFEINVFEKEQNIKFAESQREAIIGAFNNGIEIITG
FT                   GPGTGKTTIIKAIIHIYENNGMKVILGAPTGRAAKRMTESTGREAKTIHRLLEMGISED
FT                   DESVFEKGESSPLDCDVIIIDEASMIDIILMQNLLKAINLGTRLIIVGDVDQLPSVGPG
FT                   NVLKDLIESDYIKVVRLKEIFRQGSESLIVVNAHRINEGQMPLLNQKDRDFFFISEDNQ
FT                   ERIANTIMDLINRRLPKFNKSWNKLKDMQVLTPMRKGVLGVTNLNTKLQEMFNASSKDK
FT                   KEKTSRDIIFREGDKVMQTKNNYTLKWIRVSGYGENEGVGVFNGDLGFIESIDEERKTL
FT                   TIIFDEERKVIYDFNFLDELDLAYATTIHKSQGSEFKVVIIPVFMGSPFLMNRNLLYTG
FT                   ITRAKQLVVVVGFQKALMYMINNTNSIERYSSLRYRIREIITKDEFEE"
FT   gene            520477..521493
FT                   /locus_tag="Cbei_0430"
FT   CDS_pept        520477..521493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ctc:CTC00323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI8"
FT                   /protein_id="ABR32618.1"
FT                   /translation="MRNLCKVTLEDLKYAFDKIDYWYKKNIKFLTVITVPFNTSCVFSK
FT                   IISKVSQNNGNVLYVWGKEGENKELVNITREMYSDITHSYVVKEISNAKLTFTHYNNLM
FT                   KIKQNYDLVIFDDITYFSNLSNVNIREMLEMCSNIGERVLLYSIEKTTLVGEKFELAAY
FT                   NYKKPFVEPRVLTTRIDLNSDIPFSLYDYLKWFRENSHKVAIYVPNKEKLDMVYDYFCN
FT                   KLKLSNVKVIKVSGNDDIKKSEKVSKYKDKAIFIITNKIEELLEYCYMDDAVVLFADNE
FT                   RYTYKKLLYICGQIRNVNLKLPEVLLVSNDISEDIEKAKNMARDFNKKVWEKRLIEL"
FT   gene            521466..522122
FT                   /locus_tag="Cbei_0431"
FT   CDS_pept        521466..522122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0431"
FT                   /product="ComF protein"
FT                   /note="KEGG: cpf:CPF_2431 ComF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32619"
FT                   /db_xref="GOA:A6LQI9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQI9"
FT                   /protein_id="ABR32619.1"
FT                   /translation="MGKAFNRIIKSILEGLIEVIYPRENYCIICKEDNCFGICEHCMKS
FT                   IKTIADSYQDEIISYGYYGGVLKDLILKFKYKSNFTAGDILAEFLEEYIIRNLKYQEYV
FT                   ITYIPLSKKSKKIRGFNQCEYIAKKIANDLSIEALEVLIKDKETKEQKKLKKDERYENI
FT                   KDAFKIKKGLEIGKYNIILVDDVTTTGATLKEAYKLLRKYQVKDIKLLTLAKSHI"
FT   gene            522538..523071
FT                   /locus_tag="Cbei_0432"
FT   CDS_pept        522538..523071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0432"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   cpf:CPF_2430 ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32620"
FT                   /db_xref="GOA:A6LQJ0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ0"
FT                   /protein_id="ABR32620.1"
FT                   /translation="MKVTVIAKNMELTDALKEIVQKKISKLEKYFEVNVEAKATLSVQK
FT                   NRHKIEVMIPFNGVVLRGEESTSDMYKSLDLVEDKLERQIRKQKTRLSRKHSGSLRFGE
FT                   INNIDIKPSEEDDGKLVKVKKFGVKPMNSEEAILQMDLLGHNFFVYQDADSSKVNVIYK
FT                   RKDGDYGLLEPEFI"
FT   gene            523416..525983
FT                   /locus_tag="Cbei_0433"
FT   CDS_pept        523416..525983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0433"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: cac:CAC2846
FT                   preprotein translocase subunit SecA (ATPase, RNA helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32621"
FT                   /db_xref="GOA:A6LQJ1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQJ1"
FT                   /protein_id="ABR32621.1"
FT                   /translation="MGLLNAVFGTYSEREVKRLKPTIQKINDLDEELQKLSDEELKAKT
FT                   PAFKERLANGETLDDILPEAFAVVREASKRVLGMKHYDEQLMGGMILHQGRISEMKTGE
FT                   GKTLVATLPAYLNGLSGNGVHIVTVNDYLAKRDAEQMGELYGFLGLTTGVIVHELNNDQ
FT                   RRESYASDITYGTNNEFGFDYLRDNMVIYKEERVQRPLNFAIVDEVDSILIDEARTPLI
FT                   ISGQGEKSTEFYKVADYFAKKLVVEKDFTRDEKANAVMLTDEGVRKAEVTFKVANYADA
FT                   ENIELQHYVTQALKANFAMRRDKDYMVKDGEVIIVDEFTGRLMEGRRYSDGLHQAIEAK
FT                   EGVKIARESKTLATITFQNYFRMYKKLSGMTGTALTEENEFREIYGLDVIVIPTHRPIA
FT                   RKDNPDLVFSTELGKIKAVASEVEKAHAKGQPVLVGTVSIEKSELVSSMLKKKGVPHQV
FT                   LNAKFHEQEAEIISHAGEKGMVTIATNMAGRGTDIKLGEGVVELGGLKIIGTERHESRR
FT                   IDNQLRGRSGRQGDPGESTFFISLEDDLMRIFGSEKIQGVVEKLGLQEEEAIESKMVSK
FT                   AIENAQKKVEGNNFDIRKQLLGYDDVMNIQREVIYKQRSEVLEGEDVKEEILSMTKDII
FT                   ADAVNTYVTGESEDYREEFLHLMVALQDICIAPGTVNLPSLENLSNEEIIESLFESARK
FT                   FYEHKEEEFGAERLREVERVVLLRAVDTKWMNHIDNMDHLKQGIGLQSFKQIDPVQAYQ
FT                   MEGSEMFNDMIKAIKEETVRLLFHVRIEVAPERVRVAQETAAIHEESSSAAAPGPGQNQ
FT                   PGGPGGPSAGPVAPVRNLDKHGRNELCPCGSGKKFKNCCGREA"
FT   gene            526278..527252
FT                   /locus_tag="Cbei_0434"
FT   CDS_pept        526278..527252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0434"
FT                   /product="peptide chain release factor 2"
FT                   /note="TIGRFAM: peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   cpf:CPF_2428 peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32622"
FT                   /db_xref="GOA:A6LQJ2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ2"
FT                   /protein_id="ABR32622.1"
FT                   /translation="MQESGFWDNIKKAEEVTKKSKSIKDKIESFDKLKSQIEDIEVLKE
FT                   IMEDDDEESANEIIQTLRDIQAQIDDYNMKVLLCGEYDKNNAILTLHVGVGGTDANDWT
FT                   EMLLRMYTRWCEKQGYSIETLDLLPGDEAGIKSVTLKVTGEYAYGYLKAEKGIHRLVRI
FT                   SPYNANGKRQTSFASMEVLPELTKEQDIEIRSDDLKIDTYRSGGAGGQHVNKTDSAVRI
FT                   THIPTGVVVQCQNERSQFSNRDTAMEMLKSKLVELKERAHKEKIEDLTGELKDMGWGSQ
FT                   IRSYVFHPYSMVKDHRTNVETSNVTSVMDGEIDMFINAYLKQQ"
FT   gene            527914..528609
FT                   /locus_tag="Cbei_0435"
FT   CDS_pept        527914..528609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0435"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cpf:CPF_1403 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32623"
FT                   /db_xref="GOA:A6LQJ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ3"
FT                   /protein_id="ABR32623.1"
FT                   /translation="MNILIVEDERDIRNLISLHMRKENYEVYEASDGREALNIFENEKI
FT                   DLILLDIMMPNVDGISVIQKVRAISTIPIICITAMGNDSDKVLALGLGADDYLVKPISP
FT                   IELSARVASNLRRCYKYAEHKDIIYSTGELKLFTETFEVYKGNRKIDLNPKEFKILKLL
FT                   VSNLGKVFTKKQIYEEVWEEAYFGDSNNIMVHLSHIREKIEDDPKNPIYIKTIRGIGYK
FT                   IERVAMHES"
FT   gene            528599..530101
FT                   /locus_tag="Cbei_0436"
FT   CDS_pept        528599..530101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0436"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: ctc:CTC00849 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32624"
FT                   /db_xref="GOA:A6LQJ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ4"
FT                   /protein_id="ABR32624.1"
FT                   /translation="MKAKRIKRSVTTELFFIYFLGYIAINIILLIAIIGSIVVYGTLCG
FT                   PNTYNSYFRELQNKLVKDYTSITDGDLSDIDGFMVKINNENKVRYMKGHVIEEFKNINL
FT                   QSYMYLFGLTKDNEESLNDDIRTMFALSDFNNSIIETKDNVKYSLYSKYLKEEDSLVVV
FT                   GFPYSEITKPNRITKVIPHNLIIKIMGAFNVLLILSIVYILAKATSSAFIKPIKTLLAG
FT                   VIEISHGNYNIRLDIDKKNEFLELANGFNMMAGTIQNERSQKEKLEKIKEGLILDISHD
FT                   LKNPLSSILGYSEILINNNDLDEKEKLEYLNIINKNSQRANKLITDLFEFSLYDNSDYK
FT                   MITVKADIAEFVRQIIANYIPEFDHKKFEYDFEIIEETYYVMINEEKLSRAINNVLDNK
FT                   VKYNPVGSRIGVKTEVRDNYFYIILSDNGECIPQKYRENIFNPFVRVDKSRNSKTGGTG
FT                   LGLSITKKILNKHNGDIRIIDSGGIGTTFEIMLPLVVFKNKI"
FT   gene            530300..531211
FT                   /locus_tag="Cbei_0437"
FT   CDS_pept        530300..531211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0437"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: dsy:DSY1792 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32625"
FT                   /db_xref="GOA:A6LQJ5"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ5"
FT                   /protein_id="ABR32625.1"
FT                   /translation="MDNDKNELENINSNIDYDNLKEETGAINTEEHFKENGLVTKLKDK
FT                   KGILGAVGAFLLILLKFKAILFLVLGKLKFLIILLKLGKFASTFISMLLMIVIYAKMYG
FT                   VAFGVGFVLLLLIHEMGHYLTAKLIKLDVSLPIFIPFVGAFISMKEEPKDSATEAKVAI
FT                   GGPLLGSIGALICLLFYFISGEDFLAALAYVGFMLNLFNLIPVHPLDGGRVVSAISPKL
FT                   WLIGIPIGIIALFKAFNPIIVLLLILGVAKVIEQYRNPDKSYYEVKTSIRFIFALSYFG
FT                   LMLLLGIGITYIHGIHSSILIQ"
FT   gene            531394..531564
FT                   /locus_tag="Cbei_0438"
FT   CDS_pept        531394..531564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32626"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ6"
FT                   /protein_id="ABR32626.1"
FT                   /translation="MNRVTELKLCYYNDGQKQEIVVYNELSKNDLRKLILGISNENGKL
FT                   KVRTTVEEKYI"
FT   gene            531720..533897
FT                   /locus_tag="Cbei_0439"
FT   CDS_pept        531720..533897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0439"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: cpr:CPR_2136
FT                   transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32627"
FT                   /db_xref="GOA:A6LQJ7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ7"
FT                   /protein_id="ABR32627.1"
FT                   /translation="MNSIEERIAKELEIKLSQVQNVIGLLDDGNTVPFISRYRKEATGG
FT                   LSDEVLRKLSERLTYLRNLEERKADVTRLIQEQEKYTNEIGKALENATTLTEVEDIYRP
FT                   FKPKKRTKATIAVEKGLKPLAELILEGKLSGDLDEEAAKYISEEKGVTNSQEAIQGALD
FT                   IIAESISDEAKYRKYIREFVIREGNIESKGSSDEPTPYEMYYEYSEAVNKIPPHRILAI
FT                   NRGEKEKILNVKITVNEDKIIQYLENQVLKGNETLDEKLKLAIRDSLKRLIYPSIEREI
FT                   RSELTDIGEEGAIKIFKENLKALLLQAPIKGKVVMGYDPGFRTGCKIAILDATGKFLEN
FT                   TAVYPTVPKRDIEGTKKTLKALIAKHNVDVISLGNGTASRESEEVIAEMITEIKNETGK
FT                   ELAYVIVSEAGASVYSASELATKEYPDLDVTVRGAISIGRRLQDPLAELVKIDPKAIGV
FT                   GQYQHDVAPKKLEESLAGVVEDSVNTVGVDLNIATPSLLTHISGINASIAKNIVDYREE
FT                   VGRFTSRKELLKVKRLGQKAYEQCAGFLRVDDSKEPLDNTSVHPESYAIAKKLIELLGY
FT                   NKEDLKNNKLGDIDERAQSQGLKKLSETLEVGEMTLKDIIKELKKPGRDPREEMPKPIL
FT                   KTGIIELKDLKPGMVLAGTVRNVSDFGAFVDIGVHQDGLVHKSQMANRFVKHPLDIVKV
FT                   GDIVKVAILEVDEKRKRISLTMKDIDESAEV"
FT   gene            534155..535111
FT                   /locus_tag="Cbei_0440"
FT   CDS_pept        534155..535111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0440"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: ooe:OEOE_0048 predicted
FT                   dehydrogenase or related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32628"
FT                   /db_xref="GOA:A6LQJ8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ8"
FT                   /protein_id="ABR32628.1"
FT                   /translation="MIRWGIIGLGNIALRFAKSLSYSNEGKLYAIASRTKEKRDEFYDK
FT                   YNCEKVYENYNELLRDEEVDAIYIALPHGFHKHWSIEALRHKKAVLCEKPVGINSEEMK
FT                   EIKKEAVLNNTFFMEAMKTRFIPIISDIKKVIRNKEIGDITAIEANFCNNVENIKPGSY
FT                   LLDKDQGGALLDVGIYPLSFVMDMIDSEVKSVKSYMDINESGVDSYFKAILSFEDGVIG
FT                   TVEGAIDRNKERTAIIRGTKGWMEIPMYNRPNKAVVNLNSGKSYTIEKDIEFDDMYAEI
FT                   KEIHNCLKESKLESDYLTLNESIRVMEVLDRIRMNAE"
FT   gene            535137..536090
FT                   /locus_tag="Cbei_0441"
FT   CDS_pept        535137..536090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0441"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: cac:CAC2782 predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32629"
FT                   /db_xref="GOA:A6LQJ9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQJ9"
FT                   /protein_id="ABR32629.1"
FT                   /translation="MIRRERETYKMDEVKVYTNRKNIVLLATLCCFLWGSAYPAIKVGY
FT                   SLFNISDVGSKLIFAGYRFTLAGIFILIFELMSKRVIFKFTRKQFGQITLLGLTQTALQ
FT                   YIFFYVGMSYTTGVRGSIINGTGTFVSIILAHFIYKNDRLNLNKIIGCVIGFVGVVIVN
FT                   LNGESLGGTSVTFKGEGFIMVAAIIFAVSAIYGKKITQTQEPSIVTGFQLFIGGILLTA
FT                   LGFALGGSLEGFTAKSTLLLIYMALLSSIAFTVWTQLLKYNKVGLISVFNFLIPVFGTL
FT                   LSALILGENIFDIKILIALLLVCYGIFLVYRVKKEK"
FT   gene            536187..537167
FT                   /locus_tag="Cbei_0442"
FT   CDS_pept        536187..537167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0442"
FT                   /product="helix-turn-helix-domain containing protein, AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bcl:ABC0373 transcriptional regulator,
FT                   AraC/XylS family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32630"
FT                   /db_xref="GOA:A6LQK0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK0"
FT                   /protein_id="ABR32630.1"
FT                   /translation="MLKEIHDKLIALTDEEVNILSGENSVNRSIYTDDGSFIVDSNKLL
FT                   PSGELIDIRKHIRFINFPSHNHNYIEFNYVYQGKLTQIIDNNEITLQKGELIFLNQYIT
FT                   HEIKASDKEDIIINFIIRPEFFDYIITLLDKENIVSKFLLTTLYTDYDEGEYLYFKVSE
FT                   RKNIQELLEKIIIELYTNSIMKKATIKLLVGLLLVELVKNSQDIETYSVDNYEKMLIIQ
FT                   SLKYIEEFYSTATLLELSEKLNQPDYKLSKLIKKHTKMTFKELLQEKKLSKAVELIKLT
FT                   EYSIIEIIEFVGYENPTYFYKIFKKKFGMTPREYKMNRINNFRFT"
FT   gene            537514..538407
FT                   /locus_tag="Cbei_0443"
FT   CDS_pept        537514..538407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0443"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: cpf:CPF_2334 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32631"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK1"
FT                   /protein_id="ABR32631.1"
FT                   /translation="MRYLVLDVGGSSIKYALMTEDLEFIERGKKPTPLDKIESFIDVIG
FT                   EIYDIYKDDIEGIAISMPGVLDSEKGYAYTGGALSYNEGKEIVKILKERCPIKITIEND
FT                   GKCAALAEVWKGSLKDFDDGVVIVLGTGVGGGIVRNKKIHKGKNFFAGEFSFINTNVNN
FT                   TENTDECWGSISGSKALINEVAKVKSLPPDELDGYKIFEYANNNDPDILKILDDFTYKL
FT                   AVQIFNLQCILDPEIFAIGGGISSQEILIQYIKRNVDKYQKSFEIDDLPLPNVVSCKFR
FT                   NDANLIGALYNFITSK"
FT   gene            complement(538563..540656)
FT                   /locus_tag="Cbei_0444"
FT   CDS_pept        complement(538563..540656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0444"
FT                   /product="glutamine synthetase, catalytic region"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   cth:Cthe_0863 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32632"
FT                   /db_xref="GOA:A6LQK2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR040577"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK2"
FT                   /protein_id="ABR32632.1"
FT                   /translation="MNKINEIFASNVFSDAVMKERLPKATYKALKKTIEKGTTLEPDVA
FT                   DVVAAAMKDWAVEKGATHFTHWFQPMTGITAEKHDSFINPTSDGKVILEFSGKELIKGE
FT                   PDASSFPSGGLRATFEARGYTAWDCTSPAFLKDGSLCIPTAFCSYNGEALDKKTPLLRS
FT                   MEALNKQALRVLKALGNTTTKRVITTVGPEQEYFLIDKSMYDARKDLILTGRTLFGAKP
FT                   SKGQELEDHYFGTIKQRISDFMKEVDEELWKLGILAKTKHNEVAPAQHELAPIFSTTNI
FT                   STDHNQLTMEIMKKVAAKHDLYCLLHEKPFAGVNGSGKHNNWSMGTDDGMNLLEPGKSP
FT                   HENQQFLLFLCAVIKAVDEYPSLLRVSAANAGNDHRLGANEAPPAIISIFLGDQLEDVL
FT                   EQIEKGPATSSKSASELTIGVNTLPPLPKDATDRNRTSPFAFTGNKFEFRMVPSSASIA
FT                   GCNFVLNTIVAETLSEIADKLEKATDLDAEIQAILTDIVKNHKRIIFNGNGYSDEWVAE
FT                   AERRGLPNIHSTVEAAKAMIDEKNQAVLEKHGVLTRVESTSRYEITLENYNKIINIEAL
FT                   TTLEMAKRQIIPAVIQYTTSLAESINTIKATGINVDISVQTESLTEISTLLASLNKNVS
FT                   LLEKAVEKADNFEGDIFDLGMMYRYEVFEQMNTLRADADKLETLVDEEFWPLPTYSDML
FT                   FNV"
FT   gene            541381..542784
FT                   /locus_tag="Cbei_0445"
FT   CDS_pept        541381..542784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0445"
FT                   /product="rhamnulokinase"
FT                   /note="TIGRFAM: rhamnulokinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: bha:BH1551 rhamnulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32633"
FT                   /db_xref="GOA:A6LQK3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK3"
FT                   /protein_id="ABR32633.1"
FT                   /translation="MEYYLAIDIGASSGRHILGSVENGKINLEEIYRFENGISKIGNEY
FT                   CWNIEQLFNDIKKGIKKCKEMGKIPSSIGIDTWAVDFVLLGENDKILGNAVAYRDDRTE
FT                   GMMEEAFKIIPKDMMYLYTGIQFQRFNTVYQLLSLKKNNPEILDKAKTFLMIPDYLNFL
FT                   LTGKKVNEYTNASSTQLVNSFERTWDEKILDELGIKKDIFQEIKLPKTNLGTLRKELEE
FT                   EFGFDMEVILPATHDTGSAFISSVCNDSDSIYLSSGTWSLIGVENRFPICVPQAMEHNF
FT                   TNEGGIDYRYRFLKNIMGLWVIQEVRRNLDNKYSFGQLVDLAKEHIDFSSIVDVDHDRF
FT                   LKPENMVEEIKLYCVETSQKVPQEVGEIAMCVFNSLAHCYKKAVSNLEEIFEKKFERIN
FT                   IFGGGCQNNLLNELVSKVTGKEVLAGPVEATAIGNIVAQMMSKDIFKDLSEARQVIKES
FT                   FDIKIFKSN"
FT   gene            542921..544177
FT                   /locus_tag="Cbei_0446"
FT   CDS_pept        542921..544177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0446"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number="5.3.1.14"
FT                   /note="PFAM: L-rhamnose isomerase; KEGG: oih:OB0496
FT                   L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32634"
FT                   /db_xref="GOA:A6LQK4"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQK4"
FT                   /protein_id="ABR32634.1"
FT                   /translation="MNVKEKYELAKKEYEKWGIDVDKVLDELNKVKISIHCWQGDDVKG
FT                   FEVVQNELSGGIQCNGNYPGAARNAEELRKDLDKALSLIPGKHKVNLHAIYLETNGEFV
FT                   DRDEIKPEHFANWVKWAKENGLGLDFNPTIFSHPKSADGLTLSHPDKEIRDFWIRHSIA
FT                   SRKIGEYFGKELGQTCLTNIWIPDGYKDIPSDRLGPRRRLKESLDEIFKVQIDKKYNLD
FT                   CVESKVFGIGAEAYTVGSNEFYLNYAAKNNIMSLMDTGHYHPTEVVSDKLSAMLLFDEK
FT                   VALHVSRPVRWDSDHVVVYDDELKEIAKEIVRNDALDRVIIGLDFFDASINRIAAWTIG
FT                   SRNMIKALLNAMLTPNDKLRELQEEGNFTERLALMEEFKTYPMGDIWNYYCEKNNVPVG
FT                   ESWIKEVKEYEKDVLSKRN"
FT   gene            544306..545142
FT                   /locus_tag="Cbei_0447"
FT   CDS_pept        544306..545142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0447"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="PFAM: 5-keto 4-deoxyuronate isomerase; KEGG:
FT                   cpf:CPF_0395 4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32635"
FT                   /db_xref="GOA:A6LQK5"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK5"
FT                   /protein_id="ABR32635.1"
FT                   /translation="MKMEIRYSNHPEDSKQYDTETLRRHYLVEKVFVGDEVNLVYSHND
FT                   RIIFGGITPVKEILKLGASKELGTDYFLERRELGVINVGGEGTIIADGVEYNLNYRDGL
FT                   YVGQGTKNIEFKSANGKKPAKFYINSAPALKSYPTVKIDLEKANKIKCGDEINMNKRTI
FT                   NQYVHPAVCESCQLVMGLTILEQGSGWNTMPCHTHERRMEVYLYLDVPEDQAVIHFMGE
FT                   GQETRHIVMKNEQAVISPSWSIHSGIGTQNYSFIWGMCGENKTFGDMDHTKINELR"
FT   gene            545167..545949
FT                   /locus_tag="Cbei_0448"
FT   CDS_pept        545167..545949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0448"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KEGG: cpr:CPR_0392
FT                   2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32636"
FT                   /db_xref="GOA:A6LQK6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK6"
FT                   /protein_id="ABR32636.1"
FT                   /translation="MSNILHEFSMDFFRLYGKVAIVTGGNTGLGQGYAVALAKAGADLI
FT                   IPTYDTNWDETRLLIEKEGRSVTFVQADLTKKEDREKVIKIAMEVYGKIDVLVNNAGTI
FT                   RRAPLLEYKEEDWNAVMDINLNAVYFLSQEVAKIMVNQGSGKIINIASMLAFQGGKFVP
FT                   PYTASKHGVAGITKAFANELASKNIQINAIAPGYIKTANTAPIRADKERNAEIQGRIPA
FT                   DRWAEPFDLMGAIVFLASRASDYVNGHILAVDGGWLVR"
FT   gene            complement(546348..547475)
FT                   /locus_tag="Cbei_0449"
FT   CDS_pept        complement(546348..547475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0449"
FT                   /product="glycosyl hydrolase, family 88"
FT                   /note="PFAM: glycosyl hydrolase, family 88; KEGG:
FT                   efa:EF0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32637"
FT                   /db_xref="GOA:A6LQK7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK7"
FT                   /protein_id="ABR32637.1"
FT                   /translation="MKLTEKELRTKLDLVVDKLLNLDRPTDEEKLTKEGGEAIGMFPRD
FT                   FGIQEWDWPQGVGLYGLLKLDKHDKSNKYLDFLNEWYKNNISNGLPSKNINTTAPLLTL
FT                   INLLDVSPNTDFENLCLKWADWLMNCLPRTKEGGFQHVTSANGDRQGVRLNESEMWIDT
FT                   LFMTVLFLNRMGQKYNRQDWINESIHQVLIHIKYLYDKKSGLFYHGWSFNENSNFGEVF
FT                   WCRGNSWFTFGILDYIEMFDGKMNSGLKKFLIDTFKAQVTTLVKYQSKSGLWHTVIDDP
FT                   TSYEEVSGSAAIAAGILTGIRLGILDDSFKPAGQKAIEAICNNIAKDGTVLNVSGGTGM
FT                   GYNKEHYRNIIIAPMAYGQSLTIMALVEALNHIDC"
FT   gene            547974..548810
FT                   /locus_tag="Cbei_0450"
FT   CDS_pept        547974..548810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0450"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: efa:EF0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32638"
FT                   /db_xref="GOA:A6LQK8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK8"
FT                   /protein_id="ABR32638.1"
FT                   /translation="MRIGVRGHDIGLYKLDDIGRIMKEKGLKSVQFVAKKIISEFEVTR
FT                   GCMTPGMAQYINNTLNKYEVNISILGCYINLANPDDNELKESLDTFKEHIRFAKYLGCN
FT                   VVGTETGAFNKEYIYTEKNNTEEAFLRSLNSIRILVKEAEKFGIVVGIEGVTKHIMNTP
FT                   ERLKRALDNVESNNLQVIFDPINFIDESNYDKQDEIIRKSFELFGDRIVIIHAKDFIYK
FT                   DGKVQQVSIGKGQFNYPLLLKLIKERKPYIDIILEDTIPEDLDSSIKYIEEIYKSL"
FT   gene            549399..550937
FT                   /locus_tag="Cbei_0451"
FT   CDS_pept        549399..550937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0451"
FT                   /product="oligogalacturonide transporter"
FT                   /note="KEGG: eca:ECA3560 oligogalacturonide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32639"
FT                   /db_xref="GOA:A6LQK9"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQK9"
FT                   /protein_id="ABR32639.1"
FT                   /translation="MSKKDGKIRFINYFSYGMNDFIGAGAFALTSAWLLYFYTTFCGLT
FT                   PIEASSIFALARIVDAVASPTMGFITDNFHKTALGRRFGRRKFFLLAAIPLIIVYSAIW
FT                   VSGFSYLYYVGTYIAFEIVYTMVLIPYDTLAAEMTSDFKIRAKLTSARMYIAQFSAFLA
FT                   AFIPGRLINTLGKESPQSFLIAGGIFTVIFIIVLILVYTFTWERSLEEIEILEGRHSKE
FT                   KLSFGQNVMKIYIDLVTTLKIRTFRAHLGMYIGGYLAQDTFNAVFTYFIVFALFKGAVV
FT                   ASNLLALMYIFQIAGVGIATYCTLKLSPGGAFRVVSLIFLASIVGYLIVYGTIPDSLVA
FT                   LYVVSALAGLGRGGINFVPWNNYTFVPDVDEIVSADRREGVFAGFMSLLRKASQALAVF
FT                   LVGVILQEFNFKSGSTSQPPEALTAMAVILIVAPAILLVYGIISSYKFKVSHESHEVLK
FT                   KEIARLKDGGLKEDVDAETRTTVEELTGLNYENVWGNNKVGYRNWRRYKENQKA"
FT   gene            complement(551096..551410)
FT                   /locus_tag="Cbei_0452"
FT   CDS_pept        complement(551096..551410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0452"
FT                   /product="L-rhamnose 1-epimerase"
FT                   /note="TIGRFAM: L-rhamnose 1-epimerase; PFAM: protein of
FT                   unknown function DUF718; KEGG: msu:MS2324 uncharacterized
FT                   ACR"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32640"
FT                   /db_xref="GOA:A6LQL0"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQL0"
FT                   /protein_id="ABR32640.1"
FT                   /translation="MIQKAFKMKLFEGKEEEYKKRHNEIWPDLVKELKSHGTSKYLIFY
FT                   DKDTNILFSYIEMENEELWDEIAETDACKKWWAFMKDIMETNPDNSPISVELSNVFNLK
FT                   "
FT   gene            551646..552404
FT                   /locus_tag="Cbei_0453"
FT   CDS_pept        551646..552404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0453"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: ecv:APECO1_839 putative
FT                   DeoR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32641"
FT                   /db_xref="GOA:A6LQL1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL1"
FT                   /protein_id="ABR32641.1"
FT                   /translation="MLPRERLEIIKEIAIKEKKVYVSKLSKEFEVTEETIRRDLEKLEL
FT                   QGVVTRSYGGAILNVDKTNEDVPFYKRSRTNIESKQYIALKAIEFVKGSSTIVADCSST
FT                   VFEALKLIRNRNDVTVITNSVEVLQELNQSELNIISTGGGLDQRTLSLQGPITQNAIKN
FT                   YNVDIAFVSCKGMDINKGILDSNETEAEIKRSMIKQSNKVILLVDHSKYDKTSFVKLFD
FT                   YEDIDYLITDIEPNEEWINLLHANNVEVIY"
FT   gene            552776..553594
FT                   /locus_tag="Cbei_0454"
FT   CDS_pept        552776..553594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0454"
FT                   /product="Rhamnulose-1-phosphate aldolase"
FT                   /EC_number="4.1.2.19"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: msu:MS2327 ribulose-5-phosphate 4-epimerase and
FT                   related epimerases and aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32642"
FT                   /db_xref="GOA:A6LQL2"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR013447"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL2"
FT                   /protein_id="ABR32642.1"
FT                   /translation="MTIEDMKFIQNFKRMTNDAWLKGWHERNGGNITYRLTKEEVSAIK
FT                   EFINEDSEYNSIGVTVKNLANEYFLVTGSGKFIRNMTVCLGENAGIIKIDEKGENYKVV
FT                   WGLSNNARPTSELPSHLMSHSIKVEKTNGCHRVIMHSHTTNVIALTFVLPLEEKVFTRE
FT                   LWEMATECPVVFPSGIGVVPWMVPGGAAIAEATGELMKDHDVVIWAHHGMFCSGETLDL
FT                   TFGLMDTVEKSAEILVKVLSMGGKKQTIVSENFRDLAKDFNVSISEDYLV"
FT   gene            553934..555091
FT                   /locus_tag="Cbei_0455"
FT   CDS_pept        553934..555091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0455"
FT                   /product="lactaldehyde reductase"
FT                   /note="TIGRFAM: lactaldehyde reductase; PFAM:
FT                   iron-containing alcohol dehydrogenase; KEGG: cpf:CPF_1046
FT                   lactaldehyde reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32643"
FT                   /db_xref="GOA:A6LQL3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL3"
FT                   /protein_id="ABR32643.1"
FT                   /translation="MTNRMILNETSYIGAGAIENIVTEAKIRGYKKALVVTDKDLIKFN
FT                   VASKVTNLLDENDLIFEIFDEVKANPTINVVLAGIERFQASGADYLIAIGGGSSIDNTA
FT                   KAIGIIVNNPEFSDVRSLEGAVETKNKCVDIIAVPTTAGTAAEVTINYVITDEERKRKF
FT                   VCVDPHDIPVIAVVDSEMMSSMPKGLTAATGMDALTHAIEGYITKGAWELTDTLHLKAI
FT                   EIIGRSLRSAVNNEPKGREDMALGQYIAGMGFSNVGLGIVHSMAHPLGAFYDTPHGIAN
FT                   AVLLPYVMEYNAEATDKKFREIARVMGVEGVDNMSQKEYRKAAIDAVKKLSEDVGIPKV
FT                   LNEIGVKEEDLQSLAESAFVDACTPGNPRDTSVVEILEIYKKAFK"
FT   gene            555541..556008
FT                   /locus_tag="Cbei_0456"
FT   CDS_pept        555541..556008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0456"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase, DNA binding; KEGG: ctc:CTC01413
FT                   methylated-DNA--protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32644"
FT                   /db_xref="GOA:A6LQL4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL4"
FT                   /protein_id="ABR32644.1"
FT                   /translation="MENVYYYNTKIGKISIVENGTAIIKICFINKDELNIEGNETELLR
FT                   KAIKQLEEFFEGERNCFDLPLAPKGTEFQRKVWSALQEIPFGETRSYGEIAKIVGNEKA
FT                   ARAVGLANNKNPIPIIIPCHRVIGANGKLVGYAGGLNIKEKLLKIEKDYKI"
FT   gene            556310..556927
FT                   /locus_tag="Cbei_0457"
FT   CDS_pept        556310..556927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0457"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; KEGG: smu:SMU.507
FT                   putative transcriptional regulator (DeoR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32645"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL5"
FT                   /protein_id="ABR32645.1"
FT                   /translation="MIEKEGYENLNKDNIFSYKERLKLNVNEKTKIVEKAMKFIHNNKT
FT                   YFFDVSTSIEFLSRSLDKKATIFTHSIDNFNILSEKNGIVVNLIDGKFNKKNRFFYRRN
FT                   YDEYLSGIEFQAAFIGAGAIKGNGIYYENEEDAYIKGEIVKRAKKVILLAEHQKYEKDA
FT                   FYKGLNLDRADIIIVDPISVSSFSNIMELHNIEINPKSLVII"
FT   gene            557059..557871
FT                   /locus_tag="Cbei_0458"
FT   CDS_pept        557059..557871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0458"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase, type 3; KEGG: gfo:orf2334 haloacid
FT                   dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32646"
FT                   /db_xref="GOA:A6LQL6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL6"
FT                   /protein_id="ABR32646.1"
FT                   /translation="MKKIRMVCLDIDGTLLNSNHEVTEKVKSTINKVANNKKIPVILVS
FT                   ARMPKGIRFLQEELGIEEPIICYSGALILDKDNSVLAREAIDVSNFEKIYKLTSENNIH
FT                   MSLYKDDEWYIEKLDYWAKQESEITNIIPNIIDFNKLIEQWKREGVGPSKILCMSNPKE
FT                   INFLKENIYDNDLNIYPSKPTYLEIMPIKASKTSAITCLQKKFSIDKSEIIAMGDNYND
FT                   IDMLEYAGVGVAMGNAPEDVKKHADDVTLTNDEDGVAEALIKYVINKK"
FT   gene            complement(558114..558923)
FT                   /locus_tag="Cbei_0459"
FT   CDS_pept        complement(558114..558923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0459"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory protein, IclR; Transcriptional
FT                   regulator IclR-like; KEGG: cno:NT01CX_1476 transcription
FT                   regulator (IclR family) BH2137"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32647"
FT                   /db_xref="GOA:A6LQL7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL7"
FT                   /protein_id="ABR32647.1"
FT                   /translation="MSEDLSNPNLVQSVERALDILDCLAEYPKGCGIAELSKNLGLSKS
FT                   TIHRIITTLKYKEYVTQNAENDKYQLGIKLLNLSSSITNSMDLINVARPHIYDFANKFD
FT                   EVIHLCIPDESFTNIIYVDKVSSENTSRNIIMSSSIGKKAPIYCTASGKLILSQYSDDK
FT                   IRELLKDTEFIKYAENTITDINVLIEEIHVIRKNLYALDNIEYDTGVICIAVPIFDRTN
FT                   KIIAATSLSSVTLFNTMDDLLKYKEEFMNVAKNISRLMGYAYYTDIK"
FT   gene            559167..559949
FT                   /locus_tag="Cbei_0460"
FT   CDS_pept        559167..559949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0460"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KEGG: cpr:CPR_0392
FT                   2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32648"
FT                   /db_xref="GOA:A6LQL8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL8"
FT                   /protein_id="ABR32648.1"
FT                   /translation="MENILDQFSMDFFRLDGKVAIVTGGNTGLGQGYAVALAKAGADLV
FT                   VSTHGDNWDDTRELIEKEGRKAVFVKADLTQKEGRQDVIDSAMKSYGKVDILVNNAGTI
FT                   RRTPLLDYKEEDWNAVMDINLNAVYFLSQEVAKIMVKQGSGKIINIASMLSFQGGKFVP
FT                   PYTASKHGVAGITKAFANELASKNIQINAIAPGYIKTANTEPIRADKERNAEIQGRIPA
FT                   DRWAEPSDLMGAVVFLASRASDYVNGHILAVDGGWLVR"
FT   gene            560086..561033
FT                   /locus_tag="Cbei_0461"
FT   CDS_pept        560086..561033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0461"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: oih:OB2698
FT                   2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32649"
FT                   /db_xref="GOA:A6LQL9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQL9"
FT                   /protein_id="ABR32649.1"
FT                   /translation="MDVITIGDAMIAMCPQEKGPIIFCDTFKRKVGGAELNVAMGCARL
FT                   GLKSGWISRLGNDDFGKYILKIVRGEGIDTSEVQLVDGYPTSVYFREVLSDGSSRSFYY
FT                   REKSPTSTMDAKKLNEEYIKNAKVLHITGVFPSITENNREVILEAVKLAKKNNLIISFD
FT                   PNIRLKMWTKEEAKNYIEKLLPYVDILLIGDEEIEILLGDTNIEEAIKVFHNKGIEKVI
FT                   VKKGAKGAIGSDGKNIYDIEAIKPKALVDTVGAGDGFAAGFLTALLKGKSLEDCVRFAN
FT                   AVGSLVVGVEGDNEGLPYYDDVLVHLGQAKKIER"
FT   gene            561123..561749
FT                   /locus_tag="Cbei_0462"
FT   CDS_pept        561123..561749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0462"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: tma:TM0066
FT                   2-dehydro-3-deoxyphosphogluconate aldolase /
FT                   4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32650"
FT                   /db_xref="GOA:A6LQM0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM0"
FT                   /protein_id="ABR32650.1"
FT                   /translation="MFEKIYNTLKEEKAVAVIRTKTYEEAKEISIAAIEGGMKIIEVTM
FT                   SVPNAPKLIKELKEEYKNACVGAGTVLTKDAVDACIENNSDFIVSPCIDEDVIAYANQR
FT                   KALIIPGLMTMSELNKAYKLGLRFIKVFPGNVVGKAFIGAAKSIFPDLSVMPTGGVNKD
FT                   NISEWIQAGADCSGIGSDLNKVYKSNGVAGVKEYCADVISKVKNL"
FT   gene            562066..562455
FT                   /locus_tag="Cbei_0463"
FT   CDS_pept        562066..562455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0463"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   cth:Cthe_3118 hemerythrin-like metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32651"
FT                   /db_xref="GOA:A6LQM1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM1"
FT                   /protein_id="ABR32651.1"
FT                   /translation="MYEMKEEYKIGIDQIDEQHKKLFELADQAYTLLKDEFAIDKYDKI
FT                   IHIMDELKDYTIFHFKSEEEYMKSINYKRLFTQKIEHDKFIKSLEEIDYKNIDENQDES
FT                   LIKLLNFLNDWLTEHILKTDKLIGE"
FT   misc_binding    562620..562737
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 129.40"
FT   gene            562927..563508
FT                   /locus_tag="Cbei_0464"
FT   CDS_pept        562927..563508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0464"
FT                   /product="conserved membrane protein"
FT                   /note="KEGG: cpr:CPR_2135 conserved membrane protein,
FT                   probable transporter, YPAA"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32652"
FT                   /db_xref="GOA:A6LQM2"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM2"
FT                   /protein_id="ABR32652.1"
FT                   /translation="MNEKTSKLIKISLLSAIAIILMYFDFPIIPAFPWLKIDLSDVPAL
FT                   LGAFGFGPVAGVIIELIKNLLVPLIRGSQTGFVGETANFLFGAALILPASFIYYRNKNK
FT                   KNAILGMIIGGIAMEAMGIVGNIYLLLPAYGMKMPADMLQNYVWALLAFNGVKAVMVSV
FT                   LTYILYKKVSVSIFKVEPNFGSPENKTKIV"
FT   gene            564288..564449
FT                   /locus_tag="Cbei_0465"
FT   CDS_pept        564288..564449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0465"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   sfu:Sfum_3222 rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32653"
FT                   /db_xref="GOA:A6LQM3"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM3"
FT                   /protein_id="ABR32653.1"
FT                   /translation="MEKYICTVCGYIYDEAAGDPDNGVAPGTKFEDIPEDWVCPLCGVP
FT                   KSDFEKEQ"
FT   gene            564646..565410
FT                   /locus_tag="Cbei_0466"
FT   CDS_pept        564646..565410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0466"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: cac:CAC0113 transcriptional
FT                   regulator of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32654"
FT                   /db_xref="GOA:A6LQM4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM4"
FT                   /protein_id="ABR32654.1"
FT                   /translation="MFTEERLNEILNILNTYGKVKVKDLSKKFNVTEDCIRKDLKQLEH
FT                   AGKLKRTYGGAIQIRESSQLYDISEREKIDISTKSIIAKKALELIQDRETIFLDLSTIN
FT                   ILIAKSILTTQKRITVVTNMLEIANILAKAANNITVVVASGVLNKSLNGFIGSSTNDFI
FT                   KKYKFDKSFIGSCGIDAFDKSITTFEIEDGITKATIIQSSKKTFLVMENKKFFVDGNYK
FT                   FAMIDDINAIITDEKPNQPIIDVLESNEIELI"
FT   gene            complement(565563..566003)
FT                   /locus_tag="Cbei_0467"
FT   CDS_pept        complement(565563..566003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0467"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: cth:Cthe_1774 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32655"
FT                   /db_xref="GOA:A6LQM5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM5"
FT                   /protein_id="ABR32655.1"
FT                   /translation="MNIAINLMKEEDIDEILDISSLSFSICWSKNSYMQELTNPVAKYF
FT                   VAKVDNKVVGFAGTWIVLDEAHITNIATHPNYRKQGIASKILEELLSYCKSQGCVAYTL
FT                   EVRKSNAAAKALYEKYNFKQEGIRKGYYEDNKEDAILMWLKE"
FT   gene            complement(566003..566737)
FT                   /locus_tag="Cbei_0468"
FT   CDS_pept        complement(566003..566737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0468"
FT                   /product="peptidase M22, glycoprotease"
FT                   /note="PFAM: peptidase M22, glycoprotease; KEGG:
FT                   cpe:CPE2165 probable glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32656"
FT                   /db_xref="GOA:A6LQM6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM6"
FT                   /protein_id="ABR32656.1"
FT                   /translation="MIILAVDSSSKVATAALMKDDKLLGEITLNDKKEHSIILMSIIQE
FT                   LLNNNNLSIDDIDGYVISKGPGSFTGLRIGMATIKGLSLGSNKPYISVSSLDALAFSVS
FT                   NFDGIICPIMDALRNSVYTSLYKGEYTCCSNNNASNLPIKLECLLDYSALDIDELIEII
FT                   KSKNEKVIFIGDGVDKYKDYLIDNCPNSYFPPNHLNLIRASSLGEIGSALLKNGEYDDP
FT                   NSAPVYLKKSQAEREYEQRMRL"
FT   gene            complement(566734..567195)
FT                   /locus_tag="Cbei_0469"
FT   CDS_pept        complement(566734..567195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0469"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   cpe:CPE2164 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32657"
FT                   /db_xref="GOA:A6LQM7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM7"
FT                   /protein_id="ABR32657.1"
FT                   /translation="MEFEIYNVDDTAKLGINLGKLLNAGDIICLTGDLGVGKTHITKGI
FT                   AKGLGINDNITSPTFTIVNEYDSGRLKLNHFDVYRVSDPDEIYAIGFDDYIFSDAVSII
FT                   EWANYIEEILPNDLLHIDIKKDYSKGEDYRKITLNAYGKRYDYIKELKI"
FT   gene            567643..568545
FT                   /locus_tag="Cbei_0470"
FT   CDS_pept        567643..568545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0470"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ctc:CTC02442 putative zinc-binding lipoprotein (adhesin B)"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32658"
FT                   /db_xref="GOA:A6LQM8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM8"
FT                   /protein_id="ABR32658.1"
FT                   /translation="MKKITFAMVIITIALSFGMSFFSNPLLANTENNRTESRDKYLNIM
FT                   TVNKPQYYMVKKIIKEKNNAEYMFTNEKDISEFKYSEDVLNNISNMDLFIYSGTSFEPW
FT                   SDSLISELKKGSLGIINLARGIKLLNYGHDNDTKENPYYFEGIEEYKIALYNVKAAIQD
FT                   RDPQNRDYYEENYNEAIKNFDTSIKEYSEKIKSLSEYKFITLNNDFDYLTKSLNLNTIQ
FT                   LDNHELSEFIKINNLDPKKIIIIVDGEKGTKLDLSGYNTIKLWKYYGDMSFDDLILYNI
FT                   KELSKWAKPNEVVNSSNAK"
FT   sig_peptide     567643..567729
FT                   /locus_tag="Cbei_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            568733..568807
FT                   /locus_tag="Cbei_R0064"
FT                   /note="tRNA-Trp1"
FT   tRNA            568733..568807
FT                   /locus_tag="Cbei_R0064"
FT                   /product="tRNA-Trp"
FT   gene            569016..569396
FT                   /locus_tag="Cbei_0471"
FT   CDS_pept        569016..569396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0471"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: dsy:DSY1808 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32659"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQM9"
FT                   /protein_id="ABR32659.1"
FT                   /translation="MLEVTNTKKAPAAIGPYSQAIGFGNILFTSGQIPLDPSTGEVVGS
FT                   NIKEQATQVMKNISAILEANDINFENVIKTTCFIANMSDFASFNEVYAKYFVSNPARSC
FT                   VAVKELPKGVLCEVEVIAFKNV"
FT   gene            complement(569494..570561)
FT                   /locus_tag="Cbei_0472"
FT   CDS_pept        complement(569494..570561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0472"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   cpe:CPE0992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32660"
FT                   /db_xref="GOA:A6LQN0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN0"
FT                   /protein_id="ABR32660.1"
FT                   /translation="MNFNSLKIGNLVAPIPIIQGGMGIGVSSSNLAAAVANAGGIGIIS
FT                   AAQLGYNEDDFEKNPLEANLRALKKHITIAKAKAVNGIIGINAMVATNNYEDHIKTAIE
FT                   AGVDLIISGAGLPTMLPKIVKNSSVKIAPIVSSLKAAKVILKLWDKHDNVAPDLVVIEG
FT                   PKAGGHLGFKVEELEDENLDFDKSVVDIINETKKYAEKYNKEIPVVVAGGVFDGYDIAK
FT                   YLKLGASGVQMATRFVATEECDASDEFKNAYVNCNKDDIQIVKSPVGMPGRAMKNTFVK
FT                   KTSSEREKITHCYNCLTPCNPANTPYCISKALINAVKGNLDEGLIFCGENASRITKITT
FT                   VKELMDELVSEIKKA"
FT   gene            570814..570888
FT                   /locus_tag="Cbei_R0065"
FT                   /note="tRNA-Trp2"
FT   tRNA            570814..570888
FT                   /locus_tag="Cbei_R0065"
FT                   /product="tRNA-Trp"
FT   gene            571244..572260
FT                   /locus_tag="Cbei_0473"
FT   CDS_pept        571244..572260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF10_0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32661"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN1"
FT                   /protein_id="ABR32661.1"
FT                   /translation="MNKLVLLNEVRKKGIENKNRLAKSTNNTINEKESNKSYISFREKF
FT                   NCFKEDDEANNSKIRYNEEFNKNGGIKNLNKIIERIFLLNNTTIIELVNSLYNDDLNMD
FT                   ARMKYNKIKKNIDINEDIKLEDSNYDLKILAEDEYRKFEYRVQFHVNDAENIAIMITKV
FT                   NLSNNHNVISLNAKKRKSVNKSEYALKHKYSKSMIILNSNIEVPDVYPIKSEAKEKNLD
FT                   YTINIIKGWKYDFKQLSEKNMYLLFPLKALDIRKRLLNMKEDLMSKDLIKDEVYRFFKD
FT                   MNKYLQRGKADDLITDKDIIEFNSITIDLLNSFIKDKSDIFTDIKRDIETTFKEIVV"
FT   gene            572475..572666
FT                   /locus_tag="Cbei_0474"
FT   CDS_pept        572475..572666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0474"
FT                   /product="small acid-soluble spore protein, alpha/beta
FT                   type"
FT                   /note="PFAM: small acid-soluble spore protein, alpha/beta
FT                   type; KEGG: cpr:CPR_2128 small, acid-soluble spore protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32662"
FT                   /db_xref="GOA:A6LQN2"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN2"
FT                   /protein_id="ABR32662.1"
FT                   /translation="MSNNNNRTLVPEARRGLEKFKDEVAQELGIPFKEYNGNLSSRQCG
FT                   SVGGEMVKRMVEEYEHRI"
FT   gene            572898..574031
FT                   /locus_tag="Cbei_0475"
FT   CDS_pept        572898..574031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0475"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cpf:CPF_2416
FT                   Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32663"
FT                   /db_xref="GOA:A6LQN3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN3"
FT                   /protein_id="ABR32663.1"
FT                   /translation="MRKIKILHIADIHFDTPFSGMTPKLALKSKEELKQVFENIMLITL
FT                   NEEIDILLIAGDVFDNLSVKKTTLHFIKSCFENISKVKVFISPGNHDPFNEKSFYSIVD
FT                   WPSNVHIFKGSVEKVILEDLKTVVWGAGFNTTHVSKSLLKDVERINGYNNIMVIHGEVS
FT                   SVKEGNNYNPIMEEDIIKSDLDYIALGHRHKFSEVKKIGNTYYSYSGCPQGRGFDELED
FT                   KGIVLLEIKNRFVESRFIRTSVRNYYEKGINIDGCFGYNEVKNRIISEIPKDDRKNNFY
FT                   KIILKGQISDEFSLSEELLEELLKDEFYFVKIIDKSEIKLDITELIKGYSLKSIFAKKI
FT                   YEELQNVTTEEDREIISLALKIGIQSISGEEVRINEM"
FT   gene            574133..576868
FT                   /locus_tag="Cbei_0476"
FT   CDS_pept        574133..576868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_2126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32664"
FT                   /db_xref="GOA:A6LQN4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN4"
FT                   /protein_id="ABR32664.1"
FT                   /translation="MIVKKINIKAFAGIKDKSLDLSRGFNLIYGKNEKGKSSIENFIKI
FT                   WLYGIENSRSKLNDRKRYMPLSGENISGELIIEHEGKSYIIKRRFGITKKEDECEILDE
FT                   ITGESLQIEYKNEPGRYFFDINLSTFIKTLFIGQLGVVISKDKEEEIMEKLTNVYNVGD
FT                   ENTSVKKVIEKLEKKKKQLLGIRKGGEIDLLKEKNNSLKTELWEAYKLAEENVQNEENL
FT                   LRKKDVKSNIKEQIQKLDLYKKYIKKIKLQKDYKEISSYLVKGEQLKRKQDAIIEELKK
FT                   GEEYITAEYLDEINERCARYLSLLDVKQEKLNKLYKSEEELRVKNEKMINYKVFSSMGS
FT                   NIKEKIYTLKVDQRNLEEKLNDIINIKNSIAGFKMNISKQASSISNLDFIKNNREEIER
FT                   LLNSYKEGLKELKYKMENQDYSKSEGDLNSLNKKINCIYFIGAICISAFIYSMLKQIIP
FT                   IMIIFIPIFIIIGIVYFKYSLLIKSSEIFRKNNISIDELKERIEEYEKRLDVYINKTNS
FT                   VSYEDFISKINQYDKYIDYKDNMILLIKNKEEEINRYDITKLKSNYNRNKGVIASLYNV
FT                   LGCKSLDEVLEQLEFYEKQKEEILIKEYEINTINKDIENINEQLADKDDEIRKKTHVLG
FT                   LENIEIVDMHVKLREYKEKINKMNEIKSALKSVEETYKVLIKDRNIDEIKEEMKQIISQ
FT                   DINYSYESEEEIDSEIRAKSNELLKIEKEIKDLEHLIEKRYLGKREISEIEEEILMNEE
FT                   KTKKLEKEFKALELASNLIQEAFDEIKKNIGPDMNKKIIKKFNFLTNDDYEEAKISEDY
FT                   KLKIRNKGMLFEGEILSNGAKDQLYLALRLSFINMLFKNKRIPIFLDDALVQYDDERRE
FT                   RALNLLMDENFEQVIFFTCQKIEKIILDRNKYDYNLINLN"
FT   gene            576978..577874
FT                   /locus_tag="Cbei_0477"
FT   CDS_pept        576978..577874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0477"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   cpf:CPF_2413 ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32665"
FT                   /db_xref="GOA:A6LQN5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN5"
FT                   /protein_id="ABR32665.1"
FT                   /translation="MKKKIISGALAVLVSFMLIGCGANANTGIQNKTEDKLKIAVSIYP
FT                   LKEFAEKIAGDKADVICLVPDNMEPHDYEPKTKDFQELTKSNAFIYNGLGMEEWVGQVN
FT                   EAIKNTNVIVVDSSTGIETRQEGDAVDPHAWLSLKNAEIQSSNIKDTLVKLDEKNKDYY
FT                   EENYNKFKEELESLYSEYKPKFDTLSKKNFITGHAAFGYLCRDFGLTQKSVENLFAEGE
FT                   PTPKQLKDLVSFCKDNNIKTVFSESLASPKVSETLAKEVQADVVPILTLESKEDDKNYI
FT                   EAMRYNLDEIYKCLSKE"
FT   sig_peptide     576978..577055
FT                   /locus_tag="Cbei_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 26"
FT   gene            578373..580163
FT                   /locus_tag="Cbei_0478"
FT   CDS_pept        578373..580163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0478"
FT                   /product="DNA mismatch repair protein MutS domain protein"
FT                   /note="PFAM: DNA mismatch repair protein MutS domain
FT                   protein; KEGG: cpr:CPR_2123 MutS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32666"
FT                   /db_xref="GOA:A6LQN6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN6"
FT                   /protein_id="ABR32666.1"
FT                   /translation="MSLAEEFYKENIQRCLRQTKDLNYKVKIIGWSRLFVVILGVLTDY
FT                   ILYSQNKLNLILISTIFFIGIFIVLIFYHNNIIQYREKINTIMKINEKGIKRLSGNFTS
FT                   FEDSGSEYLDYKHPFIDDLDVFGNNSIFQYINDTVTKGGREELVKLLKNEGNLNKLDIA
FT                   ERQEAVKELSSKAVWRQNLVLEGSLKKSKDIDLDNLINWSGGTESSSPLRIVIACTFIL
FT                   VTIFSIYLAMVKVIPQSFLLLNLMVNFIVVKVLSKSMGTEIKLFESIKNSIYGYSKILF
FT                   LIEEENFDSQYLKNLQGKLKSDKLSCKEEMKAFSNILDWIGNSSYNAYYLLFNILLFSD
FT                   VFLLRSLEKWREKNGNKLKGWLEVMHKIDALVSVCNLPFENENWTYPVILDKNEITAVN
FT                   IGHPLLGEKAVENTFLMTCNQKVSLITGSNMSGKSTFLRTLGTNLVLSYIGAPVHADKF
FT                   SCGIMKIYTCMRTKDNLEENISSFYAEILRIKILIEACKRGESVFFLLDEIFKGTNSRD
FT                   RHTGASVLIKQLIKYGGVGLVSTHDFELCDLENESEEIINYNFREFYENNKIKFDYILR
FT                   EGRSTTQNAIHLMKLAGIEV"
FT   gene            580211..581122
FT                   /locus_tag="Cbei_0479"
FT   CDS_pept        580211..581122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0479"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: cpr:CPR_2121 exonuclease family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32667"
FT                   /db_xref="GOA:A6LQN7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN7"
FT                   /protein_id="ABR32667.1"
FT                   /translation="MGYIIIDLEFNNLKNITNYQKDFFEKYGEFDSISLENEIIEIGAV
FT                   KVDKYMKPIKEIREYIKPKIFPVINPIVTEITKIDMDILNEKGVSFEEAISKLKDMFED
FT                   GDVLCSWAKDDVAELIINAHHYNYNDLRWLNEYLDIQEYVTKILAHKKALGLKSALDEL
FT                   KIKVDDTKLHDALNDAKYTVEVFRRVYNSRVIKNYIVKDIYNMPAIQVSDLESIKIKEE
FT                   KLMLKCPKCGKKIDLQTPIKLLNWRFAAVGTCPKCKCNVLCEVLVKKTLQGENGYNEVN
FT                   SVLKDEAYLNYIYKLENSEKKR"
FT   gene            581241..581690
FT                   /locus_tag="Cbei_0480"
FT   CDS_pept        581241..581690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0480"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   cpr:CPR_2120 two CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32668"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN8"
FT                   /protein_id="ABR32668.1"
FT                   /translation="MNIAFFLTPKNEVICENQDATMKQVMEKMECYGYTAIPIIDREGK
FT                   YVGTLTEGDLLWKLKNTHNLNFKNIESVKVKDIYRKTTHRSVSITSNIESLISLAVSQN
FT                   FVPVTDDDGTFIGIIKRSDIINYCFNEMEKRKELEIQQFSMYDEG"
FT   gene            complement(581877..582536)
FT                   /locus_tag="Cbei_0481"
FT   CDS_pept        complement(581877..582536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32669"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQN9"
FT                   /protein_id="ABR32669.1"
FT                   /translation="MDNDKDLNFINEERRYWGKIYTDITYAISEISPFISERDSKIRKY
FT                   FSKSPILKDYMKLLDSAEADCKKKSLFSMFKSSPSINLLQDFKAKNRENFKQLEKCSHC
FT                   ECLSCAFDCNFKKCSSCRSGSLICSCDKERVNVRKFDNFMLELTNNDTGISSKYNVLAV
FT                   VEDCTLDNLYILLENFNNSNDKLVLYYYPGIKEDSYGEITDPNEFDFVVETYQNAE"
FT   gene            complement(582547..583197)
FT                   /locus_tag="Cbei_0482"
FT   CDS_pept        complement(582547..583197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0482"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: cac:CAC0313
FT                   phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32670"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP0"
FT                   /protein_id="ABR32670.1"
FT                   /translation="MGIFSRMSNMIKAKVNNSLDEMENPVELLDQKLRDMDEQFNKAKL
FT                   SSAQILGNVHEIEKKLDSAKKESEDYDQKVRLALSKGNEELAKRALAKKVETDKKAASL
FT                   QASYDNAKIQADTLKANLRALEEEITKTRSYRDEAAARFANAEASQKVNEVLANVQTKN
FT                   NSIQIDSIERKIQRKESLAQGLGELRDLDDFDSEFKKLDEVDLDLELAKYKSN"
FT   gene            complement(583219..583896)
FT                   /locus_tag="Cbei_0483"
FT   CDS_pept        complement(583219..583896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rno:689513 hypothetical protein LOC689513"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32671"
FT                   /db_xref="GOA:A6LQP1"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP1"
FT                   /protein_id="ABR32671.1"
FT                   /translation="MITIRKIKKKYVLTIFLTFIFIFSNLSLDAMSFIGINTSNNTTVA
FT                   FAKSTGSSSRSSSSGSKFSSGSSKSSNGFSSGSFSGSSSSSKSSTNTSGDSSSSKSGEG
FT                   FKSGNFSNSDSSNSNSKNSSSSSSSGGSQGFSSGSYSTTDKSRTTDPSTSSNTNDNKNT
FT                   NTQTYNSGSNRHSFWPFFGGGYFYRPFYFGSPASSLINTLVLAGVFVLAIILIKKYLNN
FT                   KRK"
FT   sig_peptide     complement(583804..583896)
FT                   /locus_tag="Cbei_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.776 at
FT                   residue 31"
FT   gene            584264..585418
FT                   /locus_tag="Cbei_0484"
FT   CDS_pept        584264..585418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0484"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   cpf:CPF_2405 ribosomal protein S1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32672"
FT                   /db_xref="GOA:A6LQP2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP2"
FT                   /protein_id="ABR32672.1"
FT                   /translation="MSNEELESNMSELLNQYDVKRLNRGDVLKGKVIDVNDKEVSVNID
FT                   YAFDGLIAKEEVSIDDRDPMEVVSKDDEIYVYVISPNDGEGYVELSLIKALEIKDREEL
FT                   SECFKEKKNIKVHVKEETKGGVIAYYGNVRVFIPGSLASRERIELSSLVGRDLDVRITE
FT                   LDFKNKKVIASRRIIEEEEYNKNKKNIWDNLKEGEKRNGVVKKIVKFGAFVDIGGVEGL
FT                   IHLSDLSWERVNKPEDIVKEGDNVEVFIGNVDRKNERLSLILKDVTKEPWTVHGKDINE
FT                   GDIFEGKVIRLTTFGAFVELFDGIEGLVHITEITDEHIAKPSDVLEANQKVKVKVLSVN
FT                   REEKRIALSIKEAVETNKEYLDYIDNSDESGTSLGDLLKGFKFE"
FT   gene            complement(585491..586909)
FT                   /locus_tag="Cbei_0485"
FT   CDS_pept        complement(585491..586909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0485"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="TIGRFAM: pyruvate kinase; PFAM: Pyruvate kinase,
FT                   barrel; Pyruvate kinase, alpha/beta; KEGG: cpf:CPF_2404
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32673"
FT                   /db_xref="GOA:A6LQP3"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP3"
FT                   /protein_id="ABR32673.1"
FT                   /translation="MQKTKMIFTIGPASDNEETLRKFIEIGMSAARLNFSHGTHETHKE
FT                   KIELIQRLSKEMNSATAIVLDIKGPKIRTHNFVNDGVTLNDGDDFDFICGEEILGDEKR
FT                   CSISYDVLYQDIKVGGKILVDDGLLKFKVTGVEGKTIHTKVVVGGEIKNHKGVNVPNVV
FT                   IKLPSITEKDIEDIKFGCKMGVDFIAASFIRKASDILDVKKVLKENHGEHIKVIAKIEN
FT                   QEGVDNIDSIIEVTDAVMVARGDMGVEIPIQKVPIIQKMIIRKCNEAGKVVITATQMLD
FT                   SMIRNSLPTRAEASDICNAIFDGTDAIMLSGESASGCFPIEAAKTMSKIAQEAEEYLDY
FT                   NHLTARLREPSLTDYAAAISYSACRTANILHAKAIVAATKSGATARLLSRYRSKAPIIA
FT                   ITPYEQVRKGLSLNFGIFPMPCKMFNSTDEILTEAKNTVFSLNFTQPGDDIIVAAGMPT
FT                   TQTGGTNMLKIEKI"
FT   gene            587073..588530
FT                   /locus_tag="Cbei_0486"
FT   CDS_pept        587073..588530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0486"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="TIGRFAM: aminoacyl-histidine dipeptidase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   cpf:CPF_2403 aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32674"
FT                   /db_xref="GOA:A6LQP4"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP4"
FT                   /protein_id="ABR32674.1"
FT                   /translation="MKNLENITGKRIFYHFNEISKIPRGSGNEKQISDYLLSFGKSLGL
FT                   ECIQDDALNVIIKKPASKGYEKAPTVIIQGHMDMVCEKNNDKIHDFEKDPISLVVKDDY
FT                   IYADNTTLGGDDGIAVAYAMAILEDTSIEHPAIEVLITTDEETGMTGAKAVQSKDLDGK
FT                   IVLNLDSEEEGKLWVSCAGGIRTESTLPIEWTNKKENTKEYVIEVKGLAGGHSGAEIHL
FT                   ERGNANKLMARVLREILNKVSFNLVSLKGGAKDNAIPREAMAVISIDQSKEKELIEAKT
FT                   KIDSNISKELSTKDPGLKITLSESKDKIEKVFSDDTTTKAISLSYLYPNGVNTMSSEIE
FT                   GLVESSSNLGVVTTNESDIKYHSAVRSSVFSLKEEIVERNKCLTEIMGGTFESAAGYPE
FT                   WPYKSDSKIRDICKDVYLRMYGKEAEVVAIHAGLECGILKERLGDLDMISFGPNIIDIH
FT                   TPNEHLSISSACRCFEYLVEVLKEIRN"
FT   gene            588897..589490
FT                   /locus_tag="Cbei_0487"
FT   CDS_pept        588897..589490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0487"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: ctc:CTC02078
FT                   hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32675"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP5"
FT                   /protein_id="ABR32675.1"
FT                   /translation="MKIKNNRLMKCVITTFIFSGVFLINMQHAKADTTLTHNRGITIKT
FT                   SELKTAKVIKAPSDSETVSNGEDSVSRGAISKGNEVVNYAYKFLGKPYVYGAVGPNAFD
FT                   CSGLTQYVYNKFGVDISRTTYTQVNVGTKVDKSNLRAGDLVFFNTEGSISHVGIYIGNG
FT                   EFIHAPRSGKPVMVSSLCDGYYSERYATARRIFC"
FT   sig_peptide     588897..588986
FT                   /locus_tag="Cbei_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.528 at
FT                   residue 30"
FT   gene            589833..590507
FT                   /locus_tag="Cbei_0488"
FT   CDS_pept        589833..590507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_1684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32676"
FT                   /db_xref="GOA:A6LQP6"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP6"
FT                   /protein_id="ABR32676.1"
FT                   /translation="MRYTRYEYKKSGRMKFLCSVVVIVGISIVGGVLISNVVFDGKSVQ
FT                   NVGINSSKASTQGDYNGAIKNIIALQCGYYSKEENAKESLSAISKYCQPFIVEDDGKYR
FT                   VLAGIYNEEDGLKKIEEFKSNNIDVAKISLGASSDDLENKKLIEIMNGFLTIVNKLQDN
FT                   QVKSIKTAEFKAWTDGIVNEGSTVKSNKISQLYDYIKNLPDEMDKTNSSNDMQELYKLI
FT                   KN"
FT   gene            590802..591368
FT                   /locus_tag="Cbei_0489"
FT   CDS_pept        590802..591368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0489"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: cno:NT01CX_1686 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32677"
FT                   /db_xref="GOA:A6LQP7"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQP7"
FT                   /protein_id="ABR32677.1"
FT                   /translation="MKVILASASERRQELLSRLIKTFDVIVSNFDESKVIFEGSIDRYV
FT                   KDIALGKAMNIKNKLDEDAIIISADTVVTIDNMILGKPRDEEDAFNIIKSLQGRKHLVY
FT                   SGVVVINTAKNLTIQESLSTEVTFSEISDDEILEYIKTGEPLDKAGAYGIQGIGGIFVE
FT                   EIRGCYYNVVGLPLNKLKFMLKEIQ"
FT   gene            591420..592109
FT                   /locus_tag="Cbei_0490"
FT   CDS_pept        591420..592109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0490"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: ctc:CTC02075
FT                   DNA repair protein radC"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32678"
FT                   /db_xref="GOA:A6LQP8"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQP8"
FT                   /protein_id="ABR32678.1"
FT                   /translation="MESSLKIKDIPQNERPKEKLLTYGAESLSNSELLAIIIRTGTQGE
FT                   NVLQLCSRLLSELEGLNGILDASFDDIISIKGIKQGKASQILALAELFKRFRTLKAINN
FT                   DIKITSPKDLASLLMGEMNELNQEVLKVVLLNTKNIVVGIKDVFKGSLNTSVVHPREIF
FT                   KQAISKNSASIIICHNHPSGDPTPSREDINITLRIKECGNIIGIQLVDHIIIGNNKFVS
FT                   LKERGLI"
FT   gene            592130..593146
FT                   /locus_tag="Cbei_0491"
FT   CDS_pept        592130..593146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0491"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: cpf:CPF_2398 rod
FT                   shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32679"
FT                   /db_xref="GOA:A6LQP9"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQP9"
FT                   /protein_id="ABR32679.1"
FT                   /translation="MGFFGSGKDMGIDLGTANTLVFVKGKGIVLREPSVVAMNTMTKKT
FT                   LAVGSEAKLMIGRTPGNIVAIRPLKDGVIADFDTAQTMMKSLIEKVSTKNAFKNPRIIV
FT                   CYPSGVTEVEKRAIEEATKLSGARDVILMEEPMAAAIGAGLPVSEPTGSMIVDIGGGTT
FT                   EVAIISLGGIVTSKSLRIAGDELDQSIISYIKKEFNLMVGERTAEQVKMEIGSAYRTSD
FT                   EETVMEIKGRDMITGLPKIVEISETQVREALKEPVYAIIESIKTTLEKTPPELSADIME
FT                   KGIMLAGGGAYLKGLDILINKETNMPVHIAEAPLDCVVLGAGKALEDFDKISRDQRG"
FT   gene            593149..593997
FT                   /locus_tag="Cbei_0492"
FT   CDS_pept        593149..593997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0492"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: cno:NT01CX_1689
FT                   rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32680"
FT                   /db_xref="GOA:A6LQQ0"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ0"
FT                   /protein_id="ABR32680.1"
FT                   /translation="MKLLKNKLAVTIIVLSVSFLGLIVYTVRKDNRSIIESGAGSTLNP
FT                   VQSLLYSGTSRIKETLDFFLNFSEVKAQNKELIKENQELENELASYSDLKEENDRLRQV
FT                   LNFQEERNNYNYVACDIIGYSGGNFLDGYVVNKGKNDNIQKGMIVIAAQGLVGQVTSVG
FT                   SNWCIVQSLINENIAVSVMDQSTRDATGYIKGFKDSKGENLAKVYDLPMNSDVKEGDVI
FT                   MTSGVGMLYPKEIRIGEVISVEEDKVKVMKNAVVKPYVDFNKLEELFIVSPKDTREIKY
FT                   N"
FT   sig_peptide     593149..593229
FT                   /locus_tag="Cbei_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.520 at
FT                   residue 27"
FT   gene            594007..594498
FT                   /locus_tag="Cbei_0493"
FT   CDS_pept        594007..594498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0493"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: cpr:CPR_2108 rod shape-determining protein
FT                   MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32681"
FT                   /db_xref="GOA:A6LQQ1"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR017225"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ1"
FT                   /protein_id="ABR32681.1"
FT                   /translation="MEKLIIILISIGLVILDNSLIPFFSIKGAYPSLLFTFAIAYSLVN
FT                   KKERAVFMGVVSGILQDIFFFNGFGVNSLLNLFLCLLASFIGAGIIKTKRLIPVISAFF
FT                   ITIIKYAGVMLIFNFFNIEIQFSKSIIMGVYNGVIMFFVYKLVMNVYDDEYSKQRWRFR
FT                   "
FT   gene            594495..597392
FT                   /locus_tag="Cbei_0494"
FT   CDS_pept        594495..597392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0494"
FT                   /product="penicillin-binding protein, transpeptidase"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   cpr:CPR_2107 penicillin-binding protein dimerisation domain
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32682"
FT                   /db_xref="GOA:A6LQQ2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ2"
FT                   /protein_id="ABR32682.1"
FT                   /translation="MIVNKPTNKKKKKISRYTVLSIIMIAIFSVIILKLLYIQVFNYDE
FT                   YKDKADVTSTRFISEKAPRGKIYDDKGNVLATNIETYTITYTETKDADKQFYITMKELF
FT                   KILNENGESIQDSLPLKIDGNNNLYFEYKTNDKQSQNIEELRFKKDRGLNDTLKNKMFK
FT                   DVEELSDEQNAKLDEELLKITPDDAFYALVKSYNLIGLVDPDYDSKEKKNIYSKMEGKD
FT                   LTDMILKEGYSLNDIRKFMLVKDAIKMQSFKGYKSVSIADNIKKDTSLVVMQKKYDLPG
FT                   INVSSAPIRSYPYNNLASSVLGYVSSINDTQKSTYELKGYDVSSDSVGKSGIESAFEEQ
FT                   LKGVKGGTTVKVNSKGSVSQELFKLEPYPGNDVHLTIDRDIQYAADQALADKIEYIRNN
FT                   ESDDKGNRLLNATRGALVAVEVKTGRVLALTSYPNFNPNLFTVQGQLTPEQYKDYFNPD
FT                   LEKFGQEFIKRMGLNKTVDDLFPPKNGTRTDPYDLYPKAMFNYATQSKIPPGSTFKPLT
FT                   AVAGLESGVISPGEMINDTGAFNIHPEIFGKAFAPKGLEAAQGNISLTAAIAKSINFYF
FT                   YETATRMYIQAGGKANNVEALNSLAKYAWQFGLGIDPNSSAKESTGIEINESFGQTYNF
FT                   TSWRNTVLQMSTDNVINFLESGNYNNTIYFSPIDIRDKDDDNDEVKKSKKAIKDKVKDT
FT                   INKDVDDPTAVSHDTFAKDIKKDVLNLMNNSDEYKASIAGRNINLDSQATLISQALAQF
FT                   AANDQPGQVRSPGSLVSASIGQGMNTFTPLQLVSYISTLANGGTRYKIHLVDKITDGDG
FT                   NVVQEFKPEVLNTVKMSKETQDAVKQGMTAVNQEADGTGSSTFLGYPIPTAGKTGTADF
FT                   AEDQLQKGREPFATYVSFAPANDPQIAVAAVVFDGGHGSNIASVVKSVYDAYFKDQLKN
FT                   DTQYTSSSDTWKKYVLGNPYNQEANASQANTNKTH"
FT   sig_peptide     594495..594599
FT                   /locus_tag="Cbei_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.478 at
FT                   residue 35"
FT   gene            597550..598230
FT                   /locus_tag="Cbei_0495"
FT   CDS_pept        597550..598230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0495"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein; KEGG:
FT                   dsy:DSY4287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32683"
FT                   /db_xref="GOA:A6LQQ3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQQ3"
FT                   /protein_id="ABR32683.1"
FT                   /translation="MKYNNILKGKFILRPNRFIAYVEIDGNEEVCHVKNTGRCKELLIP
FT                   NATVFIQKNDNPKRKTKFSLIGVVKGDRMINMDSQVTNKVVHEWILKGNLLKDVTLIKP
FT                   EAKYKNSRFDFYVETKHKKIFIEVKGVTLENNGIVKFPDAPTERGVKHLRELIDCIKEG
FT                   YDAYVIFVIQMKEVVHFEPNVETHKEFGDTLKYAKENGVNIVAVDCLVDEDSINIRDYV
FT                   DVIL"
FT   gene            598430..599089
FT                   /locus_tag="Cbei_0496"
FT   CDS_pept        598430..599089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0496"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: cno:NT01CX_1692
FT                   septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32684"
FT                   /db_xref="GOA:A6LQQ4"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ4"
FT                   /protein_id="ABR32684.1"
FT                   /translation="MYNNDGILIKGNKDGINTTINMNKFACFDDMLVLLIKKLSKGKHF
FT                   YKGTTLILRIDLKLVNKKEVGILKEKLLTQIELKDIVLEDIEKEIEQVNEKEVKVFSGV
FT                   YEGKTKFIRKTVRSGECINYQGNIVIVGDINSGAEVYAAGNVIVLGRIRGKVSAGTNGN
FT                   IKAVIAAFLLQPELLKIANVIAMSPDDIEKPSYPELARIRDGLIIVEPYLPNKYIY"
FT   gene            599110..599910
FT                   /locus_tag="Cbei_0497"
FT   CDS_pept        599110..599910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0497"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; KEGG: cpr:CPR_2105
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32685"
FT                   /db_xref="GOA:A6LQQ5"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ5"
FT                   /protein_id="ABR32685.1"
FT                   /translation="MGVSIVITSGKGGVGKTTTTANIGTALASLGKKVVVIDGDTGLRN
FT                   LDVLLGLENRIVYTIIDVIEGRCRLKQGLIKDKRFANLFLLPTAQTKDKDDISPQEMLK
FT                   IVNELKEEFDYVLIDSPAGIEQGFENAVIGAEKAIIVVNPEITSVRDADRVIGKLDSKG
FT                   LEDHSVIVNRLNYEMTKNGDMLDVADIIETLSVELLGVVPDDKNITISTNKGEPIVLEE
FT                   GAIAGQAFRNIARRITGEEVPIIDLHTEEHQGFFSSLKKLFKRN"
FT   gene            599925..600194
FT                   /locus_tag="Cbei_0498"
FT   CDS_pept        599925..600194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0498"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: cpf:CPF_2392 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32686"
FT                   /db_xref="GOA:A6LQQ6"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQQ6"
FT                   /protein_id="ABR32686.1"
FT                   /translation="MGFFKSLNSKPTPKEVAKDRLKLILIHDRGEIAPDIIEKIREEIL
FT                   EVISKYIDIQVEDVEISVNKNGDEEGENTSALIANIPIKSIKGR"
FT   gene            600464..601594
FT                   /locus_tag="Cbei_0499"
FT   CDS_pept        600464..601594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0499"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: cpe:CPE2136 stage V
FT                   sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32687"
FT                   /db_xref="GOA:A6LQQ7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ7"
FT                   /protein_id="ABR32687.1"
FT                   /translation="MFRLLKLDMKLIKEIDKTILISLILLILYGTFNIYLCTKGQFGLS
FT                   FVKQQLGWFAISLVALYIFVAVDYKIIFNYVPILYWGVVVLLILTMVPGIGIVVNGARG
FT                   WIRLGVGNLQPSEFAKFVIILMLGKKLDEMDGKINDVKNFFTLAFYCIVPVIFIVIQPD
FT                   MGMSMVCFFIVLGIFYTMGFDTRIIAGGLACLVLGIVIVWNSGLIETYQKARFTAFLNP
FT                   SIDDASTYHLNQSLIAIGSGGLLGSSPSLAQDGVTTYAAQNVPEVQTDFIFAAIADQWG
FT                   FLGAIVLLMLYGFLIYKMISVARTSKDIFGSVICVGIVSYFLFAILQNIGMTIGLLPIT
FT                   GITLPLVSYGGSSLLTTVISIALVINVGMRRKKIHF"
FT   gene            602012..602488
FT                   /locus_tag="Cbei_0500"
FT   CDS_pept        602012..602488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_0087 cell wall endopeptidase,
FT                   family M23/M37"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32688"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ8"
FT                   /protein_id="ABR32688.1"
FT                   /translation="MGSYRSAYEDYYKNINNTTKGRKDKRNHLTSGKKANNAIIGSRYG
FT                   SNMKSNDKMINVLIKRITKELTGATLLLLFFVGLKYTPYAQVQEMHIKCKQALNRNFNY
FT                   NEYIDTFSTMQIGNIKGKDLKIGNFTVDDLKIENLKLRTFNFMEYIRSNSNMNN"
FT   gene            602608..603465
FT                   /locus_tag="Cbei_0501"
FT   CDS_pept        602608..603465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0501"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: cno:NT01CX_0086
FT                   sterol-regulatory element binding protein (SREBP) site 2
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32689"
FT                   /db_xref="GOA:A6LQQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQQ9"
FT                   /protein_id="ABR32689.1"
FT                   /translation="MKKWYMVLILELSILMWLGDYEGYIVISFLWVILHEFAHMIVASK
FT                   FGCKFNNVNISIFGAKVELSDIDELTERKKMILYLAGPFFNIFMAVVMCYLYGYFKYQI
FT                   IEDSIKVNFFLGAFNLLPAYPLDGSRVCEILLSKKLLYKRSKKITEIFSFIISGTLFLI
FT                   FIIIMILHKVNISLFLAVILITYATFIEKEKTMYIIMGDMIKKIRKLKKHNYIENKSIS
FT                   VYYKKGLVNVLSLVDKNKFNSFYILNDDMELISIIHEDELIKALKDYGNITLEEYVQLK
FT                   KKNN"
FT   gene            603663..604262
FT                   /locus_tag="Cbei_0502"
FT   CDS_pept        603663..604262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_1376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32690"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQR0"
FT                   /protein_id="ABR32690.1"
FT                   /translation="MDTLLHGKIGYFLSKELIERGYSNIIDSNFFIYGNVLPDLKLKYR
FT                   MTMHSKNEDWEKVIGIIDEIIYGEIKRNKDISIKLGILSHYLCDFFTFPHNKAFEGNII
FT                   RHELYEQTQRILWWKKLSEVWNECTEESRIELKSMNDIVDYIEDMHSIYIRNLGDKRRD
FT                   IFFSNILVRVVLSSILKIKQNIDEHKVEENINRRIV"
FT   gene            604514..606604
FT                   /locus_tag="Cbei_0503"
FT   CDS_pept        604514..606604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0503"
FT                   /product="S-layer domain protein domain"
FT                   /note="PFAM: S-layer domain protein domain protein;
FT                   Propeptide, PepSY amd peptidase M4; KEGG: cth:Cthe_2168
FT                   propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32691"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQR1"
FT                   /protein_id="ABR32691.1"
FT                   /translation="MKKKGIISGILTLCLILSTISIPTFAADEDSKNLEQAIISAKKII
FT                   TVPDDYTEFTHNSSEREVRGAKVRIWDLNWAEKEDKKGSISVSIGEDGFLYQYSNYDGD
FT                   SKDSKDGLANITKDQAQVSAEDFLKNVIPEYIGEIKLVKNDSASFQGDEYNFTYQKFVN
FT                   EIPVNYIYVNVGVNKYSGKVTSFSNDNLEVKGAEYPNLSGIIDSVTAEKAYIDKIGIDL
FT                   KYYSYYDYEKKKMNIFAGYSPSNISEFIDAKTGQVVSYSSDNKLDDRNKDHSLVNASAN
FT                   NLDKANQELTQEEMDAIQNVANLISKEKAESILRETSDLITADMKVSDASLNKNYLDDE
FT                   YSWNISFDGVYGRVNAKSGEVISLHSYNYNKLGTSGNTSKADAQNTVENFLKKVAPNKF
FT                   TQTKFKDINNPILKITDRPIEENTFMFNYVRQVNGIEFSGNYLNVEVDKNTGKIIGYDN
FT                   NWYDNASFPDVSNVINKEAAFNKIKDLAGFSLQYTMLDENKVGIVYDFINKNDSYIIDP
FT                   INGIRIDYTGKAYRENKLPEYTDINGHWCEKTVKELLDNGYYIDGEKFNPNMNITQINF
FT                   FKYIYSPVKNNYSDDEFYDMLIQNGVIKDEEKAPNSVVSYNDAAKFIIRYLGYEKLAGH
FT                   SEIFNSPFKDNIEDSYKGYASMCYALNIIKGDTNGNFNGSHNISNAEAAVILYNLIKNN
FT                   GK"
FT   sig_peptide     604514..604594
FT                   /locus_tag="Cbei_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            606771..611006
FT                   /locus_tag="Cbei_0504"
FT   CDS_pept        606771..611006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpe:MYPE1550 predicted cytoskeletal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32692"
FT                   /db_xref="GOA:A6LQR2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQR2"
FT                   /protein_id="ABR32692.1"
FT                   /translation="MLTFIFLLAFQGFSGGVAGYITNKYAVDMLFKEYTPLKLGGVIKK
FT                   KKEKFIEEISELVERDIINADTLRSEIPNININKYIEQMAQTFFEKQLSNSLGNTKIAE
FT                   IDGFSDGILKSEEFIRNNLNILLPELIDGFMRDVDLQDILSEKQTSKVINSCYELLICE
FT                   LENADAVNGFISDLYKENSNITLADIFSKEVQKKLTDNIIECVENIFNNDILSDEKSCK
FT                   MFLDNMLSNINVDATLVELQDSIVSRNINHFITETQQEEVISRLFIKITEFINSSEGKD
FT                   LILKITNEIVSIGKNIDFTLYEILPKEIEKSLTNFIKIVIPKVMPYILEWISSNKSSLD
FT                   EMIESAIDEAIQDIDESIKKLIISKVRNALMGDVSSKNNIVNKIISYINNNFDNESSDK
FT                   IVTSIIDYLKDTKVKNIVEALEKYNLVTSDEIAEIATKVFAVHGKNTLRILIKPQFSKK
FT                   VNEIAKLDLLKLFNAKFKPMLYESIFKNKTRLCKNINSLIAKFINSKSDEIFHKKLSEL
FT                   FKDERVLSLSNKFSIWTNNLFRKNKDTYSEKLEEVILSNVKKLKIGDILSNYNVNILEY
FT                   IVDNSVSIYREAVDKYKNYQVKELVNKGFNKNQLSNILINKGYPALISKLPNLLNGNIK
FT                   KIAKNSLSKYDEDEICDIVQDFMESQLKPLSVFGAVLGTVVGIIYQLIFPNSIGLYGFP
FT                   SNMFNGLLSLGVMGFIGYITNVVALWMIFHPYKENKIISKIPFFKKFALGYIPAHKNEF
FT                   AIGMAKLIDEELLNKEEINKSFNSHKDNMSSVLTTLVKNNNYQILVNFARSKKNDFVRY
FT                   IYKIILKYCNSSSDLSEGITNRLKESKFDDFIKESYIQNGILKIISSISNSKSSLTKFI
FT                   ENRISSNYKIGDVISEDILIKIQNYIQEEGNKFIQDNLSTIEKVDFLELITKEYKDDYS
FT                   AAIKQSCKEVIGKDSIEKAKINIGKYVYEYFSNDFKIYLENMTSKYLCNGLNENNDIGS
FT                   MFNGKVKNMIDNNLNHITYYFSNKLISYLRNNQNIITENVQETIKSELNFFEKIAYATF
FT                   GGDDIAYRVVDIILNKKLPLMLREENDKLINTTKAVLNENIYPIRVSELNIKGEEFNTQ
FT                   IIIDDLFEQFGENVNLKSYIYRASDLILDSLAVASISEYLELFELSTLDSIYKKFFDEA
FT                   NIIKEDICRSININRDKLSITIEKFFNENMVKNLFNIEFNSVLLKGIDSYEIENCINNI
FT                   LSIIVESEESKKSISMFMENFYENTLSELKIEQIIDASTLSNDLDRIIKYIFANAEFNQ
FT                   KIMIAIDAIVQNAINNNFNFISDRSKDYLISKTIETGLNSVGDYIVPILREINLKNISN
FT                   KQIELLNPKEIDVMFNSFVGDFFNKLRLYGVFGFVFGINAGLSFILWIIDWRYSKKYND
FT                   KNSKALKEM"
FT   gene            611267..613123
FT                   /locus_tag="Cbei_0505"
FT   CDS_pept        611267..613123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0505"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cpr:CPR_2100 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32693"
FT                   /db_xref="GOA:A6LQR3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQR3"
FT                   /protein_id="ABR32693.1"
FT                   /translation="MNKISDDILFKVEKPSRYTGGELNEIVKDLKEVDIRFAFCFPDVY
FT                   EVGMSHLGSRILYHTINQRSDTYCERSFAPWPDMEEQLRKNNIPLFTLETKDSLKEFDI
FT                   LGFTLQYEMSYTNILNMLDMSGITIRASERGEDEPIVMAGGPCAYNPEPLYDIIDFFEI
FT                   GEGEEMMNDVLDVYKKYKGKGKKKEFLREISKIQGIYVPSLYDVIYNEDNTIKEFRPKY
FT                   DDVPKTITKRIINNYTKVDFPTDIIVPYSEIVHDRIVLELFRGCTNGCRFCQAGMLYRP
FT                   VREKTREDLKDLARKLVKSTGYEEISLSSLSTCDYSDIKGLITDLVNEHEDDRVGIALP
FT                   SIRVDAFSVDLLKDIQKVRKTGLTFAPEAGSQRMRDIINKGLTEDKILDAATSAFAAGW
FT                   KTLKLYFMVGLPYEELEDCRGIGELAEKIVYRYKQVPNKINNNKGLRLTVSTSILIPKP
FT                   FTPFQWSPMAKFDEVTEKIKAVKSSIKSKCIVYNYHEQKTSVMESVFARGDRRLCDVLI
FT                   KAFEKGARFDGWDQHFKFDVWMEAMEECNLTVDFYAYRERSYDEVLPWDFIDIGVNRKY
FT                   LEIENEKAKRAELTQNCREGCTGCGINVNFKDGECFEGAILN"
FT   gene            613107..613808
FT                   /locus_tag="Cbei_0506"
FT   CDS_pept        613107..613808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE2132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32694"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQR4"
FT                   /protein_id="ABR32694.1"
FT                   /translation="MRYLTKFTKEENIKFISHLDVLKTIQKNIRRAGLPIEYSQGFNPH
FT                   MNTSIAQPLSVGVYSSGEYMDMVLTTEMDENEIVDKLNETAPSGIKYISALAIPYKEGE
FT                   KKVPQAMALIDAARYTIKIKYSDVSNLEEEVGKLLETNEWNTVKKSKKGEREVNIRAFV
FT                   KEFSFWVKDEFLILNSVISTGSREHLSADLLVSYIQEKTSNAILDSFVNTKREEMYFYK
FT                   NNKLVPLYKCV"
FT   gene            613999..615447
FT                   /locus_tag="Cbei_0507"
FT   CDS_pept        613999..615447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0507"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: cpf:CPF_2386 ribonuclease,
FT                   Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32695"
FT                   /db_xref="GOA:A6LQR5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQR5"
FT                   /protein_id="ABR32695.1"
FT                   /translation="MKEIFVERRERILRVAIKSNNELIESIVEESKNEPIIGEIYKGKI
FT                   KNIIPAINSVFVDLGLDKEGYLYYSDELKAKGIKKGDDILVEVLKEPLNDKGAKLTAKV
FT                   SIPGKYIVLNCYEQGIEFSKRIEDKEKKIELLSNIEPLKDVCITVRTEGANVDINILKN
FT                   EISKLYDEFQNIDKKMKHSLGVRKIYGEDLTLTKLLMNFSGEEIIKIYVDNSIDFDKIS
FT                   SFAKGQENLKIEKYEGYRKLFDFYGIEKELLRLRHNKVNLQCGGYIVIDRTEAMYVIDV
FT                   NSGKNIKEKSFNKTILETNLEAAREIGKQIRLRNLSGIIVIDFIDMRDKSQRDIVMDAL
FT                   KESLRLDKGNVKIFPFTQLDLVQIARKRQGKSIYEYMEEECSLCKGRGIILKLSYIEGL
FT                   IKNDIVRMQEESSINCFHIQMDSVYKDRIRENIFEFMKEIDGLDKEIYLNYVDNIEGYK
FT                   IEPLIFQGQKDNLKDYKVTVIEKY"
FT   gene            615623..615934
FT                   /locus_tag="Cbei_0508"
FT   CDS_pept        615623..615934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0508"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: cpr:CPR_2097
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32696"
FT                   /db_xref="GOA:A6LQR6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQR6"
FT                   /protein_id="ABR32696.1"
FT                   /translation="MYAVLATGGKQYRVQEGDVIYVEKLNADVDSTVELNEVLAVGTEE
FT                   GIKVGAPVVEGAKVVAKVAAQGKAKKVVVFKYKSKKDYRRKNGHRQPYTKLVIEKIEA"
FT   gene            615942..616328
FT                   /locus_tag="Cbei_0509"
FT   CDS_pept        615942..616328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0509"
FT                   /product="protein of unknown function DUF464"
FT                   /note="PFAM: protein of unknown function DUF464; KEGG:
FT                   cpf:CPF_2384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32697"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQR7"
FT                   /protein_id="ABR32697.1"
FT                   /translation="MVKVKIKQHNNDIVGFVINGHAIGNDRDFSNEPALVGEAFDMICN
FT                   SVSVLSQSVIIGLDEVLELNSTYEIQDGYLKLDLQDFNLEELNQAQVLLKTFEKSLESV
FT                   ILGFDQLVGKKKRREYITLIKEEV"
FT   gene            616333..616632
FT                   /locus_tag="Cbei_0510"
FT   CDS_pept        616333..616632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0510"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: cpr:CPR_2095
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32698"
FT                   /db_xref="GOA:A6LQR8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQR8"
FT                   /protein_id="ABR32698.1"
FT                   /translation="MLIMNLQLFAHKKGVGSSKNGRDSESKRLGVKSADGQFVLAGNIL
FT                   VRQRGTKIHPGENVGKGKDDTLFAKVDGVVKFERLGRDKKRASVYPVDVEAIAE"
FT   gene            616934..618226
FT                   /locus_tag="Cbei_0511"
FT   CDS_pept        616934..618226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0511"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein, HSR1-related;
FT                   GTP1/OBG sub domain protein; GTP1/OBG-like; KEGG:
FT                   cpr:CPR_2094 spo0B-associated GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32699"
FT                   /db_xref="GOA:A6LQR9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQR9"
FT                   /protein_id="ABR32699.1"
FT                   /translation="MFIDTAKVFVKSGNGGNGAISFRREKYVPLGGPDGGDGGKGGSII
FT                   FQVETGITTLLDFKYKKKFIAESGENGGGSKCYGKDGESLYIKVPMGTIIREAETNKII
FT                   ADLSHKGQELVLLRGGKGGKGNVKFATATKQAPHYAEPGMPGDELNIVLELKLLADVGL
FT                   LGFPNVGKSTLLSMTTKAKPKIANYHFTTLKPNLGVVAVDGIDPFVMADIPGIIEGAAE
FT                   GVGLGIQFLRHIERTRLLIHIVDISGVEGRDPFEDFIKINEELKKYSVKLWDRPQIVVA
FT                   NKSDMLYDEGIFEDFKKKVQEMGFDKVFKMSAATNEGVDAVMKEAARILKDIPVKELEI
FT                   SEDEMYIPEEKRFTYDITVEHNKEEGYDVYIVEGTFVDRLLSAVNVNDADSLRYFHKVL
FT                   RNKGIFDELREMGVKDGDMVRLNDFEFEYIL"
FT   gene            618374..618676
FT                   /locus_tag="Cbei_0512"
FT   CDS_pept        618374..618676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0512"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   cpr:CPR_2093 putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32700"
FT                   /db_xref="GOA:A6LQS0"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS0"
FT                   /protein_id="ABR32700.1"
FT                   /translation="MLTGKQRAYLRGLANDISPIFQIGKNGVEENFLIQVSQALEAREL
FT                   IKIKVLENSGLETRETSDMICKAVKCEGIQAIGNKIVLYKQSSNLKKRKIELPNK"
FT   gene            618839..619453
FT                   /locus_tag="Cbei_0513"
FT   CDS_pept        618839..619453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0513"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="3.5.4.4"
FT                   /note="TIGRFAM: cytidyltransferase-related domain;
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   PFAM: cytidylyltransferase; KEGG: cpf:CPF_2380 nicotinate
FT                   nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32701"
FT                   /db_xref="GOA:A6LQS1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQS1"
FT                   /protein_id="ABR32701.1"
FT                   /translation="MKRFGIIGGTFDPIHNAHLYIAYEAKEKLSLDEVIFMPAGIQPLK
FT                   ANNIITDPGLRYSMVKAAIEHFSEFSVSDYEIEKGGLSFTHETLEYFKNKISDRDKDNE
FT                   LFFITGADCLFSMEKWKEVKKIFSLATLVVFSRGGINKSDMINRKHMIEEKYNGKIIVL
FT                   DLKELEISSTDIRNRVHENKRIDFFVPERVSDIIYKNRLYR"
FT   gene            619540..620118
FT                   /locus_tag="Cbei_0514"
FT   CDS_pept        619540..620118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0514"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: cpr:CPR_2091 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32702"
FT                   /db_xref="GOA:A6LQS2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS2"
FT                   /protein_id="ABR32702.1"
FT                   /translation="MLSIEEMNLYLKSNLLEKRYMHTLGVADTAKRLAKLNGVSEKKAE
FT                   IAGLAHDVAKNLSIDKMREMMKENNVIISEIEEKNMNLWHSIVAPIEAKDKLGIDDDEI
FT                   LDAIRWHTTGKEDMSTLTKIIYIADMIEPGRNFDGVDEIRRTTFNNLDKGVYFGLTSSI
FT                   KILLARNLLIDENTIKARNYFLFNPEFKL"
FT   gene            620218..621510
FT                   /locus_tag="Cbei_0515"
FT   CDS_pept        620218..621510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0515"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   cpr:CPR_2090 transcription regulator LytR-like protein
FT                   lin0463"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32703"
FT                   /db_xref="GOA:A6LQS3"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS3"
FT                   /protein_id="ABR32703.1"
FT                   /translation="MRRKTNKKRDTAFSKIFKKDNDSTTVFEKLVLGIISLIITFVIVS
FT                   MVSGVYALMKVESKSMPSGASVSFNQPVNILLLGMDIGDPKQVNNQSIKRTDTIIVANY
FT                   NPQTKSIRIVSVPRDTLISINDRNVKINSAYAIGGYPKIKSEVENLLNININYIVKVDY
FT                   NAFREIIDAIGGIEMKIDRNMIYDDEGQNLHINFKAGETVTLDGKKAEEFFRWRKNNDG
FT                   SGLANGDLDRIENQQKFISKVIEKCTSPFVIFRAPKIMTALGDNVETNLSPTDILGYGF
FT                   KFIGIKKENVTMATVSGTPKTINGESFLIVDKNENKDILSSLTSSSASNKSAEGAAKDD
FT                   IRIKVLNATKINGLAAKVAKELNDAGYTKVDTGNTELSDKSEILSNDADKLKTIKQDLN
FT                   IKENDEKDNKKEYKDYDVIIILGKDFETFGK"
FT   sig_peptide     620218..620376
FT                   /locus_tag="Cbei_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.822 at
FT                   residue 53"
FT   gene            621712..622611
FT                   /locus_tag="Cbei_0516"
FT   CDS_pept        621712..622611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0516"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: cpe:CPE2122 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32704"
FT                   /db_xref="GOA:A6LQS4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS4"
FT                   /protein_id="ABR32704.1"
FT                   /translation="MSILEKQVVNIEKGTKIREYLKVELGLSTRLIRSASLGKRIFVND
FT                   EVVKMNRVLNEGEIIKIDLAKDESQDIAPEKMDIDIVYEDEDILVVNKKPFMVVHPTKS
FT                   YQSGTLANGVINYFMESGQNCIVRLVSRLDMNTSGLIIIAKNQFSHGMLSKEMSENKVE
FT                   KKYLALVHGIMKEKQGTIDLPIYKPEGIENGIRRVVDERGQRSITHYKVVEEYNESSLV
FT                   ECKLETGRTHQIRVHLSHLGHPIYGDTLYGDGDEEDLIKRQALHAFGLDFKSPRSGEIL
FT                   SLRAELPDDMKELISKLK"
FT   gene            complement(622686..623660)
FT                   /locus_tag="Cbei_0517"
FT   CDS_pept        complement(622686..623660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0517"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: cac:CAC0023 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32705"
FT                   /db_xref="GOA:A6LQS5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS5"
FT                   /protein_id="ABR32705.1"
FT                   /translation="MISFMHILVKLIISINIINYFDGDDYMDFKQLNAFLTISKLQSFT
FT                   KAADNLGYAQSSITTQIKLLESELGVKLFERIGKNITLTHEGKKLLPYAKQILKLSSAV
FT                   KNAVLNTDVPSGTLTIGAAESLCVLRLPEILKEYKKLYPEVDISLKFGNCAEFKYFLND
FT                   NIIDVAFSLGVKINSAEFISEIEIPEPMLLLAYPGHPLINKKEVFPKDIESEPLILTEM
FT                   GCSYRATLENILNSCNIKPNVAIETGSVQAIKQFTMSGLGITLLPKVAVDDEINSGKLV
FT                   PLNWKGPDFGIISQVLYHKNKWISPALKEFLNLSRSFMESYLQ"
FT   gene            623704..624789
FT                   /locus_tag="Cbei_0518"
FT   CDS_pept        623704..624789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0518"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region; KEGG: cac:CAC0022
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32706"
FT                   /db_xref="GOA:A6LQS6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS6"
FT                   /protein_id="ABR32706.1"
FT                   /translation="MGDKLKVGIIGATGMVGQRFLCLLENHPWFEVTVLAASKNSAGVT
FT                   YKEAIANRWKMTTPLPEKYKDMVVKDAFKVEEISGMVDFVFCAISLNKEQTKLLEEDYA
FT                   KHETPVISNNSANRNVDDVPMLIPEINGVHAQIIESQKKRLGTKRGFIAVKPNCSIQSY
FT                   VPPISALMEYNPKNILACTYQAISGAGKTFNECPEIIDNVIPFIDGEEEKSEKEPLKIW
FT                   GQIESGKIINANSPIITTQCIRVPVANGHLAAVYVSFKNKPSKEEIISRWENFKVPEIV
FT                   LGLPSAPKKFLKYFTENNRPQTNLDRDYENGMGISMGRLREDKIFDYKFVCLSHNTLRG
FT                   AAGGGVLSAEYLKACGYLNAK"
FT   gene            complement(624853..626088)
FT                   /locus_tag="Cbei_0519"
FT   CDS_pept        complement(624853..626088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0519"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11, D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: cno:NT01CX_0071
FT                   D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32707"
FT                   /db_xref="GOA:A6LQS7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS7"
FT                   /protein_id="ABR32707.1"
FT                   /translation="MKRIFKTFNILFLFLFCFTYTSVQAETQPPQINAEGCALIDASTG
FT                   QVLYGKNEEKVLEPASTTKVMTAIITLEKCKLDDEVTVQEDFTKIDGTAVGLLKGDVVT
FT                   VRDLLLGLLLESGNDCANALADHISGSTEAFSKLMNEKAKELGALHTNFKNPSGLPDPE
FT                   HTTTAHDLALFLREAINNKDYVQLSTTPNYTITLKNNPSKTIVLNNKNYMINKNSRYYY
FT                   PFALCGKNGYTTKSNHTYVAAAEKNGHVLVASFLNALDKDQNFHDMQAVLNYGFDNYSL
FT                   VHLYQKGDEVSQYKITNNLTIPVMASRDIDYDVPKGQEDSVSSEIKIQDQDLSKQSFNE
FT                   GDNILKGTVYVNDKEYTTMDLAAGTSRKYEFPLSINSLSNNANSELYIGSVAIVLAGVF
FT                   GLRKLINIKLKK"
FT   sig_peptide     complement(626011..626088)
FT                   /locus_tag="Cbei_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            626254..626940
FT                   /locus_tag="Cbei_0520"
FT   CDS_pept        626254..626940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0520"
FT                   /product="competence protein ComEA helix-hairpin-helix
FT                   repeat protein"
FT                   /note="TIGRFAM: competence protein ComEA
FT                   helix-hairpin-helix repeat protein; PFAM:
FT                   helix-hairpin-helix motif; KEGG: cpf:CPF_2375 putative ComE
FT                   operon protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32708"
FT                   /db_xref="GOA:A6LQS8"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS8"
FT                   /protein_id="ABR32708.1"
FT                   /translation="MVQEFLKDKKKIGIFSMLFIVVIVLIGLYVKSGFKELKKNDTESI
FT                   FVDDSIEADTSNDESVNVKNNNKSNNNDSKKQIVAAKNKNIVVEIKGEVKKPDVYTMSE
FT                   NSIVKDLIDISGGLTENADLSNINRAKKLQDHELIYISNKNDENKEIQTVNSNSSNKDI
FT                   SDKKINLNSATLDQLKTLNGIGDSKAKGIIEYREKSGGFKSIEEIKNVSGIGDNMFERI
FT                   KEQIEV"
FT   gene            627218..627910
FT                   /locus_tag="Cbei_0521"
FT   CDS_pept        627218..627910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32709"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQS9"
FT                   /protein_id="ABR32709.1"
FT                   /translation="MSKKVISILMSIIVAASLAGCTNATDSSTKKTDTTTESSTNSNDD
FT                   SLEGKWAKNYTLDQTQKLFKDKLSKMENITKDLGVKYTKDEKTRKEKDESVNDNSIYFD
FT                   NEKPEVNKIESMYFGMKTYGDNLETGDISLKLSLNFDGENAIKNNNFDLGKTSFKKYIE
FT                   AFTDQEGRDYSDINKQIIDKLKSGENQVQINNTIDGLKEEILATKTCIIYKLSTKKYKF
FT                   ADGEMSMK"
FT   sig_peptide     627218..627292
FT                   /locus_tag="Cbei_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 25"
FT   gene            627931..628329
FT                   /locus_tag="Cbei_0522"
FT   CDS_pept        627931..628329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32710"
FT                   /db_xref="GOA:A6LQT0"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT0"
FT                   /protein_id="ABR32710.1"
FT                   /translation="MEKDNLNENEINDEVEENEIKKISDTEEEADSNVNKEVESLITSD
FT                   EESDKQSSSKIILANALDQLLMIAGSALLVLLCDIILKLCGYMFVRDNGSIILAGGIIY
FT                   FIINCIYAPIMEKSKLENTFGKKILNMN"
FT   gene            628440..629798
FT                   /locus_tag="Cbei_0523"
FT   CDS_pept        628440..629798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0523"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; DNA methylase
FT                   N-4/N-6 domain protein; conserved hypothetical protein 95;
FT                   methyltransferase small; (Uracil-5)-methyltransferase;
FT                   KEGG: cpf:CPF_2370 23S rRNA (uracil-5-)-methyltransferase
FT                   RumA"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32711"
FT                   /db_xref="GOA:A6LQT1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT1"
FT                   /protein_id="ABR32711.1"
FT                   /translation="MKKGSDLSVKIEKLQFPSTGIGYAEDKTIYVKNAFPGQTVTGRVK
FT                   RKKEDYAELKLISVDERADYEIETPCSHFGVCGGCSSQSIPYEKQLEFLSEEVKELFRE
FT                   ANVDTGEYLGIQGSPNQWEYRNKMEFTFGDEAKGEPLSLGMHMRGKSFGILTVDECKLV
FT                   DEDYRKIIRLTADYFREKDLPYYRIMKAEGYLRHLVIRKAQNTGEILVNLVTTTQIDFD
FT                   LGEYVKLLRDQSYKGNLVSIIHTENNSKSDAVIPEKVNVLFGKDYIRETLLELQFNISP
FT                   FSFFQTNTKGAESLYSIVKEFMGDSEEKIVFDLYCGTGTIGQIVAPNAKKVIGIELIEE
FT                   AVEAARENAKLNGLNNCEFIAGDVAEIIKTVKVKPDIIILDPPRTGVHPKALDYVIKFN
FT                   APEIIYVSCNPKTLVNDLRVLTEKGYKVIKTKVKDMFPNTPHAETVVRLTKEL"
FT   gene            630782..632806
FT                   /locus_tag="Cbei_0524"
FT   CDS_pept        630782..632806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0524"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: PRD domain protein; Helix-turn-helix, type 11
FT                   domain protein; KEGG: tte:TTE0598 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32712"
FT                   /db_xref="GOA:A6LQT2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT2"
FT                   /protein_id="ABR32712.1"
FT                   /translation="MMLSARLIQILFLLLNSYKPIPAGSLAENLQISKRTIFRELENAD
FT                   NYLKDYSLKLETKSKKGISIIGSKANKNIVLNELNNLEYSSPKNKEERHNRIILELLKQ
FT                   EEPQKIYYYSSLLKVSEATINNDLDPVEEWFMKSNVTLIRKSGLGIYLEYEEEDYRKVC
FT                   MRYIYQKTEDPLNRLSNLVEANIVNKVIDSIKKVRDNRLSEVAESSYTELIAYLSITTK
FT                   RIIEGRKNTKEKNINLTLQSIKDYEFVIELVTLLSEQFLIEYTTTEIIDLYIYIKGAKL
FT                   QHINENEDIFDTESDIRYVVYDMIQEYDSTLAYQIKQDTEFIRGLIAHIRPTIIRLQHG
FT                   IEIQNPFQNEIKRLYPQIYEKAERAVKVIESKYNLKVPAQELGLLAIHFGGAEIRLQNN
FT                   YKFSRKIDVGVICSSGIGISALLSSEISKFFKDEVRVKTLSFNDLSSDKIHDFEVLVST
FT                   FDLNDSQFNYIKVNPMLTEEDVLLISNEIEKASLNSRTSNTEEKEDTLTYIEEIGLITK
FT                   EIGSIIKNFDLYTLSSEITIDEAMKFVSETIGGNEESKNYIYNDLMKREQVSTQVIKEF
FT                   EFVLLHARTKGVEASKFILIKPDSAQFDDEYFSNSKVIVVMLIPEDDPRGILAISSISS
FT                   ALFDDDLFLNDIKSGKKEIIQSYIEKILKEYLLEQVKSL"
FT   gene            632825..633253
FT                   /locus_tag="Cbei_0525"
FT   CDS_pept        632825..633253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0525"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; KEGG: gka:GK2018
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32713"
FT                   /db_xref="GOA:A6LQT3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT3"
FT                   /protein_id="ABR32713.1"
FT                   /translation="MLKDMLRNNIKVIDEVSSWEEAIKIASTTLKDGGFIKEEYISAML
FT                   ENVVKNGPYIVIMPGIAMPHSRPEDGVLKTGMSLLKLSKNVMFPEEKEVSLIFVLATTD
FT                   PNTHLSLISELTNLLMDDESLEKMFSAKSEEEVLECIC"
FT   gene            633247..634005
FT                   /locus_tag="Cbei_0526"
FT   CDS_pept        633247..634005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32714"
FT                   /db_xref="GOA:A6LQT4"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT4"
FT                   /protein_id="ABR32714.1"
FT                   /translation="MLNKIKSYKFLVNSFEVNADYYEKDIENIFIPLLKQLTNLEKDKN
FT                   RRILVYLAASPGVGKSTLASFLEFISKNEAGTQEIQAIGLDGFHYNQEFIKNNKVIIDG
FT                   KEVPMAEVKGCPETFDLDKLKSKIVKLKNENVKWPIYDRNLHDVVEDKILVTKNIVLIE
FT                   GNWLLLDEYGWRDLKEHCDYSIFIKAEEEMLKERLIERKRKGGGSKEAAIKFYEKSDSK
FT                   NVKRVLNNSLKADLVLELSNDGKYNNRGDF"
FT   gene            634005..635450
FT                   /locus_tag="Cbei_0527"
FT   CDS_pept        634005..635450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0527"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphotransferase system, EIIC; phosphotransferase
FT                   system, lactose/cellobiose-specific IIB subunit; KEGG:
FT                   vpa:VPA0501 mannitol-specific PTS system enzyme II
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32715"
FT                   /db_xref="GOA:A6LQT5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT5"
FT                   /protein_id="ABR32715.1"
FT                   /translation="MDTSKRLQEKDQGGVSLESTSMRAKVQAFGGFLTAMVIPNMGAFI
FT                   AWGFITALFIPTGWMPNDYFGKLVSPMITYMLPLLLAYTGGKLVYELRGGVAGVIGTFG
FT                   LIVGGNIPMFLGAMIMGPLSAYLIKKFDALIEDKIPTGFEMVINNFSLGILGLILTLLS
FT                   YSVIGPVILEANAAITVAIQGLINTGILPILAIINEPAKVLFLNNVIDQGIYYPLGMQA
FT                   TLAAGKSIYFMVASNPGAGLGLLLAYSLFGKGTSKKTAPGAIIIHFLGGIHEIYFPYVL
FT                   MKPILILAMMAGSATGIATFSLFKVGLVAGPSPGSIFAYMALTPKGNFTGVIAGVFMAT
FT                   LVSFLVASFILKTSKQEDDDFEESVKKSKEMKSQGKQILNAALIKPIQFVAFACDAGLG
FT                   SSAMGASAFRKRVEKEGLEVTVKNYAIEKVPQEADVIVTHKNLLGRTSAAWPEKRIVTI
FT                   ENFMKDVNIEELLEELVEQKAKL"
FT   gene            635472..636719
FT                   /locus_tag="Cbei_0528"
FT   CDS_pept        635472..636719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0528"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   vpa:VPA0502 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32716"
FT                   /db_xref="GOA:A6LQT6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT6"
FT                   /protein_id="ABR32716.1"
FT                   /translation="MKARAAVIAGKNKIYIREFELPEITDNELLVKVISDTVCLSTYKA
FT                   LIRGEEHKRVPEDVSEHPAITGHEFAGIIEKVGNNLKDKYKEGQRFVLQPAMGLESGYS
FT                   PGYSYEFFGGNATYCIIPKVAIDLGCVLPLNGTYFANASLSEPMSCIIGAFHANYHTKQ
FT                   YVYTHDMGIKEGGNVALLGCAGPMGLGAIEYAINGAIKPKMVVVVDIDETKLNRAASLI
FT                   KVEEAKEKGIELIYLNTKNMDTVSELMKLSGGKGYDDVFVFAAAKQLIEAADDILGNDG
FT                   CLNFFAGPTDNNFKAQFNFYKVHYEGTHIVGTSGGSKGDMLESIELSEKGLINPSFMIT
FT                   HVGGLNAAPDTIKNLPNIPGGKKLIYSHIEMELTAIEDFEKLGENNEFYSKLSEICKNN
FT                   NNVWCEEAEKFLLNNL"
FT   gene            636881..637588
FT                   /locus_tag="Cbei_0529"
FT   CDS_pept        636881..637588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0529"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   ctc:CTC01227 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32717"
FT                   /db_xref="GOA:A6LQT7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT7"
FT                   /protein_id="ABR32717.1"
FT                   /translation="MNINDIIISPSVMCADLCNLEKSIREIEKEGIDTIHIDLIDGYFS
FT                   PSMPLGIDTVKSLRKITDMNFDVHIMSNNNEFFIQEMIKIGVSQISFHYESSTHIDRYI
FT                   NLIKKNGIKAGLALNPSTSLSVLEYCLPQCDTIMLMLINPGFATDKNEKQVIYAEKKVK
FT                   DLYKLIKGNGLNTKIEVDGRVSLDTIPGLVKAGADMLVAGSTSLFIPNQSIAENKALME
FT                   KSILEGLKGREVI"
FT   gene            637590..638150
FT                   /locus_tag="Cbei_0530"
FT   CDS_pept        637590..638150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0530"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: bsu:BG11182
FT                   6-phospho-3-hexuloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32718"
FT                   /db_xref="GOA:A6LQT8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT8"
FT                   /protein_id="ABR32718.1"
FT                   /translation="MVEFTDISKEIIKELEETLVKISDAEVEQLFEQIQKADKVFFVGV
FT                   GRVLLSLEAVAKRLAHLGINSVVVGQITEPAITEKGLLIVGSGSGETAFPLAIARKAKQ
FT                   HNATVIHIGANPNSSMKEFADYFVRIPVSTKLNLPNEVPSIQPMTSLFEQSLLLLGDTI
FT                   ALMMIKEKNIDMPSLWQYHANLE"
FT   gene            638171..639352
FT                   /locus_tag="Cbei_0531"
FT   CDS_pept        638171..639352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0531"
FT                   /product="Mannitol dehydrogenase, C-terminal domain"
FT                   /note="PFAM: Mannitol dehydrogenase, C-terminal domain;
FT                   Mannitol dehydrogenase rossman, N-terminal domain; KEGG:
FT                   bld:BLi00507 mannitol-1-phosphate dehydrogenase; RBL03232"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32719"
FT                   /db_xref="GOA:A6LQT9"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQT9"
FT                   /protein_id="ABR32719.1"
FT                   /translation="MRALHFGAGNIGKGFIGYLLNKAGFDVCFVDVNQSAIDKINRNKR
FT                   YLVELLDDDHTVEVISPVSALNSITQKEEVLNSIVKADIITTSVGIGNIPRIAECIAKG
FT                   LLKRIKINKTKINIIANENAINASSTLKKEVEKYLSNEEINKICEYVGFPNSAIDRLAL
FT                   SKENEEDEVALVEPIYEWVINESEMVNNNLPYIKGVTYVANLTPYIERKLYCVNMAHAA
FT                   TAYLGFLNGEKTIQDTLKSHVIESIVKGALNETAQYFIKEYDISLEEINIFMEKILLRF
FT                   KNKNISDDILRVGRSPVRKLGMNERLVGPTLKLYEKEYPVKYMAMLVAGALLFDNPEDE
FT                   ESVILQQYIKENGIEESIRHFTGIDDGCLIIIIKNNYCKLNNYEERRSLLAHR"
FT   gene            640021..642012
FT                   /locus_tag="Cbei_0532"
FT   CDS_pept        640021..642012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0532"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase, central region; KEGG: cac:CAC1348
FT                   transketolase, TKT"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32720"
FT                   /db_xref="GOA:A6LQU0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU0"
FT                   /protein_id="ABR32720.1"
FT                   /translation="MSRELDKLSINAIRVLSADAIEKSKSGHPGLPLGSATMAYTLWAK
FT                   MNHNGKNPEWDNRDRFVLSAGHGSMLEYSLLHLFGYGLTVEDIKNFRQFGSLTPGHPEY
FT                   GHTKGVEITTGPLGQGICNAVGFAIAEAHLAEKFNKPDYSVVDHYTYAIVGDGCLMEGI
FT                   SGEASSLAGTLGLGKLVVLYDSNNISIEGNTDIAFREDVAKRYEAYGWQVLNVADGNDI
FT                   DAIEKAIEAAKAETTKPSIITVKNQIGFGCPAKQGKASAHGEPLGADNVIAMKENLGWK
FT                   TELAFYVPDEVYTNMNEHIAKGEKTEEAWNELFKAYAKAYPELAAEYTKWMSGEIDKEA
FT                   LLNNEELWSFDKEMATRESSGIMINRLAKLIPNFIGGSADLAPSNKTHMNDRGDFSAED
FT                   RSGSNLHFGVREHAMAAIANGMYAHGGLKVFCATFFVFSDYMKGAMRLSALMNLPVAYV
FT                   LTHDSIGVGEDGPTHEPIEQLAALRSMPNMTVFRPADSKETAAAWYYAVTNGTTPTSLV
FT                   LTRQKLPLYDGCPKRALKGGYILKDSKKETPDVLLMASGSEVELIYKAAAELEAKGIDA
FT                   RVISMPSFELFDVQDESYKGSVMPNKVRARVAVEALTSFGWHKYVGLDGDVISLDTFGA
FT                   SGKAEILFEKFGLTVENVVEKAISVIAK"
FT   gene            642299..642466
FT                   /locus_tag="Cbei_0533"
FT   CDS_pept        642299..642466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0533"
FT                   /product="recombinase"
FT                   /note="KEGG: cth:Cthe_1700 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32721"
FT                   /db_xref="GOA:A6LQU1"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU1"
FT                   /protein_id="ABR32721.1"
FT                   /translation="MFKDREQFNKMIEDCKAGKIDMIKIKSISKSTLDTLNSVITLKEL
FT                   ALVLFLKKKI"
FT   gene            642607..643284
FT                   /locus_tag="Cbei_0534"
FT   CDS_pept        642607..643284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0534"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: dsy:DSY3639 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32722"
FT                   /db_xref="GOA:A6LQU2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU2"
FT                   /protein_id="ABR32722.1"
FT                   /translation="MNKILVIDDDDYIRELICTVLKDEGFSVAEAVNGRDALEKLGEEK
FT                   IDLCVLDIMMPQMDGYEFCKQARRYYEDMPILMLTAKSELSQKVKGFELGTDDYLTKPF
FT                   EIDELLVRIKALLRRYKVAASRIINIGNLVMDKSSYTVISNNEQFDIPMKEFELLFMLG
FT                   SYPGKTLSRDRLIEEVWGLDFEGNERTLDVHINRLRERFQSDIYKFKITTIRGLGYRVE
FT                   EVK"
FT   gene            643281..644354
FT                   /locus_tag="Cbei_0535"
FT   CDS_pept        643281..644354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0535"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: dsy:DSY3638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32723"
FT                   /db_xref="GOA:A6LQU3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU3"
FT                   /protein_id="ABR32723.1"
FT                   /translation="MREGNRYFFSLILIFIITLLGLTSGYYICIFIFGKSESIPLHIIF
FT                   IVQSLTSAVIYFLGWKAFIYMHWRFANKHKKFDLSHFPILSGAVEAMNKIASGDFNVLV
FT                   KTNELDPFNEVADNVNRMAKELGSLEKLRQDFISDVSHEIQSPLTSISGFATLLKKGSL
FT                   DKDQISHYASIIETESKRLSKLSENLLRLSNLESEDNNLNLKKYEINKQIESVLLMLEP
FT                   QWSAKNITLDISLEETIICGDEDLLSQVFINLLNNAIKFTPENGNIGVNLYNNEDGVEC
FT                   KVSDTGIGISSEDQPRIFERFYKADKARNRSLGGNGLGLSIVKKIIDLHGGKISLTSEI
FT                   GKGTEFIIWLPKVYERK"
FT   gene            644608..645987
FT                   /locus_tag="Cbei_0536"
FT   CDS_pept        644608..645987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0536"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: lwe:lwe0973
FT                   MatE family efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32724"
FT                   /db_xref="GOA:A6LQU4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU4"
FT                   /protein_id="ABR32724.1"
FT                   /translation="MENTENIDEKSLYYLEKAPVTKAIIHMATPMILSSIASVVYNIID
FT                   AFFVGKLNNTAMMAAVILALPFSLVLMAIGQMFGVGSGTYISRLLGEGNTDNTRKVSSI
FT                   NFWSSMLMGIILMMICLPFLSSILPLLGASGETLQYTRNFIMVLVIGAPIIIVNMALDA
FT                   SVRAEGASTISMTGTIAGIIINIILNPFFIFVLNMNVMGSALASVCGNIVSVLYFIYYL
FT                   QKKSTVQSLSIKDFKPSKEIYGEIFKVGVSALLMSGFFVIISLLFNNYSMIYGDSVVAG
FT                   FGIAQRVVQIVDCIGMGFAMGVVPLIAFAYSANNQKRLMEIVKKTILYMLGLTLTLGAV
FT                   LFALRLQIIGIFSIDPNVIAIGQITLIAQLSSTVFAALCEFFTGIFQAQGDGVKSNIMA
FT                   AVRGVLFVPILIVGNLLFTVNGVIWAMTATEGLSCLIGIALWLGIRRKSLLEISMNKQI
FT                   S"
FT   gene            646716..647081
FT                   /locus_tag="Cbei_0537"
FT   CDS_pept        646716..647081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0537"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   swo:Swol_0863 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32725"
FT                   /db_xref="GOA:A6LQU5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU5"
FT                   /protein_id="ABR32725.1"
FT                   /translation="MNDKILICDDARFMRVTLKNSLEKEGYQVVDEAENGEVLIEKYKQ
FT                   LNPDLILMDITMPVMDGISALSSIMEINPNAKVIICSAMGQGDIVIKAIKTGAKDFIVK
FT                   PFRNERLIQSVRRVLEN"
FT   gene            647395..647652
FT                   /locus_tag="Cbei_0538"
FT   CDS_pept        647395..647652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32726"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU6"
FT                   /protein_id="ABR32726.1"
FT                   /translation="MLREIEELKIKDKITIEDKQMLRKALDGIKGWKFNPVAVITNGIE
FT                   DYYFICRVKTVIKDLQMKMAKVYIKIQEGSNPRLLAIEEI"
FT   gene            complement(648029..648436)
FT                   /locus_tag="Cbei_0539"
FT   CDS_pept        complement(648029..648436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32727"
FT                   /db_xref="InterPro:IPR021701"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU7"
FT                   /protein_id="ABR32727.1"
FT                   /translation="MKTFTTESIINHSCKKIFNTFVKSAKANFPDFKEKRAVGTYSKQK
FT                   KNKRFRVEITAFERDKIYEITARNRRESFITRYQLIPISENETKLIFTEIESDRNIFGK
FT                   INSALTSLLLGKRQPDEFNTFIKNLEKSLAS"
FT   gene            648740..651622
FT                   /locus_tag="Cbei_0540"
FT   CDS_pept        648740..651622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0540"
FT                   /product="sigma-54 factor, interaction domain-containing
FT                   protein"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; PTS system fructose
FT                   subfamily IIA component; PRD domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: tte:TTE0180 NtrC family transcriptional
FT                   regulator, ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32728"
FT                   /db_xref="GOA:A6LQU8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU8"
FT                   /protein_id="ABR32728.1"
FT                   /translation="MDLENKLINIINTENKKNPLTDVQMAKFLGVARESITNLRKELNI
FT                   ANSRQRRYPYLKVATSTILKKNKDIAVSELTRELLAEGFDVSRRIVEEILEKDNFEVNK
FT                   VKVEKEEVTDPFDCLIGSNGSLKNSIEQAKSAILYPPRGLTTLIVGESGVGKSKFSECM
FT                   YEFAKKKKVIKENASFVVFNCADYGDNPQLLLSLLFGHKKGAFTGADSDASGLVEEANG
FT                   GVLFLDEIHRLPPKGQEILFSIMDRGKFRRLGEANSERKVNLMLIGATTENVEANLLLT
FT                   FRRRIPMVIKIPSLHERSIREKIDIIYNEFQAECNRIDAKIFVDKKVVEILALKKFSAN
FT                   IGQLQNMIQVLCARAFMTFINKEDINKESLIIDMNQILKINDSFQDIKFQDINRAEIRK
FT                   YVKDSIFIPFMLENQLREESTEVSESAFPEDIYRQIERKYYELKKIDIQEADIESILWA
FT                   FIQNSFTNIETTFNYEKSFSMNDLRSFVSEDLLDFIETFMEELIKENPSLEINKNVFKY
FT                   LAIHVEESIKRIRLKQKIINVDKIISDTTYEYEVAKRFAMGVEKIKDIEIPNDEIIFIG
FT                   LYIKAALKSENKRDKVGLMIISHGKIATAITNVVKELLGIRFPVAIDMPLDENPINIYN
FT                   KVVELSKIIDQGKGVLFLVDMGSLNNIGDIVNKRTGIKSRTMDRVDLIIALEAARKISI
FT                   GEGNLDEIYFSLMKDRLGHRYFMESVSDKPKAIISLCLTGEGMAKYISKNLMDKYSDVN
FT                   FYEMSALDEELSNKIVKLKEDNNILAVIGTMDPEIQGINFIPYDKEILNNLNIDSLVNK
FT                   SEELKKYERIIDEDLLIFEPDIYFKKDLLEYVCSILINNGSVDKEYLSSVVNRENLAPT
FT                   YLKGEIAVPHGESSYVNKTSFVFIKLKSPIDWGVGNVNIIFMPVFKANDKVIVKNTLKI
FT                   LEDKIFIENMKNSLTELEFKNIILNKFKEI"
FT   gene            651641..652087
FT                   /locus_tag="Cbei_0541"
FT   CDS_pept        651641..652087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0541"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; KEGG: lwe:lwe0346 PTS
FT                   system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32729"
FT                   /db_xref="GOA:A6LQU9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQU9"
FT                   /protein_id="ABR32729.1"
FT                   /translation="MNSDLIALNLEVKNKEEVIQELGKRMFEKGYVKSTYIDAVLEREK
FT                   TLPTGLDIGEMCVAIPHTDSKHVNESNVALAVLKNPVEFRNMIDPSKRVEVMVVFLLAI
FT                   NDPDSQVTLLSKLMSVFQNVELLKQIKSSSSTEEVTKLLECIGI"
FT   gene            652146..652448
FT                   /locus_tag="Cbei_0542"
FT   CDS_pept        652146..652448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0542"
FT                   /product="PTS system, galactitol-specific IIB component,
FT                   putative"
FT                   /note="KEGG: lwe:lwe0348 PTS system, galactitol-specific
FT                   IIB component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32730"
FT                   /db_xref="GOA:A6LQV0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV0"
FT                   /protein_id="ABR32730.1"
FT                   /translation="MKNVNVLSVCGSGTVTSSMVAGKVKETLKEKGISSSTTEARPTEA
FT                   LNLAQSGRFDFIVYTSPLPPGDYKIPTINAFACLTGIGEDKFFEDVFKTVDELNK"
FT   sig_peptide     652146..652214
FT                   /locus_tag="Cbei_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.508 at
FT                   residue 23"
FT   gene            652480..653898
FT                   /locus_tag="Cbei_0543"
FT   CDS_pept        652480..653898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0543"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: lwe:lwe0349 PTS system, galactitol-specific IIC
FT                   component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32731"
FT                   /db_xref="GOA:A6LQV1"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV1"
FT                   /protein_id="ABR32731.1"
FT                   /translation="MLAFLKSIIDTFGSAIIVPFIIFVIAKVFRISTNKSFLSAIYAGV
FT                   ALQGFSLILNSFTPIVTPVINRMVESTGVNRPVFDVGWQATSLVAFSSSAGMIYLGLGI
FT                   LLQTVLFLIKWTDVFQPSDLWNNYSYMVWGAMVIGVTGSFPLGIACMVLLNLYSLLISE
FT                   LVARRWSNYYRYPNCTIIAMHNVEASIFAVAIDPIYNALGFNKIKLNPQQLEKKLGFFG
FT                   EPMTLGLFLGMFIGILGNVARIGTMEAWGEILKLGIATSAVMAIFPKVASMFAQAFSPI
FT                   TDGARKFMQNQGNRDWFIAVNDAVGYGEPATLISGLILIPFMLVLAMILPGNQVLPVVD
FT                   LLALPYMVQGLVAVYNGNIFKVLLSGIIWFGLGLYVCTFTAPLFTSMAVGVGVAIPAGA
FT                   MMITSFNILGKPLMGLVFFAFLTGNPVFIAIAVAVYIALWALFKKNKNAIVDYLERQAV
FT                   KNIGEDGATPSMAS"
FT   gene            654305..655351
FT                   /locus_tag="Cbei_0544"
FT   CDS_pept        654305..655351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0544"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   lmf:LMOf2365_0535 alcohol dehydrogenase, zinc-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32732"
FT                   /db_xref="GOA:A6LQV2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV2"
FT                   /protein_id="ABR32732.1"
FT                   /translation="MKASLLYGIGDVRYEIVDIPKISSNEVLVKVKNVGICGSDLPRSM
FT                   VSGLSGGAKYPIILGHEFSGEISGVGSDVKNIQIGDRVAVAPLVPCGKCIYCKSGDYGL
FT                   CTDYHIIGTRVNGALAEYVKVPADHILKLPDSLDFETAAGIEPATIAYHGLAKAGIKVG
FT                   DSVVVLGCGPIGQFAIQWAKVFGASKIIAVDIFNEKLELAKKLGANYSVNSKESDVVAE
FT                   IKKITSGGADAVIETAGSKFTQEQALLISKKKGNVVFVGISHTPLPLSESATESILRGE
FT                   LKIQGSWNSYTQPYPGNAWHATVDFMGKGEIVFKPMISHKIKLEEVGEYLKKMVNREIN
FT                   FNKVVVEI"
FT   gene            655365..656183
FT                   /locus_tag="Cbei_0545"
FT   CDS_pept        655365..656183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0545"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   cpf:CPF_0292 putative transketolase, N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32733"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV3"
FT                   /protein_id="ABR32733.1"
FT                   /translation="MKENLKKISNSIRMNIIKSVSAAKSGHPGGSLSIADILTVLYFEK
FT                   MNIDPKNPKDPNRDRFVLSKGHSAPALYCTLAERGYFPKEELLGLRKYESNLQGHPDMK
FT                   KVIGVDMSTGSLGQGLSAANGMALAGKLDESSYRVYAILGDGEAQEGQIWEAAMSAAHY
FT                   KLDNLTAFLDLNGLQIDGSNEEIMSISPIDEKFKSFGWNVVTIDGHCFEDISKAIDDAN
FT                   ATKGKPTIIICKTIKGKGVSFMENNVNWHGSAPNKEETEKALAELEGGEK"
FT   gene            656183..657100
FT                   /locus_tag="Cbei_0546"
FT   CDS_pept        656183..657100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0546"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein; KEGG: cpr:CPR_0288 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32734"
FT                   /db_xref="GOA:A6LQV4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV4"
FT                   /protein_id="ABR32734.1"
FT                   /translation="MGVATREAYGQALKELALDNNVVVLEADLGKATKSIEFKKIAPER
FT                   YFDMGISEGDMIGTAAGLATCGKIPFASTFAMFAAGRAFEQIRNSVAYPKLNVKIVATH
FT                   AGITVGEDGGSHQAIEDISLMRSIPNMVVLSPADVIEAKKAIFAAKEYNGPVYIRLGRA
FT                   ATPEIHTEDYEFNIGKGEVLRNGDDVAIIATGIMVAKALDAAQILSEQGINATVVNIST
FT                   IKPFDSSLIVEVAKRVGKIVTVEEHSIIGGLGSTVAEALIEEYPVKIKRIGINDEFGRS
FT                   GNAEVLLEKYNLTAEHIVETVKSI"
FT   gene            657116..657775
FT                   /locus_tag="Cbei_0547"
FT   CDS_pept        657116..657775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0547"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   tte:TTE1498 Pentose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32735"
FT                   /db_xref="GOA:A6LQV5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV5"
FT                   /protein_id="ABR32735.1"
FT                   /translation="MEVKLSPSILGANFLKLEETIVKLKKQGIKELHIDIMDGHFVPNI
FT                   AFGIDQIKMIKQIACDIELDVHLMVTNPEIFIDALVEAGANTITIHQESSPHIYNLMYI
FT                   IKSFGIKVGVALNPATPINTLKHISHMVNKILIMTVEPGFGGQSFIEPMMEKINEVSNF
FT                   IKSENIECELQVDGGINLENIGKVVENGATNIVVGSAIFREEDIDSTIKRFREAIL"
FT   gene            657807..658250
FT                   /locus_tag="Cbei_0548"
FT   CDS_pept        657807..658250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0548"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: tte:TTE0146 ribose
FT                   5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32736"
FT                   /db_xref="GOA:A6LQV6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV6"
FT                   /protein_id="ABR32736.1"
FT                   /translation="MIAIGADHGGYKLKEFIKGYLDKNSVEYIDVGTFSEDSIDYPQIA
FT                   MDVANRVSIGDCEKGILCCGTGIGMSIVANKIKGVRAALVGDCFTAKATREHNDSNVLC
FT                   LGGRVIGEELALMIVDIWLSTEFIGKHHVNRLNQIKEIEEKFK"
FT   gene            658277..658966
FT                   /locus_tag="Cbei_0549"
FT   CDS_pept        658277..658966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0549"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="TIGRFAM: L-ribulose-5-phosphate 4-epimerase; PFAM:
FT                   class II aldolase/adducin family protein; KEGG: gka:GK1906
FT                   L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32737"
FT                   /db_xref="GOA:A6LQV7"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV7"
FT                   /protein_id="ABR32737.1"
FT                   /translation="MLEELKKQVLKANLELPAKKLITYTWGNVSGIDRSTGLVVIKPSG
FT                   VEYDNMTLEDLVVVDLEGNVVEGSLKPSSDTPTHLELYKEFDEIGGIVHTHSTWATIWA
FT                   QIGRAIPACGTTHADYFYGSIPCTRKMTKEEISRAYEKETGTVIIEEITGNNPLHCPGV
FT                   VVNDHGPFAWGKNAEEAVHNAVVMEEVAKMAYFTELLSPDNIMDKMLMNKHFLRKHGKN
FT                   AYYGQSK"
FT   gene            659070..660635
FT                   /locus_tag="Cbei_0550"
FT   CDS_pept        659070..660635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0550"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: lwe:lwe1891
FT                   phosphoglucomutase/phosphomannomutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32738"
FT                   /db_xref="GOA:A6LQV8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQV8"
FT                   /protein_id="ABR32738.1"
FT                   /translation="MHGQKWGGFIMLQELKRLQSGTDIRGIAIEHEGTKNLTPNLVNNV
FT                   GFGFVEWLKKTKGLSSKNIKIAVGMDSRLSGPELKKSLIEALVDSGCNVYDCGICTTPA
FT                   MFMTTILENYSCDGAVMITASHLPYYYNGLKFFTKEGGCEKEDIENIIECSNLAEKKCT
FT                   TKGLVETIYFIDVYSNILVDKIRKNVNSKTNYERPLEGTKIIVDAGNGAGGFFAYKVLE
FT                   KLGASVEGSQFTEPDGNFPNHIPNPENEEAMNSIKEAVLNNKADLGIIFDTDVDRAAIV
FT                   SSDGKEINKNALIALISSIVLEENPNSIIVTDSVTSTGLSDFITSLGGIHHRFKRGYKN
FT                   VINESKRLNKEGKLSCLAIETSGHAALKENYFLDDGAYLIAKILIKMAKLKDEGKEISS
FT                   LIENLKYPKESMDMRINIKREDFKSYGEMIIEGLKKYVDHVNGWTIEPKNYEGIKINCD
FT                   KENGDGWLLLRLSLHEPVLPLNIESDSENSINKILERLMPFLRKYEDLNLDNFSNIFEV
FT                   QLKK"
FT   gene            660703..661357
FT                   /pseudo
FT                   /locus_tag="Cbei_0551"
FT   gene            661750..662583
FT                   /locus_tag="Cbei_0552"
FT   CDS_pept        661750..662583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0552"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="KEGG: mst:Msp_0992 putative endonuclease IV;
FT                   TIGRFAM: apurinic endonuclease Apn1; PFAM: Xylose isomerase
FT                   domain protein TIM barrel; SMART: AP endonuclease, family
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32739"
FT                   /db_xref="GOA:A6LQV9"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQV9"
FT                   /protein_id="ABR32739.1"
FT                   /translation="MLKIGCHLSASKGFKNMGEEAISIGGNTFQFFTRNPRGSKAKTID
FT                   ETDIKEFLKLAEENNFSKILGHAPYTLNACSADENTRNFAVEIMKDDLERMEYIPNNLY
FT                   NFHPGSHVKQGVEIGIKYISDMLNTVLKPEQTTTVLLETMAGKGTEIGRTFDELKEILN
FT                   NVELSHKVGVCLDTCHVHDAGYDIVNNLDKVVEQFDKIIGLDKLCAIHLNDSMNPFGSH
FT                   KDRHQKIGEGSIGLEGIKNIINHPMLCNLPFFLETPNELDGYAREIKLLKSIYQN"
FT   gene            662757..663437
FT                   /locus_tag="Cbei_0553"
FT   CDS_pept        662757..663437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0553"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: cpe:CPE1567 probable
FT                   peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32740"
FT                   /db_xref="GOA:A6LQW0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW0"
FT                   /protein_id="ABR32740.1"
FT                   /translation="MRITKKKSFVFITIIMGIFLLVGCGNKNASNGKGEADNSSKTSES
FT                   NEATPSANSKDLPIATIKVEGFGEIQAELYPEIAPNTVNNFIYLANKGFYNNLKFHRVI
FT                   KGFMIQGGDPQGNGTGGPGYSIEGEFTSNGFANSLKHTKGVLSMARAQDPNSAGSQFFI
FT                   MSGDAPNLDGEYAAFGKVISGLDIVDKIQNVETSSADAPKKDVVITSITVDTKGVEYKE
FT                   PNKK"
FT   sig_peptide     662757..662828
FT                   /locus_tag="Cbei_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.416 at
FT                   residue 24"
FT   gene            complement(663537..665333)
FT                   /locus_tag="Cbei_0554"
FT   CDS_pept        complement(663537..665333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0554"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   cac:CAC1669 carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32741"
FT                   /db_xref="GOA:A6LQW1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW1"
FT                   /protein_id="ABR32741.1"
FT                   /translation="MNSIVLVIIGALILILSYRFYGAFIAAKVLVLDESKKVPSEIYND
FT                   GKDYVPTNKWVLLGHHFAAIAGAGPLIGPVLAAQFGYLPGTLWILIGSVAAGAVHDMIM
FT                   LFSSVRFNGESIAEIAKHTLGKRIGFITSISVIFILIITMAGLGLPVVNSLYNSPWGTF
FT                   TVGATIPIAIFIGIYLKYIRPSKIGEATIIGMALIMLAVIFGPQIEGTTLGNFLTLDTK
FT                   QLSVILVIYGFCAAALPVWLLLLPRDYLSTYMKLGVIGALVIGIIIVRPNLEMPALTQY
FT                   VHGGGPVVSGKVFPFLFITIACGALSGFHSLISTGTTPKLIKSEKDILPIGYGSMLLEA
FT                   FVSLMALIAATSLPTADYFAINSLPEVFDKLNLVPKDLGMLESLVGEKLAGRPGGSVSL
FT                   AVGMTYVFQKLPGASTLMSYWYHFCIMFEALFILTTIDSGTRIGRYLLQDLFGKMYKPL
FT                   AKKDSKFNLVFFSALMSLSWGALLYSGNISTIWPLFGVANQTLAAIAFAIGTSVLIEMG
FT                   KKKYTPITILPMIFIAITTSTASIENIFNNYIPNGKTTLTVLSVIILAMLIIILYECIK
FT                   SWKNNWNKHPSDKINSITQAIQ"
FT   gene            665554..666747
FT                   /locus_tag="Cbei_0555"
FT   CDS_pept        665554..666747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0555"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase internal region; 5TM
FT                   Receptors of the LytS-YhcK type, transmembrane region;
FT                   KEGG: ctc:CTC01978 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32742"
FT                   /db_xref="GOA:A6LQW2"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW2"
FT                   /protein_id="ABR32742.1"
FT                   /translation="MLMVNMLERMALITIFIYVILQTNIMKCFVKDKFDRKDNIMMILI
FT                   FSLLAILGTYFGIYIKDQSLANSRPVGAIVAGYLGGPVIGIIVGFISGLHRYSFGGFTA
FT                   LACGLSTIVEGAIGGGFRILFKKKGLNPAVAGLAAVVAEITQMIIILMFSKDINSAIDL
FT                   EKTIALSMILINSIGVFLIVMVIESSKKLVDGEVKLIKLKEENKVAELKALKAQIEPHF
FT                   LFNSLNVISAYCRTDGEKARELILNLSNYFRATLEIEGDFSTLKKELALIKAYVAIEQA
FT                   RFSNRLEVKFLIDDNLLDIKFPILVLQPIVENSIKHGILKKINGGIVTISIRNDENDVS
FT                   IEISDNGVGFENADESLSTGLGLKNINNRLRLLYGESYSLNIVSSNNGSSVNFNIPK"
FT   gene            666775..667533
FT                   /locus_tag="Cbei_0556"
FT   CDS_pept        666775..667533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0556"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: ctc:CTC01979 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32743"
FT                   /db_xref="GOA:A6LQW3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW3"
FT                   /protein_id="ABR32743.1"
FT                   /translation="MKLLDEIKVAIVEDEAISSDELKYIISKDGRFKVVGQAYDGISAL
FT                   TLIESEEPDIAFIDINIPGKNGIKLAEDVKEIFPDIILIFLTAYDTYAIRAFELKVYDY
FT                   ILKPYDEKRIEESLNCALNTISNRNENEIINILSKLENKQALKKIPCENNGKIILIDVN
FT                   KISFFYSEGERNYVKTNKDIYCTTKTLQELTEKTNFFRCHRSYVVNLEKVKEVYPWFNG
FT                   TYKLIIDDDENNEIPVSRSHVKEIKIILGL"
FT   gene            complement(667762..668130)
FT                   /locus_tag="Cbei_0557"
FT   CDS_pept        complement(667762..668130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0557"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; Transcription
FT                   regulator MerR, DNA binding; KEGG: cac:CA_P0107 HTH
FT                   transcriptional regulator MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32744"
FT                   /db_xref="GOA:A6LQW4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW4"
FT                   /protein_id="ABR32744.1"
FT                   /translation="MGYSIAEVAEKTHLSPHTLRYYEKEGLLPFVDRSESGNRDFKEKD
FT                   LELLELICCLKNTGMPIKQIKEYIQLCLKGDNTIDVRREIFIKHREEVISQIAELQRNL
FT                   DKINYKINFYNCACKKTV"
FT   gene            668438..669595
FT                   /locus_tag="Cbei_0558"
FT   CDS_pept        668438..669595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0558"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; KEGG: mma:MM1948
FT                   oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32745"
FT                   /db_xref="GOA:A6LQW5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW5"
FT                   /protein_id="ABR32745.1"
FT                   /translation="MLYRGFGKTNEKVSVLGFGCMRLPIIDGDTTKIDEEKATKMIRHA
FT                   IDEGVNYIDTAYPYHGTGMGNGGESEPFVGRALKEGYREKVNLATKLPSWAIKTREDMD
FT                   KYLNEQLERLQTDRIDFYLVHALNKGSWENLKKLGIDEFLNSAIKDGRIRYAGFSFHDK
FT                   LEVFKEIVDYYDWSFCQIQYNYLDEDFQAGTEGLKYAADRGLGVVIMEPLRGGKIVRNL
FT                   PDVVTDTFDKAEIKRSPAEWALRWVWNHPEVSVVLSGMNVMDNVTENIRVAGEVLPNSL
FT                   TEKELEIMDNVKKAFKERIKVNCTACEYCMPCPAGVNIPKNFTLYNEYNIFVTPATEKE
FT                   LKERYNGVAPSERADKCVECGKCEGHCPQAIKIRQELKNVKTIFE"
FT   gene            669777..671183
FT                   /locus_tag="Cbei_0559"
FT   CDS_pept        669777..671183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0559"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   cac:CAC0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32746"
FT                   /db_xref="GOA:A6LQW6"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW6"
FT                   /protein_id="ABR32746.1"
FT                   /translation="MRILYYDCFCGISGDMNLAAMLNLGVPKEYLFKEISKLNLNSEYD
FT                   IQINSSEKLGITGTRVDVILKDEVNNSDNIGYKDFENCSTDIIEDHSHSHVHDQEHDHH
FT                   NHSHGEDASHNHEHNHPHSHEHDCSHNHEQAHVHGHSGNHEHHHRNLKDIENIINSSDL
FT                   SEKVKNLSLNMFMRVAEAEAKVHGKTLYEVHFHEVGAIDSIVDIVGAAICLDYLKVDKI
FT                   MASHVQVGGGFVKCAHGLMPVPAPATVEILKGIPINVGVVQFETTTPTGAAILAENVQE
FT                   FTSKIDFSIKKIGYGIGHRDLDIPNVLRVYLGEDNSLEKIEEQYILETNIDDMNPEFYG
FT                   YIEEKLFDAGALDVFKTPIFMKKGRPGIKLSVLISEKIEKDILDIVFEETTSIGVRKYK
FT                   VEKIMLNREFSKVETQYGEVTIKKSYYKGNLVKYKPEYEECKKIAKENNITMEKVYREV
FT                   YKQTSNIYNE"
FT   gene            671239..672063
FT                   /locus_tag="Cbei_0560"
FT   CDS_pept        671239..672063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0560"
FT                   /product="ExsB family protein"
FT                   /note="PFAM: ExsB family protein; PP-loop domain protein;
FT                   KEGG: cac:CAC0775 ATP-utilizing enzyme of the PP-loop
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32747"
FT                   /db_xref="GOA:A6LQW7"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW7"
FT                   /protein_id="ABR32747.1"
FT                   /translation="MINNDKYSELVKYLKGLGKVVLAFSGGVDSTFLLRVAKEALGDNV
FT                   KAVTILSPYIPKWEIAEARELVRELGVQHEIIEAPIIDSIKFNPEDRCYLCKTAVFTMI
FT                   LNVAKEQGYNCVIDGTNFDDISDYRPGLKALKELEVRSPLLECKLTKAEIRAFSKELGL
FT                   NTWDKPPYACLLTRIPYGNELKVEDFEKIENAEKYMMSIGFRAVRVRCHGDLARVEVSR
FT                   NDRSKLFNEELLDTIAEKIKECGFKYVTLDLQGYRVGSFNETIVKKEDNQNK"
FT   gene            672132..672878
FT                   /locus_tag="Cbei_0561"
FT   CDS_pept        672132..672878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0561"
FT                   /product="NCAIR mutase (PurE)-related protein"
FT                   /note="KEGG: cac:CAC0776 NCAIR mutase (PurE)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32748"
FT                   /db_xref="GOA:A6LQW8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW8"
FT                   /protein_id="ABR32748.1"
FT                   /translation="MNKEEIKELLESVKNNKLNVDEALEKLEDLPFKDLGFAKIDNHRE
FT                   IRVGYPEVIYCEGKTVEQVRDIVKFMITKNNNILGTRANEEMYNAVKEICEEAKYNKLG
FT                   RTITIRKNEQPLTENYIAIVAAGTSDLPVVEEAFETASILGNRVEKITDVGVAGIHRLF
FT                   SKLDVIRGAKVVIVIAGMEGALASVVGGLVDKPVIAVPTSVGYGANFGGIAALLSMLNS
FT                   CASGVSVVNIDNGFGAAYNASIINKL"
FT   gene            672996..674036
FT                   /locus_tag="Cbei_0562"
FT   CDS_pept        672996..674036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0562"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   tte:TTE0012 NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32749"
FT                   /db_xref="GOA:A6LQW9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQW9"
FT                   /protein_id="ABR32749.1"
FT                   /translation="MSKLFSNFKLKNLEFKNRIVMAPMCMYTAKEDGIATEWHKIHYAT
FT                   RALGGVGLIIQEATGVESRGRISDKDLGIWNDSQIEGLKKIVDTCKSLGAVMGIQLGHA
FT                   GRKCEINNLEIIGPSAEAFSSEYKVPKEMSKEDINEVINAFKSAAKRCIEIGYDIIEIH
FT                   GAHGYLINQFLSPLTNKRTDEYGGNLENRARFLKEVVKAVREVWTKEKPIILRISAEDY
FT                   LNEGNHPEDLAKIINLVKEEGIDIINVSSGGVAPTPVPIKVYEGYQIKFAEIIKENTGL
FT                   PVIAGGLIISPYMAEEIIQNDRADMIFLGRILLRKPYWPLEADSKLDGEVKWPEQYERG
FT                   KFRNNR"
FT   gene            674151..674297
FT                   /locus_tag="Cbei_0563"
FT   CDS_pept        674151..674297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32750"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQX0"
FT                   /protein_id="ABR32750.1"
FT                   /translation="MDNNKNRIKDRPKSNAERRKIDPKNNADLGIIDGKKIGAPPHKEK
FT                   DHL"
FT   gene            674452..674877
FT                   /locus_tag="Cbei_0564"
FT   CDS_pept        674452..674877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32751"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQX1"
FT                   /protein_id="ABR32751.1"
FT                   /translation="MKLDLTIFELGKLLKKIEDKYDLNILVKLALSGGWATITGNANVL
FT                   KYPNDSNCGCNGKDNIIDISVEHDGNEHGSVIKITGAKDKKFDIDISSTRYKELRPNNL
FT                   TVNKIKINENESKLRIDENIIFTIGASVDDIKELIEN"
FT   gene            674960..675097
FT                   /locus_tag="Cbei_0565"
FT   CDS_pept        674960..675097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_1219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32752"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQX2"
FT                   /protein_id="ABR32752.1"
FT                   /translation="MDNSMKRKHTSKHKTLNHNPQAESVKAVFGEPKAKDSEFTPRTFD
FT                   "
FT   gene            675552..677480
FT                   /locus_tag="Cbei_0566"
FT   CDS_pept        675552..677480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0566"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="PFAM: PrkA serine kinase; PrkA AAA domain protein;
FT                   KEGG: cac:CAC0579 serine protein kinase (PrkA protein),
FT                   P-loop containing"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32753"
FT                   /db_xref="GOA:A6LQX3"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQX3"
FT                   /protein_id="ABR32753.1"
FT                   /translation="MSMNFKEFIETDREKSNTQKFEGSFLEYLDIVKENPEVVNLAHKR
FT                   IYEMIMSKGVEELKGEENPRVRKIYGNDLIRKYGFFKNDFYGIDKVIMKLASYFKSAAM
FT                   KGEESRQVLYLVGPVGAGKSSIVESLKSALESCEPVYSLKGCPMHEEPLHLIPKHLRPK
FT                   FEEMLGVQIEGDLCPVCRYKLVNELKGVYEDFPVERTGFSIRSRKGIGVVPPVDPNNQD
FT                   TSILTGSIDISKMDMYSEDDPRIFSLNGAFNVGNRGLVEFIEVFKNDVEYLHTIITATQ
FT                   EKSVPSPGKGSMIYFDGVIVAHSNEAEWNKFKSDHTNEAILDRIVKVEVPYCLELDEEV
FT                   KIYEKIIKKSNFKAHIAPHTIEIAAMFAILSRLTPSAKVDAVTKLKIYNGEEIVEKGTT
FT                   KKIDIGELREEAGQYEGMKGISTRFIIKAIDNALAESGYDCINPLSIMESIIKSVRELD
FT                   IAADDKKKYLGFIQDNIRKEYNKILEREITKAFIHSFREQAESLFNNYIDNAEAYVNKT
FT                   KIKDVSTGEELNPDEEFMRSIEEQIGVYAASAKGFRSDVTSYMFYIVRKGGKLDYTSYE
FT                   PLKEAIEKKLTASVKDLSRIITKSKVRDKEQAEKYDSMVEEMKRNGYCLHCCDVILKYA
FT                   ANNLWRD"
FT   gene            677489..678661
FT                   /locus_tag="Cbei_0567"
FT   CDS_pept        677489..678661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0567"
FT                   /product="Sporulation protein YhbH"
FT                   /note="TIGRFAM: Sporulation protein YhbH; PFAM: protein of
FT                   unknown function DUF444; KEGG: cpe:CPE1333 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32754"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6LQX4"
FT                   /protein_id="ABR32754.1"
FT                   /translation="MAIFRDYTNNQIDHDRSIEDRRRHRQLVEKSIKENLGDILSEESI
FT                   VGESKNKKFKIPIKGIKEYQFVYGKNSKGVASGVGNEKRGEKLGNGNKKLAKGNQGAGN
FT                   EEGDDIYETEITLEELMDYISEDLNLPNLDQKKYSEIVTETSGKKRGYQTHGIRPRLAK
FT                   KKTVMSKIARKQGKKRALKELESDEELERFPFREEDLRYYRVKLKPKKDSNAVMLFIMD
FT                   ASGSMDVTKKYLARSYFFVLATFLKRKYNNIAFEFIYHTTVAKRVDEFEFFHKSESGGT
FT                   YISSGINEALKVIEEKYPPAAWNIYSIYASDGDNWSEDNEKAVAAVKDICEVSNMFGYA
FT                   ELLPSTYTTTMYHKFKKEITNEKFVPVIIKEKKDLWDALKIMLRKELKEE"
FT   gene            678666..680036
FT                   /locus_tag="Cbei_0568"
FT   CDS_pept        678666..680036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0568"
FT                   /product="SpoVR family protein"
FT                   /note="PFAM: SpoVR family protein; KEGG: cpf:CPF_1539 stage
FT                   V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32755"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQX5"
FT                   /protein_id="ABR32755.1"
FT                   /translation="MEYSFNDIEKWNEKIEKKVREYGLECYPQEFEIIGFNEMIGYEAY
FT                   VGMPSRYPHWSFGKSYEKSKTLYSLNLTGLPYEMVINSDPCLAYLMKDNTLLLQILTMA
FT                   HVYGHNDFFRNNRLFKEGTNAKYTLEMFNLDAKIIRNYIDDPSIGYSEVERILDAGHAI
FT                   RYQSKRTVGVKELTNNEIKENILKDYENKKENRDILDPYEEISLPDLDKIPLEPVDDLM
FT                   GFIINYGQLQEWQKTILRIVKRETEYFIPQIETKIMNEGWASYTHYNILKQLELPQELH
FT                   LEFLKRHNDVIAPAIGGLNPYYVGFKVFEDIEKRYGKEKIFEVREIERDSSFLRRYLTK
FT                   ELCEELNLFQYNQRTFDVVIEEISDETGWKTIRDTLSYTAGMGNIPYIRVVDLNKKNYT
FT                   LTLENVFDGRPLELSYAKETLKYVQELWGHDVRLITKSSDKQEVILTCNQEKKIIVS"
FT   gene            680187..680729
FT                   /locus_tag="Cbei_0569"
FT   CDS_pept        680187..680729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0569"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: cpr:CPR_1331 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32756"
FT                   /db_xref="GOA:A6LQX6"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQX6"
FT                   /protein_id="ABR32756.1"
FT                   /translation="MNLKGSQTERNLFKTFAGESRARNKYTFYAEKARDDGFLYVAEVF
FT                   EATAGNEKAHAREVFRRYLDRINNTKNNLIESALSESEESKVIYKEFEEIAREEGFDDI
FT                   ADFYKELQEVEEHHKERFLDLAKKLKEGKMFKSDREEEWICLNCGYIYEGKEAPMKCPL
FT                   CRYPRAYFRRLCNEDCK"
FT   gene            680741..681097
FT                   /locus_tag="Cbei_0570"
FT   CDS_pept        680741..681097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR32757"
FT                   /db_xref="UniProtKB/TrEMBL:A6LQX7"
FT                   /protein_id="ABR32757.1"
FT                   /translation="MIYEYPEEFVVPVVYVEGLKEKPINRSLEFKYFQIDESMTPSEKP
FT                   QENKMFQMSTYHDEDISNKGMMFLDLDEDLLQKPYHEKYKFDDIVESEEEHYSSNNIFN
FT                   DIDNEYADGETLRM"
FT   gene            681183..681527
FT                   /locus_tag="Cbei_0571"
FT   CDS_pept        681183..681527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cbei_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:CPE1330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cbei_0571"
FT                   /