(data stored in ACNUC7421 zone)

EMBL: CP000724

ID   CP000724; SV 1; circular; genomic DNA; STD; PRO; 4929566 BP.
XX
AC   CP000724; AAKU01000000-AAKU01000263;
XX
PR   Project:PRJNA13006;
XX
DT   29-JUN-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Alkaliphilus metalliredigens QYMF, complete genome.
XX
KW   .
XX
OS   Alkaliphilus metalliredigens QYMF
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Alkaliphilus.
XX
RN   [1]
RP   1-4929566
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chertkov O., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Ye Q., Zhou J., Fields M.,
RA   Richardson P.;
RT   "Complete sequence of Alkaliphilus metalliredigens QYMF";
RL   Unpublished.
XX
RN   [2]
RP   1-4929566
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chertkov O., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Ye Q., Zhou J., Fields M.,
RA   Richardson P.;
RT   ;
RL   Submitted (13-JUN-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 185f85ced07fb2db2c08cf016694f831.
DR   BioSample; SAMN02598282.
DR   EnsemblGenomes-Gn; Amet_R0001.
DR   EnsemblGenomes-Gn; Amet_R0002.
DR   EnsemblGenomes-Gn; Amet_R0003.
DR   EnsemblGenomes-Gn; Amet_R0004.
DR   EnsemblGenomes-Gn; Amet_R0005.
DR   EnsemblGenomes-Gn; Amet_R0006.
DR   EnsemblGenomes-Gn; Amet_R0007.
DR   EnsemblGenomes-Gn; Amet_R0008.
DR   EnsemblGenomes-Gn; Amet_R0010.
DR   EnsemblGenomes-Gn; Amet_R0011.
DR   EnsemblGenomes-Gn; Amet_R0012.
DR   EnsemblGenomes-Gn; Amet_R0013.
DR   EnsemblGenomes-Gn; Amet_R0014.
DR   EnsemblGenomes-Gn; Amet_R0015.
DR   EnsemblGenomes-Gn; Amet_R0016.
DR   EnsemblGenomes-Gn; Amet_R0017.
DR   EnsemblGenomes-Gn; Amet_R0018.
DR   EnsemblGenomes-Gn; Amet_R0019.
DR   EnsemblGenomes-Gn; Amet_R0020.
DR   EnsemblGenomes-Gn; Amet_R0021.
DR   EnsemblGenomes-Gn; Amet_R0022.
DR   EnsemblGenomes-Gn; Amet_R0023.
DR   EnsemblGenomes-Gn; Amet_R0024.
DR   EnsemblGenomes-Gn; Amet_R0025.
DR   EnsemblGenomes-Gn; Amet_R0026.
DR   EnsemblGenomes-Gn; Amet_R0027.
DR   EnsemblGenomes-Gn; Amet_R0028.
DR   EnsemblGenomes-Gn; Amet_R0029.
DR   EnsemblGenomes-Gn; Amet_R0030.
DR   EnsemblGenomes-Gn; Amet_R0031.
DR   EnsemblGenomes-Gn; Amet_R0032.
DR   EnsemblGenomes-Gn; Amet_R0033.
DR   EnsemblGenomes-Gn; Amet_R0034.
DR   EnsemblGenomes-Gn; Amet_R0035.
DR   EnsemblGenomes-Gn; Amet_R0036.
DR   EnsemblGenomes-Gn; Amet_R0037.
DR   EnsemblGenomes-Gn; Amet_R0038.
DR   EnsemblGenomes-Gn; Amet_R0039.
DR   EnsemblGenomes-Gn; Amet_R0040.
DR   EnsemblGenomes-Gn; Amet_R0041.
DR   EnsemblGenomes-Gn; Amet_R0042.
DR   EnsemblGenomes-Gn; Amet_R0043.
DR   EnsemblGenomes-Gn; Amet_R0044.
DR   EnsemblGenomes-Gn; Amet_R0045.
DR   EnsemblGenomes-Gn; Amet_R0046.
DR   EnsemblGenomes-Gn; Amet_R0047.
DR   EnsemblGenomes-Gn; Amet_R0048.
DR   EnsemblGenomes-Gn; Amet_R0050.
DR   EnsemblGenomes-Gn; Amet_R0051.
DR   EnsemblGenomes-Gn; Amet_R0052.
DR   EnsemblGenomes-Gn; Amet_R0053.
DR   EnsemblGenomes-Gn; Amet_R0054.
DR   EnsemblGenomes-Gn; Amet_R0055.
DR   EnsemblGenomes-Gn; Amet_R0056.
DR   EnsemblGenomes-Gn; Amet_R0057.
DR   EnsemblGenomes-Gn; Amet_R0058.
DR   EnsemblGenomes-Gn; Amet_R0059.
DR   EnsemblGenomes-Gn; Amet_R0060.
DR   EnsemblGenomes-Gn; Amet_R0061.
DR   EnsemblGenomes-Gn; Amet_R0062.
DR   EnsemblGenomes-Gn; Amet_R0063.
DR   EnsemblGenomes-Gn; Amet_R0064.
DR   EnsemblGenomes-Gn; Amet_R0065.
DR   EnsemblGenomes-Gn; Amet_R0066.
DR   EnsemblGenomes-Gn; Amet_R0067.
DR   EnsemblGenomes-Gn; Amet_R0068.
DR   EnsemblGenomes-Gn; Amet_R0069.
DR   EnsemblGenomes-Gn; Amet_R0070.
DR   EnsemblGenomes-Gn; Amet_R0071.
DR   EnsemblGenomes-Gn; Amet_R0072.
DR   EnsemblGenomes-Gn; Amet_R0073.
DR   EnsemblGenomes-Gn; Amet_R0074.
DR   EnsemblGenomes-Gn; Amet_R0075.
DR   EnsemblGenomes-Gn; Amet_R0076.
DR   EnsemblGenomes-Gn; Amet_R0077.
DR   EnsemblGenomes-Gn; Amet_R0078.
DR   EnsemblGenomes-Gn; Amet_R0079.
DR   EnsemblGenomes-Gn; Amet_R0080.
DR   EnsemblGenomes-Gn; Amet_R0081.
DR   EnsemblGenomes-Gn; Amet_R0082.
DR   EnsemblGenomes-Gn; Amet_R0083.
DR   EnsemblGenomes-Gn; Amet_R0084.
DR   EnsemblGenomes-Gn; Amet_R0085.
DR   EnsemblGenomes-Gn; Amet_R0086.
DR   EnsemblGenomes-Gn; Amet_R0087.
DR   EnsemblGenomes-Gn; Amet_R0088.
DR   EnsemblGenomes-Gn; Amet_R0089.
DR   EnsemblGenomes-Gn; Amet_R0090.
DR   EnsemblGenomes-Gn; Amet_R0091.
DR   EnsemblGenomes-Gn; Amet_R0092.
DR   EnsemblGenomes-Gn; Amet_R0093.
DR   EnsemblGenomes-Gn; Amet_R0094.
DR   EnsemblGenomes-Gn; Amet_R0095.
DR   EnsemblGenomes-Gn; Amet_R0096.
DR   EnsemblGenomes-Gn; Amet_R0097.
DR   EnsemblGenomes-Gn; Amet_R0098.
DR   EnsemblGenomes-Gn; Amet_R0099.
DR   EnsemblGenomes-Gn; Amet_R0100.
DR   EnsemblGenomes-Gn; Amet_R0101.
DR   EnsemblGenomes-Gn; Amet_R0102.
DR   EnsemblGenomes-Gn; Amet_R0103.
DR   EnsemblGenomes-Gn; Amet_R0104.
DR   EnsemblGenomes-Gn; Amet_R0105.
DR   EnsemblGenomes-Gn; Amet_R0106.
DR   EnsemblGenomes-Gn; Amet_R0107.
DR   EnsemblGenomes-Gn; Amet_R0108.
DR   EnsemblGenomes-Gn; Amet_R0109.
DR   EnsemblGenomes-Gn; Amet_R0110.
DR   EnsemblGenomes-Gn; Amet_R0111.
DR   EnsemblGenomes-Gn; Amet_R0112.
DR   EnsemblGenomes-Gn; Amet_R0113.
DR   EnsemblGenomes-Gn; Amet_R0114.
DR   EnsemblGenomes-Gn; Amet_R0115.
DR   EnsemblGenomes-Gn; Amet_R0116.
DR   EnsemblGenomes-Gn; Amet_R0117.
DR   EnsemblGenomes-Gn; Amet_R0118.
DR   EnsemblGenomes-Gn; Amet_R0119.
DR   EnsemblGenomes-Gn; Amet_R0120.
DR   EnsemblGenomes-Gn; Amet_R0121.
DR   EnsemblGenomes-Gn; Amet_R0122.
DR   EnsemblGenomes-Gn; Amet_R0123.
DR   EnsemblGenomes-Gn; Amet_R0124.
DR   EnsemblGenomes-Gn; Amet_R0125.
DR   EnsemblGenomes-Gn; Amet_R0126.
DR   EnsemblGenomes-Gn; Amet_R0127.
DR   EnsemblGenomes-Gn; Amet_R0128.
DR   EnsemblGenomes-Gn; Amet_R0129.
DR   EnsemblGenomes-Gn; Amet_R0130.
DR   EnsemblGenomes-Gn; Amet_R0131.
DR   EnsemblGenomes-Gn; Amet_R0132.
DR   EnsemblGenomes-Gn; Amet_R0133.
DR   EnsemblGenomes-Gn; Amet_R0134.
DR   EnsemblGenomes-Gn; Amet_R0135.
DR   EnsemblGenomes-Gn; Amet_R0136.
DR   EnsemblGenomes-Gn; Amet_R0137.
DR   EnsemblGenomes-Gn; Amet_R0138.
DR   EnsemblGenomes-Gn; Amet_R0139.
DR   EnsemblGenomes-Gn; EBG00001229168.
DR   EnsemblGenomes-Gn; EBG00001229169.
DR   EnsemblGenomes-Gn; EBG00001229170.
DR   EnsemblGenomes-Gn; EBG00001229171.
DR   EnsemblGenomes-Gn; EBG00001229172.
DR   EnsemblGenomes-Gn; EBG00001229173.
DR   EnsemblGenomes-Gn; EBG00001229174.
DR   EnsemblGenomes-Gn; EBG00001229175.
DR   EnsemblGenomes-Gn; EBG00001229176.
DR   EnsemblGenomes-Gn; EBG00001229177.
DR   EnsemblGenomes-Gn; EBG00001229178.
DR   EnsemblGenomes-Gn; EBG00001229179.
DR   EnsemblGenomes-Gn; EBG00001229180.
DR   EnsemblGenomes-Gn; EBG00001229181.
DR   EnsemblGenomes-Gn; EBG00001229182.
DR   EnsemblGenomes-Gn; EBG00001229183.
DR   EnsemblGenomes-Gn; EBG00001229184.
DR   EnsemblGenomes-Gn; EBG00001229185.
DR   EnsemblGenomes-Gn; EBG00001229186.
DR   EnsemblGenomes-Gn; EBG00001229187.
DR   EnsemblGenomes-Gn; EBG00001229188.
DR   EnsemblGenomes-Gn; EBG00001229189.
DR   EnsemblGenomes-Gn; EBG00001229190.
DR   EnsemblGenomes-Gn; EBG00001229191.
DR   EnsemblGenomes-Gn; EBG00001229192.
DR   EnsemblGenomes-Gn; EBG00001229193.
DR   EnsemblGenomes-Gn; EBG00001229194.
DR   EnsemblGenomes-Gn; EBG00001229195.
DR   EnsemblGenomes-Gn; EBG00001229196.
DR   EnsemblGenomes-Gn; EBG00001229197.
DR   EnsemblGenomes-Gn; EBG00001229198.
DR   EnsemblGenomes-Gn; EBG00001229199.
DR   EnsemblGenomes-Gn; EBG00001229200.
DR   EnsemblGenomes-Gn; EBG00001229201.
DR   EnsemblGenomes-Gn; EBG00001229202.
DR   EnsemblGenomes-Gn; EBG00001229203.
DR   EnsemblGenomes-Gn; EBG00001229204.
DR   EnsemblGenomes-Gn; EBG00001229205.
DR   EnsemblGenomes-Gn; EBG00001229206.
DR   EnsemblGenomes-Gn; EBG00001229207.
DR   EnsemblGenomes-Gn; EBG00001229208.
DR   EnsemblGenomes-Gn; EBG00001229209.
DR   EnsemblGenomes-Gn; EBG00001229210.
DR   EnsemblGenomes-Gn; EBG00001229211.
DR   EnsemblGenomes-Gn; EBG00001229212.
DR   EnsemblGenomes-Gn; EBG00001229213.
DR   EnsemblGenomes-Gn; EBG00001229214.
DR   EnsemblGenomes-Gn; EBG00001229215.
DR   EnsemblGenomes-Gn; EBG00001229216.
DR   EnsemblGenomes-Gn; EBG00001229217.
DR   EnsemblGenomes-Gn; EBG00001229218.
DR   EnsemblGenomes-Gn; EBG00001229219.
DR   EnsemblGenomes-Gn; EBG00001229220.
DR   EnsemblGenomes-Gn; EBG00001229221.
DR   EnsemblGenomes-Gn; EBG00001229222.
DR   EnsemblGenomes-Gn; EBG00001229223.
DR   EnsemblGenomes-Gn; EBG00001229224.
DR   EnsemblGenomes-Gn; EBG00001229225.
DR   EnsemblGenomes-Gn; EBG00001229226.
DR   EnsemblGenomes-Gn; EBG00001229227.
DR   EnsemblGenomes-Gn; EBG00001229228.
DR   EnsemblGenomes-Gn; EBG00001229229.
DR   EnsemblGenomes-Gn; EBG00001229230.
DR   EnsemblGenomes-Gn; EBG00001229231.
DR   EnsemblGenomes-Gn; EBG00001229232.
DR   EnsemblGenomes-Gn; EBG00001229233.
DR   EnsemblGenomes-Gn; EBG00001229234.
DR   EnsemblGenomes-Gn; EBG00001229235.
DR   EnsemblGenomes-Gn; EBG00001229236.
DR   EnsemblGenomes-Gn; EBG00001229237.
DR   EnsemblGenomes-Gn; EBG00001229238.
DR   EnsemblGenomes-Gn; EBG00001229239.
DR   EnsemblGenomes-Gn; EBG00001229240.
DR   EnsemblGenomes-Gn; EBG00001229241.
DR   EnsemblGenomes-Gn; EBG00001229242.
DR   EnsemblGenomes-Gn; EBG00001229243.
DR   EnsemblGenomes-Gn; EBG00001229244.
DR   EnsemblGenomes-Gn; EBG00001229245.
DR   EnsemblGenomes-Gn; EBG00001229246.
DR   EnsemblGenomes-Gn; EBG00001229247.
DR   EnsemblGenomes-Gn; EBG00001229248.
DR   EnsemblGenomes-Gn; EBG00001229249.
DR   EnsemblGenomes-Gn; EBG00001229250.
DR   EnsemblGenomes-Gn; EBG00001229251.
DR   EnsemblGenomes-Gn; EBG00001229252.
DR   EnsemblGenomes-Gn; EBG00001229253.
DR   EnsemblGenomes-Gn; EBG00001229254.
DR   EnsemblGenomes-Gn; EBG00001229255.
DR   EnsemblGenomes-Gn; EBG00001229256.
DR   EnsemblGenomes-Gn; EBG00001229257.
DR   EnsemblGenomes-Gn; EBG00001229258.
DR   EnsemblGenomes-Gn; EBG00001229259.
DR   EnsemblGenomes-Gn; EBG00001229260.
DR   EnsemblGenomes-Gn; EBG00001229261.
DR   EnsemblGenomes-Gn; EBG00001229262.
DR   EnsemblGenomes-Gn; EBG00001229263.
DR   EnsemblGenomes-Gn; EBG00001229264.
DR   EnsemblGenomes-Gn; EBG00001229265.
DR   EnsemblGenomes-Gn; EBG00001229266.
DR   EnsemblGenomes-Gn; EBG00001229267.
DR   EnsemblGenomes-Gn; EBG00001229268.
DR   EnsemblGenomes-Gn; EBG00001229269.
DR   EnsemblGenomes-Gn; EBG00001229270.
DR   EnsemblGenomes-Gn; EBG00001229271.
DR   EnsemblGenomes-Gn; EBG00001229272.
DR   EnsemblGenomes-Gn; EBG00001229273.
DR   EnsemblGenomes-Gn; EBG00001229274.
DR   EnsemblGenomes-Gn; EBG00001229275.
DR   EnsemblGenomes-Gn; EBG00001229276.
DR   EnsemblGenomes-Gn; EBG00001229277.
DR   EnsemblGenomes-Gn; EBG00001229278.
DR   EnsemblGenomes-Gn; EBG00001229279.
DR   EnsemblGenomes-Gn; EBG00001229280.
DR   EnsemblGenomes-Gn; EBG00001229281.
DR   EnsemblGenomes-Gn; EBG00001229282.
DR   EnsemblGenomes-Gn; EBG00001229283.
DR   EnsemblGenomes-Gn; EBG00001229284.
DR   EnsemblGenomes-Gn; EBG00001229285.
DR   EnsemblGenomes-Gn; EBG00001229286.
DR   EnsemblGenomes-Gn; EBG00001229287.
DR   EnsemblGenomes-Gn; EBG00001229288.
DR   EnsemblGenomes-Gn; EBG00001229289.
DR   EnsemblGenomes-Gn; EBG00001229290.
DR   EnsemblGenomes-Gn; EBG00001229291.
DR   EnsemblGenomes-Gn; EBG00001229292.
DR   EnsemblGenomes-Gn; EBG00001229293.
DR   EnsemblGenomes-Gn; EBG00001229294.
DR   EnsemblGenomes-Gn; EBG00001229295.
DR   EnsemblGenomes-Gn; EBG00001229296.
DR   EnsemblGenomes-Gn; EBG00001229297.
DR   EnsemblGenomes-Gn; EBG00001229298.
DR   EnsemblGenomes-Gn; EBG00001229299.
DR   EnsemblGenomes-Gn; EBG00001229300.
DR   EnsemblGenomes-Gn; EBG00001229301.
DR   EnsemblGenomes-Gn; EBG00001229302.
DR   EnsemblGenomes-Gn; EBG00001229303.
DR   EnsemblGenomes-Gn; EBG00001229304.
DR   EnsemblGenomes-Gn; EBG00001229305.
DR   EnsemblGenomes-Gn; EBG00001229306.
DR   EnsemblGenomes-Gn; EBG00001229307.
DR   EnsemblGenomes-Gn; EBG00001229308.
DR   EnsemblGenomes-Gn; EBG00001229309.
DR   EnsemblGenomes-Gn; EBG00001229310.
DR   EnsemblGenomes-Gn; EBG00001229311.
DR   EnsemblGenomes-Gn; EBG00001229312.
DR   EnsemblGenomes-Gn; EBG00001229313.
DR   EnsemblGenomes-Gn; EBG00001229314.
DR   EnsemblGenomes-Gn; EBG00001229315.
DR   EnsemblGenomes-Gn; EBG00001229316.
DR   EnsemblGenomes-Gn; EBG00001229317.
DR   EnsemblGenomes-Gn; EBG00001229318.
DR   EnsemblGenomes-Gn; EBG00001229319.
DR   EnsemblGenomes-Gn; EBG00001229320.
DR   EnsemblGenomes-Gn; EBG00001229321.
DR   EnsemblGenomes-Gn; EBG00001229322.
DR   EnsemblGenomes-Gn; EBG00001229323.
DR   EnsemblGenomes-Gn; EBG00001229324.
DR   EnsemblGenomes-Gn; EBG00001229325.
DR   EnsemblGenomes-Gn; EBG00001229326.
DR   EnsemblGenomes-Gn; EBG00001229327.
DR   EnsemblGenomes-Gn; EBG00001229328.
DR   EnsemblGenomes-Gn; EBG00001229329.
DR   EnsemblGenomes-Gn; EBG00001229330.
DR   EnsemblGenomes-Gn; EBG00001229331.
DR   EnsemblGenomes-Gn; EBG00001229332.
DR   EnsemblGenomes-Gn; EBG00001229333.
DR   EnsemblGenomes-Tr; Amet_R0001-1.
DR   EnsemblGenomes-Tr; Amet_R0002-1.
DR   EnsemblGenomes-Tr; Amet_R0003-1.
DR   EnsemblGenomes-Tr; Amet_R0004-1.
DR   EnsemblGenomes-Tr; Amet_R0005-1.
DR   EnsemblGenomes-Tr; Amet_R0006-1.
DR   EnsemblGenomes-Tr; Amet_R0007-1.
DR   EnsemblGenomes-Tr; Amet_R0008-1.
DR   EnsemblGenomes-Tr; Amet_R0010-1.
DR   EnsemblGenomes-Tr; Amet_R0011-1.
DR   EnsemblGenomes-Tr; Amet_R0012-1.
DR   EnsemblGenomes-Tr; Amet_R0013-1.
DR   EnsemblGenomes-Tr; Amet_R0014-1.
DR   EnsemblGenomes-Tr; Amet_R0015-1.
DR   EnsemblGenomes-Tr; Amet_R0016-1.
DR   EnsemblGenomes-Tr; Amet_R0017-1.
DR   EnsemblGenomes-Tr; Amet_R0018-1.
DR   EnsemblGenomes-Tr; Amet_R0019-1.
DR   EnsemblGenomes-Tr; Amet_R0020-1.
DR   EnsemblGenomes-Tr; Amet_R0021-1.
DR   EnsemblGenomes-Tr; Amet_R0022-1.
DR   EnsemblGenomes-Tr; Amet_R0023-1.
DR   EnsemblGenomes-Tr; Amet_R0024-1.
DR   EnsemblGenomes-Tr; Amet_R0025-1.
DR   EnsemblGenomes-Tr; Amet_R0026-1.
DR   EnsemblGenomes-Tr; Amet_R0027-1.
DR   EnsemblGenomes-Tr; Amet_R0028-1.
DR   EnsemblGenomes-Tr; Amet_R0029-1.
DR   EnsemblGenomes-Tr; Amet_R0030-1.
DR   EnsemblGenomes-Tr; Amet_R0031-1.
DR   EnsemblGenomes-Tr; Amet_R0032-1.
DR   EnsemblGenomes-Tr; Amet_R0033-1.
DR   EnsemblGenomes-Tr; Amet_R0034-1.
DR   EnsemblGenomes-Tr; Amet_R0035-1.
DR   EnsemblGenomes-Tr; Amet_R0036-1.
DR   EnsemblGenomes-Tr; Amet_R0037-1.
DR   EnsemblGenomes-Tr; Amet_R0038-1.
DR   EnsemblGenomes-Tr; Amet_R0039-1.
DR   EnsemblGenomes-Tr; Amet_R0040-1.
DR   EnsemblGenomes-Tr; Amet_R0041-1.
DR   EnsemblGenomes-Tr; Amet_R0042-1.
DR   EnsemblGenomes-Tr; Amet_R0043-1.
DR   EnsemblGenomes-Tr; Amet_R0044-1.
DR   EnsemblGenomes-Tr; Amet_R0045-1.
DR   EnsemblGenomes-Tr; Amet_R0046-1.
DR   EnsemblGenomes-Tr; Amet_R0047-1.
DR   EnsemblGenomes-Tr; Amet_R0048-1.
DR   EnsemblGenomes-Tr; Amet_R0050-1.
DR   EnsemblGenomes-Tr; Amet_R0051-1.
DR   EnsemblGenomes-Tr; Amet_R0052-1.
DR   EnsemblGenomes-Tr; Amet_R0053-1.
DR   EnsemblGenomes-Tr; Amet_R0054-1.
DR   EnsemblGenomes-Tr; Amet_R0055-1.
DR   EnsemblGenomes-Tr; Amet_R0056-1.
DR   EnsemblGenomes-Tr; Amet_R0057-1.
DR   EnsemblGenomes-Tr; Amet_R0058-1.
DR   EnsemblGenomes-Tr; Amet_R0059-1.
DR   EnsemblGenomes-Tr; Amet_R0060-1.
DR   EnsemblGenomes-Tr; Amet_R0061-1.
DR   EnsemblGenomes-Tr; Amet_R0062-1.
DR   EnsemblGenomes-Tr; Amet_R0063-1.
DR   EnsemblGenomes-Tr; Amet_R0064-1.
DR   EnsemblGenomes-Tr; Amet_R0065-1.
DR   EnsemblGenomes-Tr; Amet_R0066-1.
DR   EnsemblGenomes-Tr; Amet_R0067-1.
DR   EnsemblGenomes-Tr; Amet_R0068-1.
DR   EnsemblGenomes-Tr; Amet_R0069-1.
DR   EnsemblGenomes-Tr; Amet_R0070-1.
DR   EnsemblGenomes-Tr; Amet_R0071-1.
DR   EnsemblGenomes-Tr; Amet_R0072-1.
DR   EnsemblGenomes-Tr; Amet_R0073-1.
DR   EnsemblGenomes-Tr; Amet_R0074-1.
DR   EnsemblGenomes-Tr; Amet_R0075-1.
DR   EnsemblGenomes-Tr; Amet_R0076-1.
DR   EnsemblGenomes-Tr; Amet_R0077-1.
DR   EnsemblGenomes-Tr; Amet_R0078-1.
DR   EnsemblGenomes-Tr; Amet_R0079-1.
DR   EnsemblGenomes-Tr; Amet_R0080-1.
DR   EnsemblGenomes-Tr; Amet_R0081-1.
DR   EnsemblGenomes-Tr; Amet_R0082-1.
DR   EnsemblGenomes-Tr; Amet_R0083-1.
DR   EnsemblGenomes-Tr; Amet_R0084-1.
DR   EnsemblGenomes-Tr; Amet_R0085-1.
DR   EnsemblGenomes-Tr; Amet_R0086-1.
DR   EnsemblGenomes-Tr; Amet_R0087-1.
DR   EnsemblGenomes-Tr; Amet_R0088-1.
DR   EnsemblGenomes-Tr; Amet_R0089-1.
DR   EnsemblGenomes-Tr; Amet_R0090-1.
DR   EnsemblGenomes-Tr; Amet_R0091-1.
DR   EnsemblGenomes-Tr; Amet_R0092-1.
DR   EnsemblGenomes-Tr; Amet_R0093-1.
DR   EnsemblGenomes-Tr; Amet_R0094-1.
DR   EnsemblGenomes-Tr; Amet_R0095-1.
DR   EnsemblGenomes-Tr; Amet_R0096-1.
DR   EnsemblGenomes-Tr; Amet_R0097-1.
DR   EnsemblGenomes-Tr; Amet_R0098-1.
DR   EnsemblGenomes-Tr; Amet_R0099-1.
DR   EnsemblGenomes-Tr; Amet_R0100-1.
DR   EnsemblGenomes-Tr; Amet_R0101-1.
DR   EnsemblGenomes-Tr; Amet_R0102-1.
DR   EnsemblGenomes-Tr; Amet_R0103-1.
DR   EnsemblGenomes-Tr; Amet_R0104-1.
DR   EnsemblGenomes-Tr; Amet_R0105-1.
DR   EnsemblGenomes-Tr; Amet_R0106-1.
DR   EnsemblGenomes-Tr; Amet_R0107-1.
DR   EnsemblGenomes-Tr; Amet_R0108-1.
DR   EnsemblGenomes-Tr; Amet_R0109-1.
DR   EnsemblGenomes-Tr; Amet_R0110-1.
DR   EnsemblGenomes-Tr; Amet_R0111-1.
DR   EnsemblGenomes-Tr; Amet_R0112-1.
DR   EnsemblGenomes-Tr; Amet_R0113-1.
DR   EnsemblGenomes-Tr; Amet_R0114-1.
DR   EnsemblGenomes-Tr; Amet_R0115-1.
DR   EnsemblGenomes-Tr; Amet_R0116-1.
DR   EnsemblGenomes-Tr; Amet_R0117-1.
DR   EnsemblGenomes-Tr; Amet_R0118-1.
DR   EnsemblGenomes-Tr; Amet_R0119-1.
DR   EnsemblGenomes-Tr; Amet_R0120-1.
DR   EnsemblGenomes-Tr; Amet_R0121-1.
DR   EnsemblGenomes-Tr; Amet_R0122-1.
DR   EnsemblGenomes-Tr; Amet_R0123-1.
DR   EnsemblGenomes-Tr; Amet_R0124-1.
DR   EnsemblGenomes-Tr; Amet_R0125-1.
DR   EnsemblGenomes-Tr; Amet_R0126-1.
DR   EnsemblGenomes-Tr; Amet_R0127-1.
DR   EnsemblGenomes-Tr; Amet_R0128-1.
DR   EnsemblGenomes-Tr; Amet_R0129-1.
DR   EnsemblGenomes-Tr; Amet_R0130-1.
DR   EnsemblGenomes-Tr; Amet_R0131-1.
DR   EnsemblGenomes-Tr; Amet_R0132-1.
DR   EnsemblGenomes-Tr; Amet_R0133-1.
DR   EnsemblGenomes-Tr; Amet_R0134-1.
DR   EnsemblGenomes-Tr; Amet_R0135-1.
DR   EnsemblGenomes-Tr; Amet_R0136-1.
DR   EnsemblGenomes-Tr; Amet_R0137-1.
DR   EnsemblGenomes-Tr; Amet_R0138-1.
DR   EnsemblGenomes-Tr; Amet_R0139-1.
DR   EnsemblGenomes-Tr; EBT00001797651.
DR   EnsemblGenomes-Tr; EBT00001797652.
DR   EnsemblGenomes-Tr; EBT00001797653.
DR   EnsemblGenomes-Tr; EBT00001797654.
DR   EnsemblGenomes-Tr; EBT00001797655.
DR   EnsemblGenomes-Tr; EBT00001797656.
DR   EnsemblGenomes-Tr; EBT00001797657.
DR   EnsemblGenomes-Tr; EBT00001797658.
DR   EnsemblGenomes-Tr; EBT00001797659.
DR   EnsemblGenomes-Tr; EBT00001797660.
DR   EnsemblGenomes-Tr; EBT00001797661.
DR   EnsemblGenomes-Tr; EBT00001797662.
DR   EnsemblGenomes-Tr; EBT00001797663.
DR   EnsemblGenomes-Tr; EBT00001797664.
DR   EnsemblGenomes-Tr; EBT00001797665.
DR   EnsemblGenomes-Tr; EBT00001797666.
DR   EnsemblGenomes-Tr; EBT00001797667.
DR   EnsemblGenomes-Tr; EBT00001797668.
DR   EnsemblGenomes-Tr; EBT00001797669.
DR   EnsemblGenomes-Tr; EBT00001797670.
DR   EnsemblGenomes-Tr; EBT00001797671.
DR   EnsemblGenomes-Tr; EBT00001797672.
DR   EnsemblGenomes-Tr; EBT00001797673.
DR   EnsemblGenomes-Tr; EBT00001797674.
DR   EnsemblGenomes-Tr; EBT00001797675.
DR   EnsemblGenomes-Tr; EBT00001797676.
DR   EnsemblGenomes-Tr; EBT00001797677.
DR   EnsemblGenomes-Tr; EBT00001797678.
DR   EnsemblGenomes-Tr; EBT00001797679.
DR   EnsemblGenomes-Tr; EBT00001797680.
DR   EnsemblGenomes-Tr; EBT00001797681.
DR   EnsemblGenomes-Tr; EBT00001797682.
DR   EnsemblGenomes-Tr; EBT00001797683.
DR   EnsemblGenomes-Tr; EBT00001797684.
DR   EnsemblGenomes-Tr; EBT00001797685.
DR   EnsemblGenomes-Tr; EBT00001797686.
DR   EnsemblGenomes-Tr; EBT00001797687.
DR   EnsemblGenomes-Tr; EBT00001797688.
DR   EnsemblGenomes-Tr; EBT00001797689.
DR   EnsemblGenomes-Tr; EBT00001797690.
DR   EnsemblGenomes-Tr; EBT00001797691.
DR   EnsemblGenomes-Tr; EBT00001797692.
DR   EnsemblGenomes-Tr; EBT00001797693.
DR   EnsemblGenomes-Tr; EBT00001797694.
DR   EnsemblGenomes-Tr; EBT00001797695.
DR   EnsemblGenomes-Tr; EBT00001797696.
DR   EnsemblGenomes-Tr; EBT00001797697.
DR   EnsemblGenomes-Tr; EBT00001797698.
DR   EnsemblGenomes-Tr; EBT00001797699.
DR   EnsemblGenomes-Tr; EBT00001797700.
DR   EnsemblGenomes-Tr; EBT00001797701.
DR   EnsemblGenomes-Tr; EBT00001797702.
DR   EnsemblGenomes-Tr; EBT00001797703.
DR   EnsemblGenomes-Tr; EBT00001797704.
DR   EnsemblGenomes-Tr; EBT00001797706.
DR   EnsemblGenomes-Tr; EBT00001797708.
DR   EnsemblGenomes-Tr; EBT00001797709.
DR   EnsemblGenomes-Tr; EBT00001797710.
DR   EnsemblGenomes-Tr; EBT00001797712.
DR   EnsemblGenomes-Tr; EBT00001797714.
DR   EnsemblGenomes-Tr; EBT00001797715.
DR   EnsemblGenomes-Tr; EBT00001797717.
DR   EnsemblGenomes-Tr; EBT00001797718.
DR   EnsemblGenomes-Tr; EBT00001797719.
DR   EnsemblGenomes-Tr; EBT00001797720.
DR   EnsemblGenomes-Tr; EBT00001797721.
DR   EnsemblGenomes-Tr; EBT00001797722.
DR   EnsemblGenomes-Tr; EBT00001797723.
DR   EnsemblGenomes-Tr; EBT00001797724.
DR   EnsemblGenomes-Tr; EBT00001797725.
DR   EnsemblGenomes-Tr; EBT00001797726.
DR   EnsemblGenomes-Tr; EBT00001797727.
DR   EnsemblGenomes-Tr; EBT00001797728.
DR   EnsemblGenomes-Tr; EBT00001797729.
DR   EnsemblGenomes-Tr; EBT00001797730.
DR   EnsemblGenomes-Tr; EBT00001797731.
DR   EnsemblGenomes-Tr; EBT00001797732.
DR   EnsemblGenomes-Tr; EBT00001797733.
DR   EnsemblGenomes-Tr; EBT00001797735.
DR   EnsemblGenomes-Tr; EBT00001797736.
DR   EnsemblGenomes-Tr; EBT00001797737.
DR   EnsemblGenomes-Tr; EBT00001797738.
DR   EnsemblGenomes-Tr; EBT00001797739.
DR   EnsemblGenomes-Tr; EBT00001797740.
DR   EnsemblGenomes-Tr; EBT00001797742.
DR   EnsemblGenomes-Tr; EBT00001797743.
DR   EnsemblGenomes-Tr; EBT00001797744.
DR   EnsemblGenomes-Tr; EBT00001797746.
DR   EnsemblGenomes-Tr; EBT00001797747.
DR   EnsemblGenomes-Tr; EBT00001797748.
DR   EnsemblGenomes-Tr; EBT00001797749.
DR   EnsemblGenomes-Tr; EBT00001797752.
DR   EnsemblGenomes-Tr; EBT00001797754.
DR   EnsemblGenomes-Tr; EBT00001797756.
DR   EnsemblGenomes-Tr; EBT00001797759.
DR   EnsemblGenomes-Tr; EBT00001797761.
DR   EnsemblGenomes-Tr; EBT00001797762.
DR   EnsemblGenomes-Tr; EBT00001797763.
DR   EnsemblGenomes-Tr; EBT00001797764.
DR   EnsemblGenomes-Tr; EBT00001797765.
DR   EnsemblGenomes-Tr; EBT00001797766.
DR   EnsemblGenomes-Tr; EBT00001797767.
DR   EnsemblGenomes-Tr; EBT00001797768.
DR   EnsemblGenomes-Tr; EBT00001797769.
DR   EnsemblGenomes-Tr; EBT00001797770.
DR   EnsemblGenomes-Tr; EBT00001797771.
DR   EnsemblGenomes-Tr; EBT00001797772.
DR   EnsemblGenomes-Tr; EBT00001797773.
DR   EnsemblGenomes-Tr; EBT00001797774.
DR   EnsemblGenomes-Tr; EBT00001797775.
DR   EnsemblGenomes-Tr; EBT00001797776.
DR   EnsemblGenomes-Tr; EBT00001797777.
DR   EnsemblGenomes-Tr; EBT00001797778.
DR   EnsemblGenomes-Tr; EBT00001797779.
DR   EnsemblGenomes-Tr; EBT00001797780.
DR   EnsemblGenomes-Tr; EBT00001797781.
DR   EnsemblGenomes-Tr; EBT00001797783.
DR   EnsemblGenomes-Tr; EBT00001797784.
DR   EnsemblGenomes-Tr; EBT00001797785.
DR   EnsemblGenomes-Tr; EBT00001797786.
DR   EnsemblGenomes-Tr; EBT00001797787.
DR   EnsemblGenomes-Tr; EBT00001797788.
DR   EnsemblGenomes-Tr; EBT00001797789.
DR   EnsemblGenomes-Tr; EBT00001797790.
DR   EnsemblGenomes-Tr; EBT00001797791.
DR   EnsemblGenomes-Tr; EBT00001797792.
DR   EnsemblGenomes-Tr; EBT00001797793.
DR   EnsemblGenomes-Tr; EBT00001797794.
DR   EnsemblGenomes-Tr; EBT00001797796.
DR   EnsemblGenomes-Tr; EBT00001797797.
DR   EnsemblGenomes-Tr; EBT00001797798.
DR   EnsemblGenomes-Tr; EBT00001797799.
DR   EnsemblGenomes-Tr; EBT00001797800.
DR   EnsemblGenomes-Tr; EBT00001797801.
DR   EnsemblGenomes-Tr; EBT00001797802.
DR   EnsemblGenomes-Tr; EBT00001797803.
DR   EnsemblGenomes-Tr; EBT00001797804.
DR   EnsemblGenomes-Tr; EBT00001797806.
DR   EnsemblGenomes-Tr; EBT00001797807.
DR   EnsemblGenomes-Tr; EBT00001797808.
DR   EnsemblGenomes-Tr; EBT00001797810.
DR   EnsemblGenomes-Tr; EBT00001797813.
DR   EnsemblGenomes-Tr; EBT00001797814.
DR   EnsemblGenomes-Tr; EBT00001797815.
DR   EnsemblGenomes-Tr; EBT00001797817.
DR   EnsemblGenomes-Tr; EBT00001797818.
DR   EnsemblGenomes-Tr; EBT00001797820.
DR   EnsemblGenomes-Tr; EBT00001797821.
DR   EnsemblGenomes-Tr; EBT00001797822.
DR   EnsemblGenomes-Tr; EBT00001797823.
DR   EnsemblGenomes-Tr; EBT00001797824.
DR   EnsemblGenomes-Tr; EBT00001797826.
DR   EnsemblGenomes-Tr; EBT00001797827.
DR   EnsemblGenomes-Tr; EBT00001797828.
DR   EnsemblGenomes-Tr; EBT00001797829.
DR   EnsemblGenomes-Tr; EBT00001797830.
DR   EnsemblGenomes-Tr; EBT00001797831.
DR   EnsemblGenomes-Tr; EBT00001797832.
DR   EnsemblGenomes-Tr; EBT00001797833.
DR   EnsemblGenomes-Tr; EBT00001797835.
DR   EnsemblGenomes-Tr; EBT00001797837.
DR   EnsemblGenomes-Tr; EBT00001797839.
DR   EnsemblGenomes-Tr; EBT00001797841.
DR   EnsemblGenomes-Tr; EBT00001797843.
DR   EnsemblGenomes-Tr; EBT00001797845.
DR   EnsemblGenomes-Tr; EBT00001797846.
DR   EuropePMC; PMC2900426; 20553716.
DR   EuropePMC; PMC3386446; 23729896.
DR   EuropePMC; PMC3584212; 23239474.
DR   EuropePMC; PMC5095475; 27811105.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP000724.
DR   SILVA-SSU; CP000724.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634496
CC   Source DNA and bacteria available from Matthew Fields
CC   (matthew.fields@erc.montana.edu)
CC   Contacts: Matthew Fields (matthew.fields@erc.montana.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4929566
FT                   /organism="Alkaliphilus metalliredigens QYMF"
FT                   /strain="QYMF"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:293826"
FT   gene            50..1396
FT                   /locus_tag="Amet_0001"
FT   CDS_pept        50..1396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase; KEGG: cno:NT01CX_0867 chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46244"
FT                   /db_xref="GOA:A6TJ76"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJ76"
FT                   /protein_id="ABR46244.1"
FT                   /translation="MHDNLPQIWEKAINLIKTELTEVSFNTWVKPIQAISLDNETLVLG
FT                   VPNDFTQGILNARYNTLISNAVKQVTSKNYEVHIVVPSEERVGDTQNINARRSNAQSPI
FT                   MGNSPLILNPKYTFDTFVIGNSNRFAHAASVAVAESPAKAYNPLFIYGGVGLGKTHLMN
FT                   AIGHYILANNPKAKVVYVSSETFTNELINSIRDDRNVEFRNRYRNVDVLLVDDIQFIAG
FT                   KERTQEEFFHTFNALHESNKQIIISSDRPPKEIPTLEERLRSRFEWGLITDIQPPDLET
FT                   RIAILRKKAQMENIYVPDEVTAHIAKKIQSNIRELEGALIRIVAYSSLTNSEVTVELAS
FT                   EALKEIFTSKPRLLNVPLIKEVVSNHFSIKLEDFDSKKRTRSISYPRQVAMYLTRELTD
FT                   LSLPKIGDEFGGRDHTTVMHAHSKIVNEINSDSDLKNKLDAIIKELKSD"
FT   gene            1629..2735
FT                   /locus_tag="Amet_0002"
FT   CDS_pept        1629..2735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain; KEGG: ctc:CTC00093 DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46245"
FT                   /db_xref="GOA:A6TJ77"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ77"
FT                   /protein_id="ABR46245.1"
FT                   /translation="MHFSCSQKALMHSISIVQKGVSAKTTLPILKGIYIETNNEGLRLV
FT                   GTDLEIGIEHVMEADVLQEGIVVVDARLFSEIIRKLPDAEVDITLKENNQLEIKCASTE
FT                   FNILVYSPDEFPELPIVEEDQVYEIAQELFKGMIRQTVFATSQDESRPILTGVLMEIEE
FT                   NTLNMVALDGYRLALRKGKISGNSNHKVVVPAKTLNEVNRILNPDEEEPLHITLTNNHA
FT                   LFTAGKTKLISRLLEGEFINYKQILPKEHRSKVTIKGKEILNSIERASLLAKEGRNNLV
FT                   RFVVNDEKMVITSNSELGKVHEEINIVLEGEDIEIAFNSKYFIDALKVIDDEEVCLEFT
FT                   TNLSPGILKPLANENYTYLVLPVRLASN"
FT   gene            2819..3028
FT                   /locus_tag="Amet_0003"
FT   CDS_pept        2819..3028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   cth:Cthe_2373 RNA-binding S4"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46246"
FT                   /db_xref="GOA:A6TJ78"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ78"
FT                   /protein_id="ABR46246.1"
FT                   /translation="MLKEVKIEGEYIKLDQILKLGELVGSGGQAKLLILNGEVKVNGNI
FT                   VIQRGKKIRPGDIVELFDDKVKVI"
FT   gene            3115..4221
FT                   /locus_tag="Amet_0004"
FT   CDS_pept        3115..4221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: cth:Cthe_2374 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46247"
FT                   /db_xref="GOA:A6TJ79"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJ79"
FT                   /protein_id="ABR46247.1"
FT                   /translation="MIIEGLKLINFRNYEQLQLQLHPKLNIFVGENAQGKTNVLEAVYL
FT                   SAIGKSFRTSKDQEMIFVDKHQAYVQVKVKRVVYENNIELRLNVDKKKNIKVNQVPLLK
FT                   LGELLGNLNIVLFSPEDLKIIKEGPGERRKFIDGEISQIAPKYYYNLNQYNKILQQRNK
FT                   LLKYHKGKKLDLEVWNEQLANIGASLIIYRRNFIKRIAILAKLMHRKITDGIETLEIEY
FT                   KSSVLIKDHDTVDQIRVGFLKELNQSADEERRRGVTLVGPHRDDLNFNINGLEVKTYGS
FT                   QGQQRTAVLSLKLAELELIKGEVGEYPVLLLDDVMSELDMKRQNDLIYHLKHVQTLVTT
FT                   TMLEPLNIKNVQDKALFRVIKGEIGKYE"
FT   gene            4310..4597
FT                   /locus_tag="Amet_0005"
FT   CDS_pept        4310..4597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46248"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ80"
FT                   /protein_id="ABR46248.1"
FT                   /translation="MFLHLGGEIAVHSSEVIAILDIESTLKSKDSKAFLKICKEKGFIH
FT                   KITNEEPRSFVITEKQEHLAKSGNRIRKLVIYYSPISAPTLQKRAAFIPE"
FT   gene            4652..6559
FT                   /locus_tag="Amet_0006"
FT   CDS_pept        4652..6559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gka:GK0005 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase, type IIA, subunit B,
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46249"
FT                   /db_xref="GOA:A6TJ81"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ81"
FT                   /protein_id="ABR46249.1"
FT                   /translation="MENKIQEYGAEQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEV
FT                   VDNSVDEALAGYCDVIDVTIYQDNSIKVVDNGRGIPIETHPQTGKSTLETVMTVLHAGG
FT                   KFGGGGYKVSGGLHGVGISVVNALSEYVEVEVRKDGKLYKQRYERGIPITDVQEVGETT
FT                   ETGTTITFKADSEIFEEILYVYTTLENRLREMAFLNKGIKITLRDLREEEVMESSFRYD
FT                   GGIQEFVMHLNRNREALIDKVIYFEKQKEGSVVEVALQYTGAYTENIFSYANTINTHEG
FT                   GTHLSGFKAGLTRVINEYARKNGILKEKEINLLGEDIREGLTAIISVKMADPQFEGQTK
FT                   TKLGNSEMKGIVESSTSQYLEAFLEENPHEAKIIIEKSLRAQRAREAAKKARELTRRKG
FT                   ALENTALPGKLADCAEKDPALSEIYIVEGNSAGGSAKQGRDRATQAILPLRGKILNVEK
FT                   SRLDRILGSAEIRNMITAFGTGIGIEFDIEKVRYHKIVIMTDADVDGAHIRTLLLTFFF
FT                   RYMKPLIELGYVYIAQPPLYKLKKGKVENYAYSDEEMQKIIVQMGGSADIQRYKGLGEM
FT                   NPEQLWDTTMNPETRTFLQVSIEDAAGADDIFNTLMGDKVEPRRQFIEQNSKYVTNLDI
FT                   "
FT   gene            6576..9068
FT                   /locus_tag="Amet_0007"
FT   CDS_pept        6576..9068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: chy:CHY_2704 DNA gyrase, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46250"
FT                   /db_xref="GOA:A6TJ82"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ82"
FT                   /protein_id="ABR46250.1"
FT                   /translation="MIDNKDNIVPINIESEMKKSYIDYSMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMIELGVTPDKPHKKSARIVGDVLGKYHPHGDTAVYDAMVRLAQDFSMRYLLVD
FT                   GHGNFGSVDGDGAAAMRYTEARLSKISVEMIRDINKETVDYRPNFDETLKEPAVLPSRF
FT                   PNLLVNGSNGIAVGMATNIPPHNLGEVIDSVVTLIDDSEAEIEDFMEHIKGPDFPTGGI
FT                   ILGTEGIKDAYTTGRGKIKVRAKASIEEMSKGRQHIIVNEIPYQVNKARLIEKIAELVR
FT                   DKKIEGISDLRDESDREGMRIVIELKRDANANVVLNKLYKHTQLEDTFGVIMIAIVDGQ
FT                   PKVLNLKEVLTHYLNHQKDIIVRRTKFDLNKAEDRAHILEGLKIALDNLDEVIKLIRGS
FT                   DNTQIAKAGLMEKFSLSEKQAQAILDMRLQKLTGLEIEKVEEEYKELIKIINHLKEILA
FT                   NERLLLDIIKEELLEIREKYADKRRTEIAIDPGSINMIDLVDEEDVVITLTHFGYIKRL
FT                   PIDTYRSQKRGGKGISGVTTRDEDFVEKLTITSTHSPLLFFTNLGKVYKLNVYEIPEGR
FT                   RQAKGTAIVNLLQLSANEKIAAVIPVDRDCNEQYLVMATQKGIIKKTELCQFDNTRKTG
FT                   LMAINIREDDELISVRLINKEQEIFMITSQGMSIRFKEDNVRDMGRTAMGVKGINLAEK
FT                   DYVVAMEVLEDNKDLLVVSENGLGKRTDLSEYRLQTRGGKGIKTYKVSKKTGNLIGAKI
FT                   VEDHDEILLMTNEGIVIRLNVKGISKMGRATRGVTLMNTGTEKSIVSIAQIPYHEEVII
FT                   QEMIEEISEEKDEEKDEE"
FT   gene            9333..9650
FT                   /locus_tag="Amet_0008"
FT   CDS_pept        9333..9650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0008"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   cth:Cthe_2898 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46251"
FT                   /db_xref="GOA:A6TJ83"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ83"
FT                   /protein_id="ABR46251.1"
FT                   /translation="MSLSVNKQFNDEENLWTVQLAGEVDIYTAGQLKEAFIKMIEERKE
FT                   TIKIDCEELVYIDSTGLGVLIGALKRLKQEKKEIMLFNIKPSIKKLLNITGLDKIFIIE
FT                   G"
FT   gene            9691..10116
FT                   /locus_tag="Amet_0009"
FT   CDS_pept        9691..10116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0009"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: bcl:ABC0815 anti-sigma B factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46252"
FT                   /db_xref="GOA:A6TJ84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ84"
FT                   /protein_id="ABR46252.1"
FT                   /translation="MNEKKNDEIKLTIPNKPEYVSVVRLTVSSIANRMGFDVEQIEDIK
FT                   IATAEACTNAITHGKCDVEESFDIKFIIDEGKLVISVFDNGKGCMINNIKKPDLINPKE
FT                   GGLGIFIIKSLMDDVKITSDADKGTTIIMTKYVGEDT"
FT   gene            10116..10916
FT                   /locus_tag="Amet_0010"
FT   CDS_pept        10116..10916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0010"
FT                   /product="phage transcriptional regulator, RinA family"
FT                   /note="TIGRFAM: phage transcriptional regulator, RinA
FT                   family; RNA polymerase sigma-70; RNA polymerase sigma-B/F/G
FT                   type; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: cth:Cthe_2900 RNA polymerase, sigma 28 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46253"
FT                   /db_xref="GOA:A6TJ85"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ85"
FT                   /protein_id="ABR46253.1"
FT                   /translation="MKNIARANKMALNRDHSLMHLTEKELFIEYQENKKVEVRNELVNR
FT                   YLYIAEILSKKFLNKGIDYEDIYQVASLGLIYAIERFDLSRGFEFSSFATPTIIGEIKK
FT                   HFRDKGWSIRVPRRIQELSKKVNTAKMTLHQNLQRTPMIKDIAEYLNCTQEEVMEAMEA
FT                   SQVYTPKSLDLTYDNDGEDKDIQLIDLIGEKDKNFDEIENRDFLKKAMRNLNEVEKKVL
FT                   EDRFFNSKTQMNVAEELNVSQMTVSRMEKRIIEKFRKELNKSME"
FT   gene            11329..12849
FT                   /locus_tag="Amet_R0001"
FT   rRNA            11329..12849
FT                   /locus_tag="Amet_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            13209..16143
FT                   /locus_tag="Amet_R0002"
FT   rRNA            13209..16143
FT                   /locus_tag="Amet_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            16271..16386
FT                   /locus_tag="Amet_R0003"
FT   rRNA            16271..16386
FT                   /locus_tag="Amet_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            16755..16907
FT                   /locus_tag="Amet_0011"
FT   CDS_pept        16755..16907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46254"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ86"
FT                   /protein_id="ABR46254.1"
FT                   /translation="MITLYKDNQDNKIIDINEYREKKNKKIEKEIEEREKTLNLFMKVL
FT                   STMRE"
FT   gene            17117..17344
FT                   /locus_tag="Amet_0012"
FT   CDS_pept        17117..17344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46255"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ87"
FT                   /protein_id="ABR46255.1"
FT                   /translation="MMKGYDIMYNHSDTPIAEDFQQLYEQGYRCIYYELHEKDQFFIAH
FT                   LKNFENEDIRELKCSIEDGTNLKNYIDNLN"
FT   gene            17548..18012
FT                   /locus_tag="Amet_0013"
FT   CDS_pept        17548..18012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0013"
FT                   /product="protein of unknown function DUF988"
FT                   /note="PFAM: protein of unknown function DUF988; KEGG:
FT                   ctc:CTC02339 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46256"
FT                   /db_xref="GOA:A6TJ88"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ88"
FT                   /protein_id="ABR46256.1"
FT                   /translation="MKQTKMLVQGAIIAGLYVALTLAFAPISFLQVQVRISEVLTILPV
FT                   FTPAAIPGLFVGVLIANMFGGLGIIDIVLGSLATLTAAYLSRKMPRRWLVPLPPVVINA
FT                   VVVAFILNYVLGFPYVATMGWVAIGQIIACYGLGYPFMLVLDKYKDNIFK"
FT   sig_peptide     17548..17640
FT                   /locus_tag="Amet_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.564 at
FT                   residue 31"
FT   gene            18180..19043
FT                   /locus_tag="Amet_0014"
FT   CDS_pept        18180..19043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46257"
FT                   /db_xref="InterPro:IPR029433"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ89"
FT                   /protein_id="ABR46257.1"
FT                   /translation="MIQINKAKLVMQSVQGKIHSPQGANPYRIDREGVGHILPATGGIT
FT                   YNVKIGDSCMEWIGDHVEPGVSIRNEDKMENNALMILSCIGNEARVVTGEAKGAKGYVT
FT                   GMHGGIDHVLIHFKEEDMEKMAINDTILIKAFGQGLAIEGLDDVKCMNIDPGLFEKLDI
FT                   KINPEGYLEIPVKTEVPAYMMGSGIGGATAYSGDYDIMTGDKDANREFGINELKFGDLV
FT                   LLRDCDNTYGRQYLKGAVSIGIVVHSDCIKSGHGPGITVIMSSKKPIIKAIINKEANIS
FT                   NYLQIK"
FT   gene            19183..20526
FT                   /locus_tag="Amet_0015"
FT   CDS_pept        19183..20526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0015"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   tte:TTE0294 Glycine cleavage system protein P
FT                   (pyridoxal-binding), N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46258"
FT                   /db_xref="GOA:A6TJ90"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ90"
FT                   /protein_id="ABR46258.1"
FT                   /translation="MFPYIPATEESKKKMLEDVGLNSVEDLFKDISHKVRLKGELNIPK
FT                   HKSELEVSSYIKKLGKMNETTEDYTCFLGCGAYDHYIPSVVDAVISRSEYYTAYTPYQA
FT                   EIAQGTLQTIFEFQSMMAGLTGMDVCNASVYDGSTAVYEAAYVAVASNRRKEVLISKSV
FT                   HPEYRKVLKASLGAANIKYIEIEIKEGTTDLDDLKEKLTKDVSAVIVQSPNFFGLIEEV
FT                   EEVVKESHENKSLVVMSTDPISLGLLKTPGEMGVDIAIGEAQALGIPLSFGGPYLGFIT
FT                   TTKALLRKVPGRLVGMTKDVDGKRGFVLTLQTREQHIRREKSISNICTNQALNATAATV
FT                   YLSLMGKEGMKEVAKQNYDKAHYAHEQLISTGMFEDSWEKPFFKEFTLKYKGNLKALKE
FT                   KLEENKILGGFHPKEDYQALENHLIIAVTEKRSKEEVDQLCTIVKEVE"
FT   gene            20526..21971
FT                   /locus_tag="Amet_0016"
FT   CDS_pept        20526..21971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0016"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   tte:TTE0293 Glycine cleavage system protein P
FT                   (pyridoxal-binding), C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46259"
FT                   /db_xref="GOA:A6TJ91"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ91"
FT                   /protein_id="ABR46259.1"
FT                   /translation="MYEKVIYEISSKGKKGYMLPPQDVPQYEVPEKYLRKTDNHLPEVS
FT                   EREVMSHFVNISSKNYHIDKGFYPLGSCTMKYNPKINEAMARLDGLANIHPYQDEKMVQ
FT                   GALRLMYELQGSLGEITGMDAFTLQPAAGAHGEKTGLMLMHQYHRGRNDLKRDKIIVPD
FT                   SSHGTNPASAAMTGFKIIEVPSNERGGVDIEALKNVVGDDTAGLMLTNPSTLGLFEENI
FT                   TEIAGIIHGAGGLLYYDGANMNAIMGYARPGDMGFDIIHLNLHKTFTTPHGGGGPGAGP
FT                   VGVKEFLKEFLPVPMIDKKDETYTLRYDMENSIGKVKSFYGNFGMLIRAYTYILTMGSD
FT                   GLKHVSEMAVLNANYLKENLKEYYQLPYDILCKHEFVLSGKSMKKKYGVSTMDIAKRLI
FT                   DYGYHPPSVYFPLIVEEAIMIEPTETESKETLDEFIKVMITIAKEAAENPDLLHEAPHH
FT                   SPVRRLDDSGAARNPILKWQDIE"
FT   gene            22384..23904
FT                   /locus_tag="Amet_R0004"
FT   rRNA            22384..23904
FT                   /locus_tag="Amet_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            24268..27202
FT                   /locus_tag="Amet_R0005"
FT   rRNA            24268..27202
FT                   /locus_tag="Amet_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            27463..27578
FT                   /locus_tag="Amet_R0006"
FT   rRNA            27463..27578
FT                   /locus_tag="Amet_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            27844..28755
FT                   /locus_tag="Amet_0017"
FT   CDS_pept        27844..28755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0017"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: cth:Cthe_2356
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46260"
FT                   /db_xref="GOA:A6TJ92"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJ92"
FT                   /protein_id="ABR46260.1"
FT                   /translation="MNETNMIDEIKRLKKEKNAVILAHNYQIPEIQEIADIVGDSLKLS
FT                   QEATKTDADIVVLSGVKFMAESVKILSPNKKVLLPAHDAGCPMADMIDVDQLKEFKAEY
FT                   PNVPVVCYVNSSAEVKAESDICCTSSNAIKVVRSLQSDKVIFVPDQNLAAYIAEQVPEK
FT                   EIIPWQGFCITHHRVKDLEVDKIRKQMPEAVFLVHPECTPDVVKKADFVGSTSQIIQYA
FT                   KESNAEKFVIGTEMGVLHKLKKENPTKKFYLLSPGLICFNMKKTTLVNVYEALRDEQHE
FT                   IIVDEYVREKALKTLNQMLEIK"
FT   gene            28770..30332
FT                   /locus_tag="Amet_0018"
FT   CDS_pept        28770..30332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0018"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="TIGRFAM: L-aspartate oxidase; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: cth:Cthe_2355 L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46261"
FT                   /db_xref="GOA:A6TJ93"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ93"
FT                   /protein_id="ABR46261.1"
FT                   /translation="MKVINNTIMKNKCDVLVIGSGVAGLFTALNIDPSYTVHVITKNQL
FT                   SKSNSTLAQGGIVSCVDSKIHYEDTMKAGCYYNNKEAVNLLGRKGYQMIQQLIEYGVMF
FT                   DRNNSGGLKMTREGGHTQFQVAHCKDETGKEIMRALSDTVSKKNNIKVREKVFALDTIV
FT                   KDGIVHGVDVLVSGKREVYESKITVLATGGIGDLYESTTNERASTGDGIAIAYRAGANI
FT                   KDMEFIQFHPTALYHQSKGKKLLISEAVRGEGGVLKNKYGEAFMGKYHKMKDLAPRDIV
FT                   ARSIFYEMQRTKTSFVYLDITHLSKEFIQNRFPMIYRMCLSEQIDITKNWISVAPAAHY
FT                   IMGGIETDSQGRTTVKNLYACGECARTGAHGANRLASNSLLEGVVFGKQVADDINQALK
FT                   QLIFNEELVDNEWPLIKKHTNLSDDHKQHLELGALTRIEGRLKQTMNQYVSISRDGKGL
FT                   IKARYVIDKLKEKLQQESNNNIKYYELINQLTVSELIIESAFRRKKSLGAHYRLDNEIN
FT                   NQS"
FT   gene            30355..31194
FT                   /locus_tag="Amet_0019"
FT   CDS_pept        30355..31194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0019"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   cth:Cthe_2354 nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46262"
FT                   /db_xref="GOA:A6TJ94"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ94"
FT                   /protein_id="ABR46262.1"
FT                   /translation="MYNHLLIEDIIKNALIEDMNYGDITTDALVDGDKTGIAIITAKEE
FT                   GVIAGTSIVEMVFKLVDQTLYVTNLKQDGEKVNTGDNMIEVDGNIKSILKGERIALNFM
FT                   QRMSGIATTAREFADRVEGFNTKIVDTRKTTPGLRSLEKYAVKVGGCYNHRFNLSDAVL
FT                   IKDNHIKAVGGITEAVKRCRVQIPHTAKIEVEVESLEQLEEAIEVKADIIMLDNMTVEM
FT                   MKEAVQRTKGRALLEASGNMTKEKIKEVAATGVDFISVGLLTHSVKAMDISLNIQMK"
FT   gene            31205..31723
FT                   /locus_tag="Amet_0020"
FT   CDS_pept        31205..31723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0020"
FT                   /product="3H domain protein"
FT                   /note="PFAM: 3H domain protein; Helix-turn-helix, type 11
FT                   domain protein; KEGG: tte:TTE0520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46263"
FT                   /db_xref="GOA:A6TJ95"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ95"
FT                   /protein_id="ABR46263.1"
FT                   /translation="MNTQERRAVIAKRLEERKGPIKGTELAKWLQVSRQVIVQDIALLR
FT                   AEGTAVIATPQGYVILKSDKKGLTKTVVSKHENYEEMEEELQIMIDHGARVVDVIVEHP
FT                   LYGEIRGMLDISYGQELKMFMKKIRTEKAEPLSSLTYGIHIHTLEVPSEESFNKMNQAL
FT                   MEKGYLINE"
FT   gene            31739..32788
FT                   /locus_tag="Amet_0021"
FT   CDS_pept        31739..32788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0021"
FT                   /product="phosphotransferase system, EIIC"
FT                   /note="PFAM: phosphotransferase system, EIIC; KEGG:
FT                   bha:BH3254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46264"
FT                   /db_xref="GOA:A6TJ96"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ96"
FT                   /protein_id="ABR46264.1"
FT                   /translation="MKIREKSVSLREYLTQALNGMALGLFSSLIIGLILKQIGEILNIT
FT                   VLMEFGQIAQFLMGPAIGAGVAYAIGAPSLGIFASLITGAIGANTIFLTEVGAYGIKVG
FT                   EPVGAFVAALIGAEIAKLIAGKTKVDIVLVPAVTIIVGGLAGNFIGPWVSAMMSGLGQL
FT                   INNTTELHPIPMGIFVAILMGMILTLPISSAALAISLGLSGLAAGAAVVGCATQMVGFA
FT                   VSSYKENGFGGLIAQGLGTSMLQVPNIIRNPLIWIPPIIASGILGPLATTLFQMENNSI
FT                   GAGMGTSGLVGQFGTFAKMVTENGNPASTVLIKMGILHFILPAIITLVIAKYMRQKGWI
FT                   KPGDMKLNQ"
FT   gene            32891..35689
FT                   /locus_tag="Amet_0022"
FT   CDS_pept        32891..35689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0022"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   swo:Swol_1161 protein of unknown function UPF0182"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46265"
FT                   /db_xref="GOA:A6TJ97"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJ97"
FT                   /protein_id="ABR46265.1"
FT                   /translation="MSEEEKELKNRKKVIIGLGIFIFIFLFGFLSEILSFITDYQWFQE
FT                   LGYESVFLTKLKTQLQIGIPLFIVGTILYYLYLIGLKKEYYKQIKSYHMDISEKRVNQI
FT                   LILPAFVFGLMTSTSVAGSLWFDILLYANAKPFNLTDPLFNNDITYYLLELPFLKQLLN
FT                   TVTSILFLMVIITVIFYVIMFLIRRPTLYEVKADLQWNSNFFVSLLQIALKQFAALGVI
FT                   FFLVLAARYYLGVYDLLYSTRGVVYGASYTDTHVTLWVYRAQILASLLSATGVVYAYVK
FT                   RNPKLLLIAPISIIAVGILGNVISLGVQNFIVSPNEIARELPYIEHNLSYTRRAYGIGE
FT                   IQETDFPYDTELTREDIENNQEIIDNIRINDYRPALEVYNQIQAFRPYYRFVDVDIDRY
FT                   WVNGEYRQVFIAPRELDQRELSDNAQTWINQTLKYTHGYGVALSPVNEVTSGGQPVLWM
FT                   RNFPLVSSVDIEVTRPEIYFGELTDQYIIVNTKEKEFDYPLDNDNAETLYEGTAGVPLK
FT                   GVNRLLYSWRQGTLKMLLSGNITSESRIVFDRNIVTRMNKIAPFITYDEDPYIVINEGK
FT                   LYWMIDGYTISGNFPYAEPYMAGNNNYIRNSVKVVIDAYNGTVDYYISDEEDPIILTYQ
FT                   AIFPDLFKPLDDMPEGLKAHIRYPQVLFDIQSEVYATYHMNNPRVFYNKEDLWRIAREK
FT                   YDQNEQTIESQYMMMKLPGEESEEFVISVPYTPIRLDNMRALLVARNDGEQYGELIAYR
FT                   MPKDQNVYGPKQIEDRIDQNTTISQNLSLWGEGGSSVIRGNLLVVPIENSLLYVEPLYI
FT                   RATSGTSLPEVKMVIVSFGDQIVMEPTLEEALNRIFGARVEEIREEIQEEVEGDTDGET
FT                   ITEEITEGLGEASQLIRRASEVFDRAQEASRQGNWSAYGDALEELEQVLRQLQETTQVL
FT                   EN"
FT   gene            complement(35753..35959)
FT                   /locus_tag="Amet_0023"
FT   CDS_pept        complement(35753..35959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46266"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJ98"
FT                   /protein_id="ABR46266.1"
FT                   /translation="MKQIDIVNQLSNLKEVDYRNTLAIATLIELLIENDIITRKAFAEK
FT                   SYELDKMSLDELKEFRNRKKTTS"
FT   gene            36527..37807
FT                   /locus_tag="Amet_0024"
FT   CDS_pept        36527..37807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0024"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); seryl-tRNA
FT                   synthetase, class IIa; KEGG: ctc:CTC00081 seryl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46267"
FT                   /db_xref="GOA:A6TJ99"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJ99"
FT                   /protein_id="ABR46267.1"
FT                   /translation="MLDIKRIRMNLDEIKAAMARRGEKGFDLDAVVALDEDRRTILQEV
FT                   EQMKNEQKTVSKEVPKLKKEGKDVSEVMEKMKTLSAEIKNLDVKVKEIEEKMEEILLRI
FT                   PNVPHPDVPQGDTDDDNIEVRTWGEPTQFSFEPKPHWEVGVNLGILDFEAASKVTGSRF
FT                   TLYRGMAARLERALISFMLDLHTDEHGYTELLPPFMVNRASMIGTGQLPKFEEDAFKIP
FT                   QKDYFLVPTAEVPVTNIYRDDIIEGDQLPIKYVAYTPCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVRPEDSYEELEKLTNNAEKVLQLLGLPYRIVRICTGDLGFTAAFKYDIEVW
FT                   MPSYNRYVEISSCSNFEDFQARRANIRYRPDTKSKVEFVHTLNGSGLAVGRTVAAILEN
FT                   FQQEDGSVVIPEAIRSYMKGFEKITAK"
FT   gene            38018..38752
FT                   /locus_tag="Amet_0025"
FT   CDS_pept        38018..38752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46268"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA0"
FT                   /protein_id="ABR46268.1"
FT                   /translation="MPFNVCDQNGKHIGILYERCPEYSLGRKFSLVCLTELTTEKININ
FT                   FHGIKDYLARRYDLKTVFGKIKEEKLQEKLEEEWREYYSEYGAYDEVFLLKIHLSNHQG
FT                   EISHLIEIEEQSVQGYILLNRENVIFHNKETIIIKNELDFIQPEKEILGKKPLYTKVVD
FT                   YPVISMGVMGLGEGLLLGANLSDFGGRNHIHNTKLKLMVGNDIHQLELPMQINAKRGMT
FT                   ILFYLEGQKIKHMVCDERIYTF"
FT   gene            38852..38928
FT                   /locus_tag="Amet_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            38852..38928
FT                   /locus_tag="Amet_R0007"
FT                   /product="tRNA-Arg"
FT   gene            38949..39404
FT                   /locus_tag="Amet_0026"
FT   CDS_pept        38949..39404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0026"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   gka:GK0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46269"
FT                   /db_xref="GOA:A6TJA1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA1"
FT                   /protein_id="ABR46269.1"
FT                   /translation="MEAYYMSLALEEAKKAYELGEVPIGAIILRENKVIAAAHNLRESH
FT                   HDATAHAEIIAIQAACRRLGGWRLTNSTLFVTIEPCPMCAGAILQSRIDRVVIGAMDPK
FT                   AGACGSIINLLNNNQFNHQTEIVTGVLEDECSQIMKDFFKSLRQKKK"
FT   gene            39483..39570
FT                   /locus_tag="Amet_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            39483..39570
FT                   /locus_tag="Amet_R0008"
FT                   /product="tRNA-Ser"
FT   gene            39705..39805
FT                   /gene="ffs"
FT                   /locus_tag="Amet_R0009"
FT   misc_RNA        39705..39805
FT                   /gene="ffs"
FT                   /locus_tag="Amet_R0009"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            40091..40726
FT                   /locus_tag="Amet_0027"
FT   CDS_pept        40091..40726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0027"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: swo:Swol_1887
FT                   SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46270"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA2"
FT                   /protein_id="ABR46270.1"
FT                   /translation="MWYFNKGGLLKVNKEIDARGMNCPLPVIHTKKALESIDQGKITTI
FT                   VDNETARENISKLAKSLDCEIDIQENQGSYYIDIFKDYETQGMEAMDIQCDDSPKKDLV
FT                   ILIGQDQMGEGSVELGKVLMKGYLYTLTEVTPYPKAIILVNSGVRLSTEDPETIGHLRI
FT                   LEANGVEILSCGTCLDYFKLKDKLVVGGLTNMYTIVEHLNNANNTIKL"
FT   gene            40741..41007
FT                   /locus_tag="Amet_0028"
FT   CDS_pept        40741..41007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46271"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA3"
FT                   /protein_id="ABR46271.1"
FT                   /translation="MSQQGFYVVVFDSTHHAISAEKQLKKEKIAFNVIPTPREITASCG
FT                   LSIKFNAEVLGTVQKVVEQENIAVKGVYIIEKLHDRKRVTQVS"
FT   gene            41021..41905
FT                   /locus_tag="Amet_0029"
FT   CDS_pept        41021..41905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0029"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   tte:TTE2783 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46272"
FT                   /db_xref="GOA:A6TJA4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA4"
FT                   /protein_id="ABR46272.1"
FT                   /translation="MEELMTSLEIILDNMREFITNPEQLSTIIANSVKIVVILVVAKVS
FT                   IRILYSITNQIFQQQKSLKLNTDLPRMETLNGLIKSLIKYGIYFIAITTIISFFGVKVT
FT                   GLIATAGIGGLAIGFGAQNLVRDVITGFFILFENQFSIGHYIEVNGVSGIVEEMAMRIT
FT                   KVRDFNGDLHIIPNGQIQKLTNKSTGKMRAWVDISIAYEEDIDRAIEVLTTKSEQLRME
FT                   NANIVEGPTVLGVTGLGNSDVVISIMAKTVPMEQWAIERLMRKTFKQAFDEVGIEIPYP
FT                   RRVIISQNEKSEM"
FT   gene            42014..42208
FT                   /locus_tag="Amet_0030"
FT   CDS_pept        42014..42208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0030"
FT                   /product="protein of unknown function DUF951"
FT                   /note="PFAM: protein of unknown function DUF951; KEGG:
FT                   cth:Cthe_2512 protein of unknown function DUF951"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46273"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA5"
FT                   /protein_id="ABR46273.1"
FT                   /translation="MPIKLEVGDRVELKKQHPCGSKAFEIMRTGADFRVKCLGCEKQIW
FT                   LVRSELERRIRKITPKNEE"
FT   gene            42372..43565
FT                   /locus_tag="Amet_0031"
FT   CDS_pept        42372..43565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0031"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmp:MMP0096 aminotransferase (subgroup I)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46274"
FT                   /db_xref="GOA:A6TJA6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA6"
FT                   /protein_id="ABR46274.1"
FT                   /translation="MKFARRMEALKASEIREILKLIENPDVISFAGGLPAPELFPVEEM
FT                   KKVSVAVLEEDGQQALQYSATEGYRPLREKIAKRMEVIGIGTTADNILITSGSQQGLDF
FT                   SGKVFLDEDDVVVCESPSYLGAINAFRAYSPKFVEIETDEDGMIIEDLEKALAETKNIK
FT                   MIYVIPDFQNPSGRTWSIERRKRLIALANQYDLPVVEDNPYGELRFEGERPPAIKSFDT
FT                   EGRVIYLGTFSKTFCPGLRLGWTLGDGELLQKYIFVKQGADLHTNTLTQRELNKFLEMY
FT                   DIDAHIEKIKDVYRKRRDVMMDSIKKYFPKNVKYTYPEGGLFTWCELPQEMNAREIFLK
FT                   SIKVNVAFVPGGSFFPNGGKENTFRLNYSMMSEEKIEEGIKRLGKVLQEEMTAGKTI"
FT   gene            43948..44232
FT                   /locus_tag="Amet_0032"
FT   CDS_pept        43948..44232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0032"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: cac:CAC3724 30S
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46275"
FT                   /db_xref="GOA:A6TJA7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJA7"
FT                   /protein_id="ABR46275.1"
FT                   /translation="MNKYELTYILKSETDEEKRNQLAEKFKGIIEADGAVENVDEWGNR
FT                   KLAYEIDKRNEGYYVLVNFASSIDVPKELDRNLKIAEQVIRHMIIRIQE"
FT   gene            44256..44696
FT                   /locus_tag="Amet_0033"
FT   CDS_pept        44256..44696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0033"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; KEGG: ctc:CTC00108 single-strand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46276"
FT                   /db_xref="GOA:A6TJA8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJA8"
FT                   /protein_id="ABR46276.1"
FT                   /translation="MNRVVMIGRLARDPELRFTASGKAVATFSIAVNKTFSKEKQADFF
FT                   NVVVWNKTAENCANYLAKGRLVGLDGRLQSRSYETKNGDKRYVTEIVADQVEFLEWGDK
FT                   NSQPNQTSQKPKQDFGKSDDFNSADIDINDFQAIDEDDDIPF"
FT   gene            44715..44945
FT                   /locus_tag="Amet_0034"
FT   CDS_pept        44715..44945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0034"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: cno:NT01CX_0885
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46277"
FT                   /db_xref="GOA:A6TJA9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJA9"
FT                   /protein_id="ABR46277.1"
FT                   /translation="MVNRRRKKMKKKVCTFCADKSSKIDYKEVHKLKKYVTERGKILPR
FT                   RISGNCAIHQRDITQAIKRSRHIALLPYTID"
FT   gene            45115..46218
FT                   /locus_tag="Amet_0035"
FT   CDS_pept        45115..46218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0035"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: cno:NT01CX_0212
FT                   conserved membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46278"
FT                   /db_xref="GOA:A6TJB0"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB0"
FT                   /protein_id="ABR46278.1"
FT                   /translation="MINIKQVKMILVIALLVGILGASLAHGETSNEHIQYKKARAIILE
FT                   VQEEQEGQLVVQWAKARVMNGPLKGHIIQLKHPLIKGSKYHIELEENMRIFLELRVEEN
FT                   RVTSANFIDVTKEHHLKILLAIFVTLLLIFGGFKGLRSFIALVITGLCMLYIFIPMVFN
FT                   GYSFILATVVVSGIIIVSSFILISGFTTKSLTAIIGTIGGTTISGVIAIYFGNLMYLTG
FT                   ITDDAIETLIRHSTLDVDYRGLLYSGMTIGALGAVMDVSMTITSVIYEIKRGNRQVRIK
FT                   SLVLSGLAVGRDIMATMTNTLILAYAGTSLPLLLLFIFSEMPLEDIINSQYIASEVVRA
FT                   LSGSIGLVLTIPITSVVAAINIKWAKE"
FT   sig_peptide     45115..45198
FT                   /locus_tag="Amet_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 28"
FT   gene            46365..46781
FT                   /locus_tag="Amet_0036"
FT   CDS_pept        46365..46781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpf:CPF_0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46279"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB1"
FT                   /protein_id="ABR46279.1"
FT                   /translation="MSYVLVKEKMIDSEEILKSIEEEFSFKKIKDITSGSKRDDTLIYQ
FT                   IIHDVKQLKKEIEAEGEMGQTEEEELIEELMSVADEKVVIIEEVIPEGLIAYGYSYHYD
FT                   EGLEEIKSIFIASDESIGELRLRDIADRVLRSID"
FT   gene            47045..47647
FT                   /locus_tag="Amet_0037"
FT   CDS_pept        47045..47647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0037"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   swo:Swol_0069 ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46280"
FT                   /db_xref="GOA:A6TJB2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB2"
FT                   /protein_id="ABR46280.1"
FT                   /translation="MGTPILKYTIREEAGTGGASKARRAGEVPAVLYSKGEVTQPVYLN
FT                   TKELEKILSIYGGSSRIALDHEGKKCFAIIKEIQKNMLKNSLLHVDLQKLDENQKIRMT
FT                   IPIYILNKEAVETLAEIVQIQQDEVEIQAYPRDLPEKIEVDASLLKDQANLTMKDLNIV
FT                   GNTAIEILDDLENVVATLAYTSRPVETEEESVEEALV"
FT   gene            47781..48395
FT                   /locus_tag="Amet_0038"
FT   CDS_pept        47781..48395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0038"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG: cpe:CPE1874
FT                   probable general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46281"
FT                   /db_xref="GOA:A6TJB3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB3"
FT                   /protein_id="ABR46281.1"
FT                   /translation="MMKNSLVSSLRNETGSNASHRSRDLGNVPAVIYGKSINTLTVEIE
FT                   RTEVEAFVRNQGGKGLVQVNVGGQPYTTFVKEMQRDPVTGMIMHVDFQQVNQDEQIHTM
FT                   VPIILKGRGFVEKGGVTVQQQVRELEVQCFAGSIPEKFEFDISNFRPGDTLKVSDVEFG
FT                   EEVSIINNLESVIASIATPAKIIDDEGEVPLEKKIELADME"
FT   gene            48874..50394
FT                   /locus_tag="Amet_R0010"
FT   rRNA            48874..50394
FT                   /locus_tag="Amet_R0010"
FT                   /product="16S ribosomal RNA"
FT   gene            50461..50536
FT                   /locus_tag="Amet_R0011"
FT                   /note="tRNA-Ala1"
FT   tRNA            50461..50536
FT                   /locus_tag="Amet_R0011"
FT                   /product="tRNA-Ala"
FT   gene            50776..53710
FT                   /locus_tag="Amet_R0012"
FT   rRNA            50776..53710
FT                   /locus_tag="Amet_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            53891..54006
FT                   /locus_tag="Amet_R0013"
FT   rRNA            53891..54006
FT                   /locus_tag="Amet_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            54401..55921
FT                   /locus_tag="Amet_R0014"
FT   rRNA            54401..55921
FT                   /locus_tag="Amet_R0014"
FT                   /product="16S ribosomal RNA"
FT   gene            56089..56165
FT                   /locus_tag="Amet_R0015"
FT                   /note="tRNA-Ile1"
FT   tRNA            56089..56165
FT                   /locus_tag="Amet_R0015"
FT                   /product="tRNA-Ile"
FT   gene            56325..59259
FT                   /locus_tag="Amet_R0016"
FT   rRNA            56325..59259
FT                   /locus_tag="Amet_R0016"
FT                   /product="23S ribosomal RNA"
FT   gene            59440..59555
FT                   /locus_tag="Amet_R0017"
FT   rRNA            59440..59555
FT                   /locus_tag="Amet_R0017"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(59604..60812)
FT                   /locus_tag="Amet_0039"
FT   CDS_pept        complement(59604..60812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0039"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   rxy:Rxyl_2475 acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46282"
FT                   /db_xref="GOA:A6TJB4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB4"
FT                   /protein_id="ABR46282.1"
FT                   /translation="MKNLVDWKGFIHQYYDEEELVKLTQDLIKIPSHVNYPGREKEVGI
FT                   FLSDYCQRQGFDVEVKTIVDERVNVIVTLKGTGEGKTLLLNGHLDTVPPGEMDFDPYGA
FT                   EIVDGHILGRGTVDMKGPIASMIIMMLALKRSDLKLTGDIIFTGVIGEEEQSEGTEDLV
FT                   KNGIKADGAIVGEPSSSQYSAGHRGLEWLEIKIKGRSAHGGVPHLGINAIEKAGKLISA
FT                   IQDTIYPKLEKRSHPLMGPSVMNFGYIKGGIQPSTVAGDCIIQIDRRYIPGETVATVIA
FT                   EYQEVIDHLKAHDSDFDAEIIRMPNNMLTLDHLPLETSLDDPITVALKNALSAVLEREP
FT                   VLSTKRGWTDASLLYNFANIPTIVYGPGDISYSHTKNEQIAIKELIEAVEVYFLTALQF
FT                   CGN"
FT   gene            complement(60905..62329)
FT                   /locus_tag="Amet_0040"
FT   CDS_pept        complement(60905..62329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0040"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier; AbgT
FT                   putative transporter; KEGG: bld:BLi00322 YcgA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46283"
FT                   /db_xref="GOA:A6TJB5"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB5"
FT                   /protein_id="ABR46283.1"
FT                   /translation="MSNDTNPVKTKRFKVPHTYVIICMIILLAFIGTYIMPAGEYQRVE
FT                   DPNGRTVVDADSFTSVPQNPVKFFSFTEDHLFSSVHRGMQDASNIIFFILIVGGAFAMI
FT                   QGTGAINAGIGKLALGLKDKGSMIIPVMLFIFGVGGSTIGMAEETIVFIPIGIALARAL
FT                   GYDAIVGVAMITLGASAGFSGGIANPFTVGVAQGIAELPIYSGAMYRVVIFAVFQIAAF
FT                   LYVMRYAKKVKADPQISAVRELEIAEKDQIIDLSELPKFTTKHIYVFITVIIGFVAMIY
FT                   GVMEHDWYIRELSSLFLMMGIFASLIGGSSPSKASSDFVLGAKDLIFGALVVGIARAIL
FT                   MVMSDGQIIDSLVYSMAAGISTFGTTIGALFMYLVQIVLNLFIPSGSGQAATTMPIMVP
FT                   LSDLIGVSRQTAVLAYQLGDGITNLIIPTSGTIMGVIAISKIPYEKWVKWVAPYVGILL
FT                   LIGAVFVAMSNIIGLT"
FT   gene            62690..64081
FT                   /locus_tag="Amet_0041"
FT   CDS_pept        62690..64081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0041"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   pab:PAB0090 D-aminoacylase (aspartate, glutamate etc)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46284"
FT                   /db_xref="GOA:A6TJB6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB6"
FT                   /protein_id="ABR46284.1"
FT                   /translation="MYDLKIINGIIIDFDTGQKKVCDIGIKKGKIDAIGNCPEDAKREI
FT                   DASGKIIAPGFIDIHMHEENLKEGGANPIDISNRMLLMGVTTCVAGNCGNNRQSLEEFI
FT                   HFIHHKGMPVNYLSFIGHNFLRNAVGSTDRYQKASKNEVEEMQKLLINAVDQGALGVSF
FT                   GLEYAPGIDLEEVLDLCSVIEDRKMLLAAHYRKDAKHSIPSIKEMMEISKQTGHPMQIS
FT                   HIGSSCAYGMMTEGLDTIQKGINLGLDITVDCYPYDAFSTYIGSAVFDEGCFGLWNKSY
FT                   DAILLTEAPYKGMRCDEALFHKARKEHPDMLVVAFVMNEEEVIQAIKAPFVMVASDGLY
FT                   RKGQGHPRGAGSFPRVLGKYVREKQELSLLEALKKMTLMPAKRLGLESKGEIKEGKDAD
FT                   IVIFDQNEILDGATFEDPQALPIGIDYVILKGEVAVENNIIIKGDLGKYISNPLEKTVQ
FT                   VNSLL"
FT   gene            64185..65354
FT                   /locus_tag="Amet_0042"
FT   CDS_pept        64185..65354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0042"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: bld:BLi00323
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46285"
FT                   /db_xref="GOA:A6TJB7"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB7"
FT                   /protein_id="ABR46285.1"
FT                   /translation="MRQIAEKLTHGIKEELIQLSEYIFNNPELGYEEFKACEAHVKLLK
FT                   RHGFVVEEGFLDIKTAFKAVYDSGIPGPVVAFLSEYDALPGMGHGCGHNLLGATTTGAG
FT                   ITVSKLMKEMGLRGKVMVFGTPAEETSGAKVQMTNEGAFEDVDVAMQAHPASQHMKSGK
FT                   SLALEAIQFTFTGKSAHAAASPEEGINALDAAINTFVSINALRQHILPSARIHGIISEG
FT                   GKAANIVPDLAIAQFYVRATTKTYLQELVEKVKNCARAGAMAAGAKVEFYNYEASYDNL
FT                   VTNETLSEAYSRRLMEVGVEKIEGAKKGYGSLDLGNISHVGPTIHPYFRICEENIPAHT
FT                   KAFAAATQTPFAYESMVKTINALALTATDVLEDEKLLKKIKEEFQKAEK"
FT   gene            65576..67054
FT                   /locus_tag="Amet_0043"
FT   CDS_pept        65576..67054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0043"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   tte:TTE1777 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46286"
FT                   /db_xref="GOA:A6TJB8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB8"
FT                   /protein_id="ABR46286.1"
FT                   /translation="MLMGKNKEIKKVTSKLVDISKGDLTSKIDVKSQGTIRELGESINQ
FT                   VLFRVRNLVGKVSSSNEKTLNFAKDLEGNARYIYDASQDVATAITDIASEASIQSEAVA
FT                   NVKGYTDRIEKDILNILDEAAKTQNVSEEMIKTVQNGVGGFEKVVEMLHRNANWSIDLS
FT                   QKIQVLKTEAEKVQSITSVVTDISNHTNLLALNASIEAARAGDSGRGFAVVANEVRNLA
FT                   EQSTNSAKEIEGITTSIVKKIKDMTEEIELETVKVKNDIRIADESKVQLHSIIEVTEST
FT                   SQGIDNIVFLAQDESKLVHELNRAIEEIALATEKAAAFSQEAAASTEEQTASVQVIFES
FT                   IKKLGVMAKEVHEIVDGFVQKFTMDEEIKKLLDRGIKILEEITNNNDLEELSQEKLRGL
FT                   FGEVLNKNVYFELLSILDDSGESKAVVLRGSNEKLSGNASHRPYFQQAIQGSTFISEPY
FT                   ISLFSNTYCVTLALPFRDEQGKIVGIVMGDVSIG"
FT   gene            67152..67490
FT                   /locus_tag="Amet_0044"
FT   CDS_pept        67152..67490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0044"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   dsy:DSY4511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46287"
FT                   /db_xref="GOA:A6TJB9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJB9"
FT                   /protein_id="ABR46287.1"
FT                   /translation="MENINSDKILEDLSIDNQEPKKPSKQSQATQKSIISRLNRIEGQI
FT                   RGIKSMIEKGTYCDDVINQIEASRSALSSIEILLLESHFKHCVVEQIKSGDEGVVEEIL
FT                   KTIKKLTK"
FT   gene            67581..67796
FT                   /locus_tag="Amet_0045"
FT   CDS_pept        67581..67796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0045"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: dsy:DSY4509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46288"
FT                   /db_xref="GOA:A6TJC0"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC0"
FT                   /protein_id="ABR46288.1"
FT                   /translation="MQKKIFIEGMTCGHCVGHVKRGLEEVTGVNEVKVDLEEKNAVVDL
FT                   QEIVTEESLKSAIEEAGYKVVKIESI"
FT   gene            complement(67921..68937)
FT                   /locus_tag="Amet_0046"
FT   CDS_pept        complement(67921..68937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0046"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG: tte:TTE1255
FT                   predicted periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46289"
FT                   /db_xref="GOA:A6TJC1"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC1"
FT                   /protein_id="ABR46289.1"
FT                   /translation="MKKWICTLCIVLLLGLVSLFFLPSYLSMAANTQDVEITIPQGASL
FT                   YQVSERLYDEGVIRSRLWFRYQGKISQADRNIRPGAYTFSPDTDLEEIFTLLQKGVPEQ
FT                   PVIMTIPEGFTLYEIAQRVESLGFGLAEEFIKATQDYFKSRDYSFDTSELYFEMEGYLY
FT                   PDTYHLKKNQDMKAIVHSLVSPIDAFFSEEYIKRAEELGLSLHEVLTIASIIEREAYHD
FT                   EERATVSGVIFNRLGIRMSLQIDATVIYGLGEGKEHRNRVLYADLETPNPFNTYMNTGI
FT                   PPGPIAAPSKASIHATLYPEDHSYLYYVLGEGGHVFSETYQEHLKHVDAYRRRINQN"
FT   sig_peptide     complement(68848..68937)
FT                   /locus_tag="Amet_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.748 at
FT                   residue 30"
FT   gene            69263..70279
FT                   /locus_tag="Amet_0047"
FT   CDS_pept        69263..70279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0047"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: sus:Acid_0749 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46290"
FT                   /db_xref="GOA:A6TJC2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC2"
FT                   /protein_id="ABR46290.1"
FT                   /translation="METRYEKQINFSGIGSEGQQLLQKASVLIIGCGALGTVVANSLVR
FT                   TGVGHVKIVDRDFVETGNLHRQILFDEEDAAEGMPKAEAAKKKLGKMNSTIRIETLVAD
FT                   VNSITISQMISNVDLIIDCTDNFKTRYLINDVAFKENIPWIYGGVIGSSGVLQSFIPGE
FT                   TACLRCMMAEPPPTGSLPTCDTAGVINTITGIIGSLQANEAIKYVTNQVEKMKKEMLYL
FT                   DLWDNTVESIEIQTNIDCPCCQKRSFIFLENKFPEAVHICGNNSVQVMPFTNKKVNLDQ
FT                   LAIRLQEANIQVKRTPFLLNIKTDAHEITVFPDGRAIIKQVSNVNEAKSIYAKYIGY"
FT   gene            70432..71064
FT                   /locus_tag="Amet_0048"
FT   CDS_pept        70432..71064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0048"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   cac:CAC0677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46291"
FT                   /db_xref="GOA:A6TJC3"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC3"
FT                   /protein_id="ABR46291.1"
FT                   /translation="MNKKKSFIKIVAIVIILGIVYTLNNQGLFGVSLDVDRIQKFVQDA
FT                   GVWGVLVYILINTIRPFLFIPTAALFITGGIIFGAVQGSIYNLIGLICACSLAYFVARK
FT                   FEGPFRKLVGEKYVSKLYGVEGRKAVKALFIMRVTPGFPIDPISFGAGLVNMNYRKFFL
FT                   GTLLGIAPKAIIYTFLGDQIDNLYSVQTMVALGILVLLATTSYFVDV"
FT   gene            complement(71109..71585)
FT                   /locus_tag="Amet_0049"
FT   CDS_pept        complement(71109..71585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0049"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="KEGG: mta:Moth_2197 putative transcriptional
FT                   regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46292"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC4"
FT                   /protein_id="ABR46292.1"
FT                   /translation="MMSISELDKCIIRALQEDLPLSPEPFKKLAEDLGIEEEMLLKKVQ
FT                   FFLDSGMMRRFGATLRHQKVGFKANAMVVWKIPPSRSKEVGHHMAQFAEVSHCYERPTY
FT                   PDWPYNLFTMIHATSKEECHTIAKKIALTVGFFDYDLLFSSHELKKVSMRYFCE"
FT   gene            complement(71582..72040)
FT                   /locus_tag="Amet_0050"
FT   CDS_pept        complement(71582..72040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0050"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="SMART: regulatory protein, AsnC/Lrp family; KEGG:
FT                   mta:Moth_2198 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46293"
FT                   /db_xref="GOA:A6TJC5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC5"
FT                   /protein_id="ABR46293.1"
FT                   /translation="MDKIDGQLLTLIQRDFPVTSRPYAFLGDQLGLSEADVITRISNLK
FT                   NQGFIRRVGGVFDSRKLGYTSTLCALKVPENRIHQVKQIINEIPGVTHNYLRNHEYNMW
FT                   FTLIAPSNEVIVDTLTSLKLKTNLDQLMNLPATQFFKINVHFKLQEGS"
FT   gene            complement(72033..73040)
FT                   /locus_tag="Amet_0051"
FT   CDS_pept        complement(72033..73040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0051"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: chy:CHY_1211
FT                   radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46294"
FT                   /db_xref="GOA:A6TJC6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027633"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC6"
FT                   /protein_id="ABR46294.1"
FT                   /translation="MIISWNTTNHCNMYCDHCYRDSGVKGSSELNTEEGKALIDEIVLA
FT                   GFKIMIFSGGEPLMREDLFELIAYAKDRGLRPVLGTNGTFITPAVAEKLKRVGTMGVGI
FT                   SLDSLDSHKHDGLRHYDGAWDGAIQGMRNCQSAGLPFQIHTTVMDWNNPELEAITDLAV
FT                   ELGAVAHHFFFLVPTGRAHNIEEESLRAEQYERTLERIMKKQQLVRIELKPTCAPQFMR
FT                   IAKQMGMNLRFGRGCLAGTSYCIINPNGKVQPCAYLDMEIGNVRETPFSEIWKNSEVFS
FT                   NLRTLSYGGGCGSCEYHISCGGCRARAAYYHEGDYMAEEPWCLHHGRKGGVAHG"
FT   gene            complement(73037..74245)
FT                   /locus_tag="Amet_0052"
FT   CDS_pept        complement(73037..74245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0052"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dsy:DSY2223 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46295"
FT                   /db_xref="GOA:A6TJC7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR023930"
FT                   /db_xref="InterPro:IPR034479"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC7"
FT                   /protein_id="ABR46295.1"
FT                   /translation="MISVTKFLLGTSHFGDSLRYRHCTEKNPHGTSPGHGPVVAWNITQ
FT                   TCNLNCIHCYMNSANKKYEGELTHEEALGFIDDLGGFKVPVLLFSGGEPLIREDFFALA
FT                   QHASKLNIRPTVSTNGTLISRKVAETLKSIGVGYVGISLDGLKDVNDRFRAQAGAFDAA
FT                   LTGIENCVAVGQKVGLRFTINRHNVKQLNDIFDLVEKMNIDRICFYHLVYTGRGSTMVA
FT                   EDISHEESRQAMDLIIERTLDFHRRGLHKEILTVDNHADGIYIYQKLKEMDPSRADEVY
FT                   RLMKINGGNRSGIAFANVDSTGNVHPDQFTQNHLIGNIRERPFSEIWTDESHPILRGLK
FT                   NRKSLLKGRCGECQWVDLCNGNFRARAEAVTGDFWGSDPACYLTDEEIGLSSHCLNGGG
FT                   AKL"
FT   gene            74566..75975
FT                   /locus_tag="Amet_0053"
FT   CDS_pept        74566..75975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0053"
FT                   /product="conserved hypothetical protein 698"
FT                   /note="PFAM: conserved hypothetical protein 698; KEGG:
FT                   ter:Tery_0334 conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46296"
FT                   /db_xref="GOA:A6TJC8"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC8"
FT                   /protein_id="ABR46296.1"
FT                   /translation="MINFQGVKGENVLKKEVDLITVSKKENWWTEAMKQGINWSSLWKK
FT                   EDWWTVWLGFLLIIASIAGVVAVPVLPLRWGPGRQGAETIIGSIPAEILSGILVTGIIN
FT                   LALFSIGILFIKREELKKFIVAFPFVFMLAIVAELGGNYAPWRHYGFNSVIWALGIGLL
FT                   VSNTIKTPGFMKGAVRTELYIKTGLVLLGASILFNRMLALGAMGLGVAWIVTPIVLISM
FT                   YWFSQKVLKMHDSKGLAITIASATSVCGVSAAIAAGTAAKAKKEEISLAISITLIFTVV
FT                   MMIGMPALVGALGIDPIVGGAWLGGTIDATGAVVAAGAMLGENALEVASVIKMVQNILI
FT                   GLIAFGIAIFFSTVVEKKPASEVTIGPAEVWVRMPKFIIGFIAASILFSFILPQNAIDA
FT                   SLPSINGFREFLFTLAFISIGLESNFKEMAKMVKGGKPLTLYLVGQALNIILTFIAAYI
FT                   FFSGRFFTLPF"
FT   gene            76126..76353
FT                   /locus_tag="Amet_0054"
FT   CDS_pept        76126..76353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46297"
FT                   /db_xref="GOA:A6TJC9"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJC9"
FT                   /protein_id="ABR46297.1"
FT                   /translation="MERKLVMKYFRTLLLMTVIVVATYIVFTDVGDSINQSSGAGDIWW
FT                   TDTADIDQAYRNMIEKKQQIQLNSGVSTIN"
FT   gene            76435..76839
FT                   /locus_tag="Amet_0055"
FT   CDS_pept        76435..76839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0055"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: gme:Gmet_1571
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46298"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJD0"
FT                   /protein_id="ABR46298.1"
FT                   /translation="MIKLGDVESLEAYDSEVAYLASKVVAMYESLSPQLEITLEKEANI
FT                   KVTPEESKVKDQEKDLLNIVDLKGVKCPMNFVKAKVALGKIASGEEIGFYLDDDAPINN
FT                   VPKSVEGEGHQIVNIDREYTGYNLLIVKKK"
FT   gene            76860..77771
FT                   /locus_tag="Amet_0056"
FT   CDS_pept        76860..77771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0056"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein, beta
FT                   subunit; KEGG: mta:Moth_1706 cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46299"
FT                   /db_xref="GOA:A6TJD1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJD1"
FT                   /protein_id="ABR46299.1"
FT                   /translation="MIYKNITQTIGNTPVVKLNNLVDENMADVYVKLEMFNPGGSVKDR
FT                   ISISMIEEAEKKGLIKPGDTIVEPTSGNTGIGLGLVAASKGYKLVLTMPESMSLERRKL
FT                   LKAYGAELELTKAHLGMKGAIDKANELVEENGYVMLQQFNNLANPEIHRNTTAKEILND
FT                   FGNDLDAFVVGIGTGGTITGVGEVLKKKIDKITVVAVEPEDSPVLSGGNPGPHMIQGIG
FT                   AGFVPEVLNVKIFDEVIKVQNEEALETARQLAKQEGLMVGISSGAAVFAAIKVAQKLGK
FT                   GKKVLTIAPDTGERYISTALFE"
FT   gene            77883..79118
FT                   /locus_tag="Amet_0057"
FT   CDS_pept        77883..79118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0057"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: cac:CAC0102
FT                   O-acetylhomoserine (thiol)-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46300"
FT                   /db_xref="GOA:A6TJD2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJD2"
FT                   /protein_id="ABR46300.1"
FT                   /translation="MGLNTKLIHGNGVSKEKKVGATNVPIYFSNAYAYNKAKDLENIFS
FT                   GRDIGHVYTRISNPSIEALEKRMVAVEGGVSAIATASGMSAIYLAVMNILTPGDEIIAS
FT                   SGVFGGTYNFFKNLKQLNIEVKFVDELNEESLTEHITPKTKIVFAETIGNPKLDVLDIE
FT                   VVSTICKIKGVVFMVDSTVTTPYLIRPLEYGADVVIHSVSKYVNGSANSIGGMIIDGGS
FT                   TKFNSERYENFKHYTKRYRQFAFSAKLRNELGKDLGAVMSPMNSFLNLTGIETLSLRMK
FT                   RHCHNAYQLAKYLQENPKVLHTNYPGLETSEYYPLTQKYYAKEAGGILTLRVGSKEKAF
FT                   QLIDSLKLISNVTNIGDTKTLALHPASTICNGNTPEEKEQMGVYEDLIRVSVGLEDMED
FT                   IIEDLENALGGL"
FT   misc_binding    79239..79421
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 128.39"
FT   gene            79684..80958
FT                   /locus_tag="Amet_0058"
FT   CDS_pept        79684..80958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0058"
FT                   /product="Glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase; KEGG: cno:NT01CX_0264 glutamyl-tRNA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46301"
FT                   /db_xref="GOA:A6TJD3"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJD3"
FT                   /protein_id="ABR46301.1"
FT                   /translation="MKIIVFGITHKKATIDLREKVAFSQSKKQEAYSLLKESPFIHEAV
FT                   ILSTCNRSEVFAVVQDTSIARRWFKRFYTDFFQLKETALEGCNHFEKGREAVQYLYHVC
FT                   VGVDSLVIGEDQILGQVKEAHAEALDFAATGKILNKLFLEAVTTAKEVKTETAISENAL
FT                   SISSIAVKQMENHLKGLVGKTVLVVGFGKMSRIAIENLLCKGIKRLYICNRTKESVQEL
FT                   IEKHPQIHYLSYDQKYEMLNGVDAVISATGAPHFIFYKEDMEKIYQKHRPMCMIDIALP
FT                   RDIDPAVKEIEGIELFHIDDLKEIANENLAYRMDCIEIIKQSINEAIEKYEGWYQCLPI
FT                   YPRIQAIKAYSETLTDQELEKLFKRLDHMAEEDRQVIEVVVKSLVKKMWKTPILQLKDA
FT                   GIRGNGEAFAAFVDEFLGLDAGCGK"
FT   gene            80971..81699
FT                   /locus_tag="Amet_0059"
FT   CDS_pept        80971..81699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0059"
FT                   /product="siroheme synthase"
FT                   /note="TIGRFAM: siroheme synthase; KEGG: gka:GK0404
FT                   siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46302"
FT                   /db_xref="GOA:A6TJD4"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042518"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJD4"
FT                   /protein_id="ABR46302.1"
FT                   /translation="MTKYYPIMLNIEEKKCTVVGGGRVAERKVKSLLEHGAVVTVMSPT
FT                   LTDALQEMVRQGQLLHHQKHYETGDLRGSYLVYVATDDLQVSQACHEEASRENILMNVV
FT                   DVPRLCDFTVPAIVRRGPLTVAIASDGKSPMLSRKIREELEKRFGQHYEDVLELLGEMR
FT                   VQALNEINEIEDRKQLFQQLIYEHDVENLGKKGKEILWREAWQFYEAFKKQLKGCDKNE
FT                   NNKNRIKSQSAGPSSSRNHY"
FT   gene            81632..82582
FT                   /locus_tag="Amet_0060"
FT   CDS_pept        81632..82582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0060"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase; KEGG: bsu:BG10342
FT                   porphobilinogen deaminase (hydroxymethylbilane synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46303"
FT                   /db_xref="GOA:A6TJD5"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJD5"
FT                   /protein_id="ABR46303.1"
FT                   /translation="MRTIKIGSRASQLALVQAEIIINMLKEKFPQYTYEIIKITTLGDR
FT                   ILDKTLDKIGGKGLFVKEIQKALAEEKIDLAIHSMKDMPGETPEELVLGAITKREDPRD
FT                   VLITRENKSLEELPKGAVIGSSSLRRQAQVMALRGDIKVVPIRGNVGTRLGKIETESLD
FT                   GVILAAAGLNRLGLKEKISSYLEIEDFTPAVGQGALGCEARRKDIEMLEMLLAINHEET
FT                   YRCVMAERAFLKLLEGGCHVPIGAYGQQQGQELHMTGMVASSDGRRVIKEQVMGDIADF
FT                   QALGIQLGETLIEKGAKEILETVNTDNRIVNTEGS"
FT   gene            82626..84134
FT                   /locus_tag="Amet_0061"
FT   CDS_pept        82626..84134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0061"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Uroporphyrinogen III synthase HEM4;
FT                   KEGG: dsy:DSY2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46304"
FT                   /db_xref="GOA:A6TJD6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJD6"
FT                   /protein_id="ABR46304.1"
FT                   /translation="MSKGYVYLVGAGPGDEELITVKGLRCIQEADVILYDRLANPALLK
FT                   NKRDEAECIDVGKSPKRHAYTQEEINELLVLQAHKGKTVTRLKGGDPYVFGRGGEEALA
FT                   LRKARIPFEVVPGITSAIAVPNYGGIPVTHRNVSTSFHVITGHEDPLKEKSSVNYEALA
FT                   KLEGTLVFLMGVGNLEEIVNQLRRYGKPKETPIALVHQGTTAKQRTVTGTLESIVTVVK
FT                   EKKITSPSVIVIGEVVRLQDELNWFESLPLHGQRILVTRTREQASQLSTKLKALGGDVV
FT                   EYPTIEIRPAQDIEGVNAKLKRIHQGDYIIFTSVNGVKAFFERLKALKMDVREMGPGKL
FT                   VAIGPATAKALEEKGLLVEVIPETYVAEGIIDCLKESIKEGDKVFLPRANIARKALNEG
FT                   LEALGAQVEEIEIYETVLPVQGEQHLRELLVEGIDWITFTSSSTVQNFMDLLGKEDRHL
FT                   LESVKIASIGPITGKTAKKLGLPVDVQAKEYTIAGLVQAMMEVQ"
FT   gene            84135..85109
FT                   /locus_tag="Amet_0062"
FT   CDS_pept        84135..85109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0062"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   mta:Moth_1246 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46305"
FT                   /db_xref="GOA:A6TJD7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJD7"
FT                   /protein_id="ABR46305.1"
FT                   /translation="MDLIQRPRRLRGFEAIRNIVRETTVNTSDLIYPIFVVHGEKIKRE
FT                   ISALPGQYHLSVDMLAEEIEEISALGIQGIMIFGIPKTKDEAGSEAYHTNGIVQQAVKE
FT                   VKKHRPSLLVMTDVCLCQYADHGHCGIIQNGRILNDRTLDVLANIALSHAEAGADVVAP
FT                   SDMMDGRVKRIREVLDHNDFEHIPILSYSVKYASAFYGPFRSAAGSSPQFGDRKTYQMD
FT                   TGNRRESLREVALDIEEGADMVMVKPALAYLDIIREVKDKFQVPLGAYQVSGEYAMIKQ
FT                   AAQAGLADETQMMVETLTSIKRAGADIILTYFAKEMAKWIRDQ"
FT   gene            85091..86413
FT                   /locus_tag="Amet_0063"
FT   CDS_pept        85091..86413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0063"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: chy:CHY_1212
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46306"
FT                   /db_xref="GOA:A6TJD8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJD8"
FT                   /protein_id="ABR46306.1"
FT                   /translation="MDKRSIMKYERSQKLFEASQEVIPGGVNSPVRAFSSVGMNPPFIK
FT                   RGKGAYIYDEDGNKYIDYVGSWGPLILGHCHPEVVENLKAVLETGTSFGAPTEIELKIA
FT                   ELITGAIPSVEMIRMVNSGTEATMTALRLARGYTGRNKIVKFNGNYHGHSDGLLIKAGS
FT                   GALTHGVPNSPGVTPDVAKNTITAKYNDIEGIMEIFKQQGEEIAAVIIEPIAGNMGVVP
FT                   MTNKFAHALRKITEDYGALLIFDEVMTGFRVSFGGAQSLYQIKPDLTCFGKIIGGGLPV
FT                   GAFGGKREIMEHLSPVGPVYQAGTLSGNPLAMTAGYTTLSILHNNSGIYEELEKKAQKL
FT                   EKGFKKIVKELQIDASFNRVGSMLCMFFTKEKVSDLETASTSNTEIYSQYFRAMLSRGV
FT                   YLAPTQFETMFISDAHGDVEINRTIEAAYEGLKEIRNNPSI"
FT   misc_binding    86468..86650
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 119.93"
FT   gene            86836..87210
FT                   /locus_tag="Amet_0064"
FT   CDS_pept        86836..87210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0064"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: ppd:Ppro_1299 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46307"
FT                   /db_xref="GOA:A6TJD9"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJD9"
FT                   /protein_id="ABR46307.1"
FT                   /translation="MKRGLFVLAHGSMAQEAGEIVKEIVTMLEGDKSEAFDLLGFGSLQ
FT                   FSQPDFMQGIDQLVEQGAEEIIIVPMFLFQGNHVKHDIPEELEVLQKKHEKVKFTLGRP
FT                   IGADRRIADIIQERAKEALS"
FT   gene            87298..88701
FT                   /locus_tag="Amet_0065"
FT   CDS_pept        87298..88701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0065"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: tte:TTE0375
FT                   Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46308"
FT                   /db_xref="GOA:A6TJE0"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE0"
FT                   /protein_id="ABR46308.1"
FT                   /translation="MKRKGAILLAGTHSGVGKTTISLGIMGALKKRGEKVKPFKVGPDY
FT                   IDPQFHQYVTGIPSRNLDSHLIDPRVLESLFHKNVGDDEIAVIEGVMGLYDGLGTHRDQ
FT                   GSSAHISKIVKAPVILIIDGKGMSASAAAMVLGYQAYDKEVDIQGVIINNLSGDKHYDL
FT                   LRQAIERDTGIPCIGYLKQQKQIQLASRHLGLIPSMEVPELKEKVAQMVEMIEETVDVD
FT                   LLIEIALRWQPSSPKSPEYSRECKDMGTGLNIAYAYDQAFHFYYEDNLDLLREMNVTLI
FT                   PFSPLKDTVLPKDIHALYIGGGFPEVFAPELEANEALRREIKKKSEEGLPIYGECGGLM
FT                   YLTKGIKTIEGKVHPMVGIFDVYSEMTQRLQRFGYAEIQVSEESGILKDVGKVKTHEFH
FT                   RSRLESQEQNYSYTVQKKRDDKVVDRWQCGLEKNNTLGAYGHIHFYSNLNFPKAWIEAA
FT                   KSYKKKCSS"
FT   gene            88804..89325
FT                   /locus_tag="Amet_0066"
FT   CDS_pept        88804..89325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46309"
FT                   /db_xref="GOA:A6TJE1"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE1"
FT                   /protein_id="ABR46309.1"
FT                   /translation="MISRNRKKQMDTKMLVKMAMLIALSGIGAMIKIQGSIALDAVPGF
FT                   YAALLLGPMAGGIVAFAGHLISALTAGFPMTVPMHLVVAVEMFIIVALFSVVWQKINPW
FT                   VAIIVGILLNGVGAGLLVVPMSILLGLPLNGWALFAVIWMPLLIGSTVNILIAASLYKI
FT                   MGKGKSVNGN"
FT   sig_peptide     88804..88911
FT                   /locus_tag="Amet_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.504 at
FT                   residue 36"
FT   gene            89315..90061
FT                   /locus_tag="Amet_0067"
FT   CDS_pept        89315..90061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ctc:CTC00742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46310"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE2"
FT                   /protein_id="ABR46310.1"
FT                   /translation="MEIKRCRDLTLIERAGQPNLVIACDSCGGIGEKPQDQIKVPAEVV
FT                   GYFTARVSLMEVMSVGARVMTVINTLSVEREPTGEKMIKGIQKMIEEVKLPITALNGST
FT                   EENVVTCQTAMGITVIGEVERESIKIGCSKPGDLIVALGTPKVGNEIKLPIDDEICSIK
FT                   DFQALVKMKNVKDIHPIGSKGMYYEAQLLASLNHCEFKSREATGVDLKKSAGPATAVIF
FT                   SVSKEQLPTVESQLQQQVKVIGSLEN"
FT   gene            90100..90975
FT                   /locus_tag="Amet_0068"
FT   CDS_pept        90100..90975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0068"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; KEGG: lin:lin1134 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46311"
FT                   /db_xref="GOA:A6TJE3"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012363"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE3"
FT                   /protein_id="ABR46311.1"
FT                   /translation="MIEVICPGSCGELIQGMIQGSEKLISYAINCYSKVTLTEGRSPFL
FT                   ENWSKSQQMIEKVLLYYGYSPKEGEEIGITVDSQIPMGKGMASSTADLAATALAMATYL
FT                   NETITQEEIAILCVEIEPTDSTVFSQLTLFDHLEGKYKKSYEEPMKANVLMLEGVGSIN
FT                   TIGFRKSNHHRLLKEKESELKEALHFFEKGIKGGDLKLMGKAATLSAFANQEILYKKEL
FT                   ETLFKISEKLGAAGVNVAHSGTVMGILYEENQFDLEAMKVLLKQERFRPYYPANKTYEI
FT                   IQGGPRVITK"
FT   gene            90992..91612
FT                   /locus_tag="Amet_0069"
FT   CDS_pept        90992..91612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0069"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   cpr:CPR_1241 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46312"
FT                   /db_xref="GOA:A6TJE4"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE4"
FT                   /protein_id="ABR46312.1"
FT                   /translation="MKYIQSPREIERKSFEIITRELEVELPDPQTAPIIKRVIHTTADF
FT                   EYAKLIKIHPEAVEAAQKALQEGCRIYTDTNMVLSGINKRILKKYGGEVYCLVGDPEVA
FT                   REAKERGVTRSMVAMEKAMADPETKLFVIGNAPTALFILCQGIQEGKAKPSAIIGVPVG
FT                   FVGAQESKELLMEQTVPHITIQGRKGGSTVAVAIVNALLYMLE"
FT   gene            91627..92760
FT                   /locus_tag="Amet_0070"
FT   CDS_pept        91627..92760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0070"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   plu:plu2996 cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46313"
FT                   /db_xref="GOA:A6TJE5"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJE5"
FT                   /protein_id="ABR46313.1"
FT                   /translation="MERYIIKDGKKLRYGYTTGSCATAASKAAAQMLLQPGEVHEVDID
FT                   TPKGWSLKLKVEDIQRSHGAVSCAIIKDAGDDPDVTNKLAIYSKLIWRQDTKIEIHGGE
FT                   GVGTVTRPGLQIPVGKPAINPIPLQMIEREVREVIGPGRGVDIVISVPKGQEVAKKTFN
FT                   PKLGIQGGISILGTSGIVEPMSEEAMKDSLALELPMAKAEKIKTFVFVPGNYGRDMARE
FT                   KYKIHDKNMIKISNFVGFMMDQSVIQNVERILIIGHIGKLVKVAGGIFHTHSKVADGRR
FT                   EILAAHLAALGASQQLVLRVLESNTTEEAVGLIQEKGFDRLFSHLADKITEKCVERTQG
FT                   NIEIGTIIFSMEQGVLAHCSQAGRLLEILKSEGVKDE"
FT   gene            92753..93373
FT                   /locus_tag="Amet_0071"
FT   CDS_pept        92753..93373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0071"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   ctc:CTC00734 precorrin-6B methylase/decarboxylase
FT                   cbiT/cbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46314"
FT                   /db_xref="GOA:A6TJE6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE6"
FT                   /protein_id="ABR46314.1"
FT                   /translation="MNKIYVIGLGPGHQDYVLPIAKKRAQECNVLVGGKRNLNIFSDFE
FT                   GEMIPIHQDLQGIVVEIKKRARTQQVGIIVSGDPGFYSMLTYLSKHFELEELEVIPGIG
FT                   SIQYLFSRLKKPWQNTPFKSLHGRGTDWVGILQKEKSIALLTDPEHNPQWIAEQCIEYG
FT                   LSKVKMVVGENLSYSEERIIQGTPAEIKEHGPYQMSVVVIENE"
FT   gene            93366..93974
FT                   /locus_tag="Amet_0072"
FT   CDS_pept        93366..93974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0072"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; KEGG: fnu:FN0964
FT                   precorrin-8W decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46315"
FT                   /db_xref="GOA:A6TJE7"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE7"
FT                   /protein_id="ABR46315.1"
FT                   /translation="MSRQRQVPMWGVPDEAFIRGRVPMTKAEIRGIIMRKLRLREESIL
FT                   VDVGAGTGSVTIEAAMHVSQGSVYAIEYKEEAVELIKKNIEKFQLENIQIMTGRAKEQL
FT                   MEIQTFDRMFIGGSEGELQWMIRYAAENLPSKGRIVMTAVTLETAYEGLQFLKQNEFTE
FT                   IETISVSIAKGRVVGNRTLMEAENPITVISAERGEQHER"
FT   gene            93964..94686
FT                   /locus_tag="Amet_0073"
FT   CDS_pept        93964..94686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0073"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: mta:Moth_1091 precorrin-2
FT                   C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46316"
FT                   /db_xref="GOA:A6TJE8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE8"
FT                   /protein_id="ABR46316.1"
FT                   /translation="MKGKLTGIGVGPGEKDLLTLRALDRIKEADIIFCPQVKVGESSIA
FT                   LEIVQEYIPQGTIIQGLCFPMTPCPKTLEANWQLNLEAIKKVLDQGKKAVFLTLGDALL
FT                   YSTYNYMVKELQNKNYEVETVPGIPSYSAIASRMNRPLAEGKEVLSILPLNAEPEQIKK
FT                   AFEYGDNLVVLKISHDPQGLKNMIQEADLEACLIVASNFGHENEIITEDTSILDGKIPY
FT                   LSTAIITKNRKTKKNRGE"
FT   gene            94679..95446
FT                   /locus_tag="Amet_0074"
FT   CDS_pept        94679..95446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0074"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: fnu:FN0957 precorrin-4
FT                   C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46317"
FT                   /db_xref="GOA:A6TJE9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJE9"
FT                   /protein_id="ABR46317.1"
FT                   /translation="MSKVEKVFFVGAGPGDPELLTMKGHRVIGSADVIIYAGSLVNPKV
FT                   LDHRKESAEIHNSAKLTLETVIQLIKKAVDEGKQVARVHTGDPSLYGAIQEQMDLLDGY
FT                   KIPYEVIPGVSSFMAAAAALKRELTLPDVTQTVILTRLEGRTPVPEKEALKELASHQAS
FT                   MAIFLSVHMMEGVVEQLLESYPEDTPIAVVQRASWPDEKMVIGTLKDIAKKVQEANITK
FT                   TAQILVGRFLNTEYERSKLYDPTFSHEYREATK"
FT   gene            95443..96507
FT                   /locus_tag="Amet_0075"
FT   CDS_pept        95443..96507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0075"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: fnu:FN0952 cobalamin biosynthesis protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46318"
FT                   /db_xref="GOA:A6TJF0"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF0"
FT                   /protein_id="ABR46318.1"
FT                   /translation="MKIAIIALTKGGKTLALVLQEFLEESHLYLKGPLPLGEKNVFAVG
FT                   EDFKRCVAQLFSAYDILVFIMATGIVVRSIAPLLQHKSQDPGVLVMDEKGQNVISLLSG
FT                   HWGRANEMTQRVATMINANPVITTASDVQGRVAVDLLAQQLNCEIADWQLTKTLTAHIV
FT                   NDGIIGLYCEDNRALVLPEGYVRVSKQKDLEDHDYGIIISNQSRLGKRARDLQLYPRNL
FT                   VIGIGCRKKVSPQLMIEKIKASLKNLDKSTHSIEKFVTVEVKKEEKAIIEASAHFNVPL
FT                   EIIDIETIKKSQTSLHQFETSAFVEKTIGVGAVSGPCAYIGSQGGHMLMEKEKGDGITL
FT                   SIAEVKVSEASERK"
FT   gene            96579..97319
FT                   /locus_tag="Amet_0076"
FT   CDS_pept        96579..97319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0076"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: gme:Gmet_0485 cobyric acid
FT                   synthase CobQ:precorrin-3B C17-methyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46319"
FT                   /db_xref="GOA:A6TJF1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF1"
FT                   /protein_id="ABR46319.1"
FT                   /translation="MKKNGKVFVIGIGPGDEAYRAPAATRALMKSDTIIGYKTYIELIE
FT                   ETLEGKEVIDSGMRKEVERCQLALTLAEEGKVVSLVSSGDPGIYGMAGALLQVKQQRQS
FT                   DIEVEVIPGITAVSAAAALLGAPLMHDFAVISLSDLLTDWELIQKRVALAGEGDFVIAL
FT                   YNPKSKGRTIQIEETQKILLKYRSKETPVGIVKNGTRQGEVVIVTTLGEMLLHPIDMLT
FT                   VVIIGNSHTTMMNDVMITPRGYGI"
FT   gene            97316..98092
FT                   /locus_tag="Amet_0077"
FT   CDS_pept        97316..98092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0077"
FT                   /product="precorrin-6x reductase"
FT                   /note="TIGRFAM: precorrin-6x reductase; PFAM: Precorrin-6x
FT                   reductase CbiJ/CobK; KEGG: mta:Moth_1223 precorrin-6x
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46320"
FT                   /db_xref="GOA:A6TJF2"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF2"
FT                   /protein_id="ABR46320.1"
FT                   /translation="MILLLCGTVEGRQVLHELLKRKIQVLATVTTSYGADLLKQEGQVT
FT                   VLEERLDQEGMEALLKGHPIQAVVDVTHPYAQQISKLAMGVCAEKDIPYLRYERGQVTC
FT                   GDQGLKMVKDFKEAAQEAKKYQGSIFLTIGSKEIPTFLEEINVERLIARVLPLSSMVKA
FT                   CEDYGFTPDNLIAMKGPFSEAMNQELFRQYCPSVIITKDSGMAGGTQEKIRAAQKLNIP
FT                   IIVVQRPIMNYGQTHENTKELIQAVQKVMKFEEATT"
FT   gene            98625..99125
FT                   /locus_tag="Amet_0078"
FT   CDS_pept        98625..99125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC00217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46321"
FT                   /db_xref="GOA:A6TJF3"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF3"
FT                   /protein_id="ABR46321.1"
FT                   /translation="MAAMIRHTASEPKKPFWQTMLKIIGALLVINLFVELTNFMPKNYA
FT                   SIASVMILLISTGLTSYLINRNLAKYTYILIEDDLIFYKEIGSKEKKVLDVKIYDIQWI
FT                   KPIQALDKQEKCNKTYGIACRLKGKGVYVGQYENDGKINRFIFQPSEGLLEELQKQITV
FT                   ANQ"
FT   gene            99267..99452
FT                   /locus_tag="Amet_0079"
FT   CDS_pept        99267..99452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46322"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF4"
FT                   /protein_id="ABR46322.1"
FT                   /translation="MGEGLKCYVCNRENNTGIVVLNEYICGSCEKEMLYIETDQLKYEL
FT                   FKKKIKEIWKKGLQVS"
FT   gene            complement(99506..99682)
FT                   /locus_tag="Amet_0080"
FT   CDS_pept        complement(99506..99682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46323"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF5"
FT                   /protein_id="ABR46323.1"
FT                   /translation="MNGDRITNLKEFVTAYGGRKSDIEIAEMLEAPIDQVKSERRKLSF
FT                   DTFKTKISIHHKK"
FT   gene            99846..101276
FT                   /locus_tag="Amet_0081"
FT   CDS_pept        99846..101276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0081"
FT                   /product="Orn/Lys/Arg decarboxylase, major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; Soluble liver
FT                   antigen/liver pancreas antigen; KEGG: tte:TTE0093
FT                   Arginine/lysine/ornithine decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46324"
FT                   /db_xref="GOA:A6TJF6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF6"
FT                   /protein_id="ABR46324.1"
FT                   /translation="MSEVPILDRLLQLQKQDIVSFHVPGHKNGKIYHQFPYKNFTDFLM
FT                   HIDTTEIPGTDNLHNPKEIIKEAQERASRAFHSKETFFLVNGSTSGIYSMVMACTEPGD
FT                   KIIVDRNCHQSVINSTILGDLNPVYLYPEIEIEQGISLGVSPQAVEQMIQEHLDAKAMI
FT                   ITYPTYHGITSDLKKIAEIVHKYDKILLIDEAHGAHFGLSQQLPATALACGADAVVQST
FT                   HKTLPSFTQSSMLHIQGDRIDRNKLKTMLRIHQSSSPSYLLLASLDLATMIYDTQGKYL
FT                   MEQLLQHITYFKAELADIEGIEILGGENHDATRLWISLKHLGVTGYQLEKRLRDQYQIQ
FT                   MELANIYGVLGVATIGNQRRDFDRLIKALKNIAQEKGNQRIKEMPPFTYRIPKQVLRPG
FT                   EALHKRKETIPLLEARGQISGEYVIPYPPGIPIVIPGEVIDKEMIQYIDLMVQEGMEIV
FT                   GMKDASYKTIQIIKADEI"
FT   gene            101366..102001
FT                   /locus_tag="Amet_0082"
FT   CDS_pept        101366..102001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0082"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: lga:LGAS_0372
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46325"
FT                   /db_xref="GOA:A6TJF7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF7"
FT                   /protein_id="ABR46325.1"
FT                   /translation="MKNGLFISFEGVDGAGKSTQIHYAKDFFEERGYKVSLTREPGGTR
FT                   ISEIIREAILDRTHQEMTHRTEALLYAASRAQHVEEFILPALAEGRVVLCDRFVDSSMV
FT                   YQGRGRGLGFDAVRNINQFATGGLEPDLTIFFNIHPQVSLGRINVKEKGDRLEQEKMAF
FT                   HYTVYESYHDLAQMNSSRIKVIEANQEVEKIKSEVEKIMTNLLRRDEA"
FT   gene            101998..102327
FT                   /locus_tag="Amet_0083"
FT   CDS_pept        101998..102327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0083"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   cac:CAC0299 protein from nitrogen regulatory protein P-II
FT                   (GlnB) family, ortholog YAAQ B.subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46326"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF8"
FT                   /protein_id="ABR46326.1"
FT                   /translation="MKLVIAIVHDDDVHALLDDLTANQFRVTKLATTGGFLKSGNTTIL
FT                   VGVDDDKVDEVISSIKDNCESREQIATSPAPVSGATGVFIPYPIEVRVGGATVFVVDVE
FT                   KYAKL"
FT   gene            102347..103336
FT                   /locus_tag="Amet_0084"
FT   CDS_pept        102347..103336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0084"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: tte:TTE0097 ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46327"
FT                   /db_xref="GOA:A6TJF9"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJF9"
FT                   /protein_id="ABR46327.1"
FT                   /translation="MAFENIVGQAHVIKLLKQSIKQNTVGHGYIFEGIEGLGKHLVAFE
FT                   LAKALCCTGTGDQPCNQCNSCKKLSHQNHPDVIWITGEGSIKINTIRDLQKDTQQKPYE
FT                   SRKKVYIIEKAEKMTVQAQNALLKTLEEPPSYVTLILLTANSHSLLPTITSRCQIIKFQ
FT                   PVPLDVIQAFLMLEKNVDLEKAKLMATLSNGVVGKALKLLEDPSFQNQREGLIQISKDL
FT                   FKKDKVAALQKFSFFEDHKESIEEILELYLVWYRDLLVYRDTQNKVLMFNIDQVEEIIS
FT                   QSNRIDLKKISNIISIIENTKENVRRNVQFQLNIEVMLLNIQEVLSSW"
FT   gene            103330..104226
FT                   /locus_tag="Amet_0085"
FT   CDS_pept        103330..104226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0085"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: ctc:CTC00222 tpl
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46328"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG0"
FT                   /protein_id="ABR46328.1"
FT                   /translation="MVTVVGIRFKKAGKIYYFDPTEFEVSKNKNVIVETVRGVEFGEVV
FT                   VGPKEVLEEDIIAPLKKVIRIATEEDEKIHDENKAKEKEAFEICIEKVEKHQLEMKLVD
FT                   VEFTFDNNKIIFYFTADGRVDFRELVKDLASVFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   SLCCATWLGDFEPVSIKMAKEQNLSLNPAKISGICGRLFCCLKYEHDMYQQILAKLPGT
FT                   GSIVLTPDGEGIVLDTNVLLELVKVKVRNGDNGAEEVKSYFLHDVTKIKVVQKKAQQDD
FT                   LEIPEELKDELKNLEQK"
FT   gene            104393..105001
FT                   /locus_tag="Amet_0086"
FT   CDS_pept        104393..105001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0086"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ctc:CTC00146 thiol:disulfide interchange protein TlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46329"
FT                   /db_xref="GOA:A6TJG1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG1"
FT                   /protein_id="ABR46329.1"
FT                   /translation="MPMKKGYKKVQIMILIMVLLLIIAGCRRTIGPEEVEDNQPPTEQE
FT                   MTEEETQDIEEAPIEEGPLQFTLENQRQEEVTLSELKGKPIFLTFWVSWDEDSKEQLEV
FT                   LHNLQRLLEEDVSFVGVNATTFETAEHKDILAYLEEQEYEFHIVFDDEGEVQDAYYVGS
FT                   FPTTFLLDESGEVVQLFTTLMKEDKMIEALEPVLEKLLP"
FT   gene            105104..105847
FT                   /locus_tag="Amet_0087"
FT   CDS_pept        105104..105847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0087"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="TIGRFAM: RNA polymerase sigma-I type; RNA polymerase
FT                   sigma-70; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   bsu:BG13269 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46330"
FT                   /db_xref="GOA:A6TJG2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014244"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG2"
FT                   /protein_id="ABR46330.1"
FT                   /translation="MTKLFKILKKRKTIEERIRDIQEGNEEEKNSIIQEHIPFIKKILS
FT                   QQLGRYIEIENDDMFSIGLMAFNEAIDKYETSRGKFLSFAAIVIKNRSIDQLRKQSRTS
FT                   NEVIVSQMIGDDGEASSTDHMASVESFENRVEAKVDMGIFIKRMAEFQVTLDDLINEAP
FT                   RHMDTRLNAIKIGRYVHENHQLKEKLLRRKKLPTSELMKELMVSKKVVQGSRKFIIAVI
FT                   LILDSNLDTMKEYISQVEGGDYIDE"
FT   gene            105840..106865
FT                   /locus_tag="Amet_0088"
FT   CDS_pept        105840..106865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46331"
FT                   /db_xref="GOA:A6TJG3"
FT                   /db_xref="InterPro:IPR024449"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG3"
FT                   /protein_id="ABR46331.1"
FT                   /translation="MNKGCVMEIRKNTMVIMTDDCLFTEIKKKRQAEVGTEILFHSTEI
FT                   VNPKKGKIQPWMLMAASVLLVLITSLYGINLWQMNYQVHALLTVDINPSIQMEVNANNK
FT                   VIKVTPLNEDAKTLPLQELKNQSVELALEELVNLSKEQGYIPFGDENYILVARILLKES
FT                   KANLTGLQALIEIGKERIEQTAVEQGESISVVTIEAEVESLKKATEDKISVGKLEMYEK
FT                   VRATTPEDIDMEEIKEKSIGEMMKQIDKAHPVFDEHPGNQKKNQDQLKEHPVFNEHPGN
FT                   REKDNKQEQLDKKDNQDRQGKQDEKNEQGEKVQKGQKNHPVFEQHPGNQNKSRGKGTGP
FT                   N"
FT   gene            106957..107799
FT                   /locus_tag="Amet_0089"
FT   CDS_pept        106957..107799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46332"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG4"
FT                   /protein_id="ABR46332.1"
FT                   /translation="MKKFLAGAFALLMFVSFAATASAFVPPGLAKKQGLPPGLEEKAGE
FT                   LPPGIQKRFGDIEELQKGLAYEYNKTILQMDADNRRIVIEEGTAQLHLLVADNAKIELD
FT                   GKIVSFKDLYKNDEVQLKLNDELTIIEIIGSKGKDRIPAEKYEEVKGKIDAINSTRREI
FT                   TVISDNTKRLYDIDSNAKIWIDDASSRLTRLEKGMEVTLKIEEDKVVEIYGFSDIQTHE
FT                   GRLMSVKITEEENIIILRIGEENRTFTVEKRIDLSEISLGATIRIQVKNNEVYRLAEK"
FT   sig_peptide     106957..107028
FT                   /locus_tag="Amet_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.752 at
FT                   residue 24"
FT   gene            107951..108718
FT                   /locus_tag="Amet_0090"
FT   CDS_pept        107951..108718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0090"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; KEGG: cth:Cthe_2102 methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46333"
FT                   /db_xref="GOA:A6TJG5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG5"
FT                   /protein_id="ABR46333.1"
FT                   /translation="MEELLKENERIDDLQINDLKLIQNPQWFCFGIDAVLLANFVTLKK
FT                   NARVVDLGTGTGIIPILLAGKSESSHVTGIEIQEEVAEMAQRSVKLNGLECRIDILPMD
FT                   LKEAPQVLPVNSFDVVTSNPPYMHGQGLKNQEDKKTISRHEVKCNLEDVIRTASKLLKQ
FT                   HGKLFLIHRPQRIVDILVFCRQYKLEPKQLRLIHSTYDKKPNLMLLEAKKDANPELKFL
FT                   DPLYVYDQEGKYTSEIHEIYGKNHIEKGANTNG"
FT   gene            108711..109550
FT                   /locus_tag="Amet_0091"
FT   CDS_pept        108711..109550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0091"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: tte:TTE0104
FT                   predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46334"
FT                   /db_xref="GOA:A6TJG6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG6"
FT                   /protein_id="ABR46334.1"
FT                   /translation="MDKGKLYICPTPIGNLEDITLRVLNTLKAVDVIAAEDTRHTLRLL
FT                   NHFEIQKPLTSYHEHNRMSKGPQLVNKLLQGEKIALVSDAGMPGISDPGEDLIKLCIEE
FT                   DIPVEVLPGATAGILALVASGLDARRFSFEGFLDRDKKKKKERLEQIKHEDRTLIFYEA
FT                   PHRLKETLKSLSEVLGNRQAVVGRELTKKFEEFIRGDFETLLAHFQENPPRGEIVLLCE
FT                   GGVPSDHQEEAFKDLTIQEHLIQLIEAGMDKKQAIKEVAKARKVPKRDVYQESIELP"
FT   gene            complement(109662..109901)
FT                   /locus_tag="Amet_0092"
FT   CDS_pept        complement(109662..109901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0092"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: cth:Cthe_2100
FT                   transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46335"
FT                   /db_xref="GOA:A6TJG7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG7"
FT                   /protein_id="ABR46335.1"
FT                   /translation="MKSTGIVRKVDELGRIVLPIELRRTLTIAEKDSLEIYVDGESIIL
FT                   KKYEPACIFCGNAKDVTVYKTKNVCEDCLEEFRK"
FT   gene            110289..111707
FT                   /locus_tag="Amet_0093"
FT   CDS_pept        110289..111707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0093"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase, HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase, HD region; KEGG: tte:TTE0109 tRNA
FT                   nucleotidyltransferase/poly(A) polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46336"
FT                   /db_xref="GOA:A6TJG8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG8"
FT                   /protein_id="ABR46336.1"
FT                   /translation="MNKIIACILETGKVSNIDIYLVGGSIRDFLLNRNIKDLDLIIKED
FT                   PGRFAEKIAKELQGSYFVLDQDRGIHRVKVKDGITIDLAKFQGEDILADLAKRDYTINA
FT                   MAYPLESGWPIDESQLIDPYGGQQDIKEKVIRQISEKNFQQDPIRMLRGPRLMGQLDFE
FT                   MDDETKKSIQRNCLLINEAPGERIATEIFTLLGEENTHEYLEFLDKELHVLDKIFPEII
FT                   NMKDVGQCKYHVVDCWTHSLYTMRIAEMVIYHQGFFENHIREAYEVHTSKKVAGEHTRL
FT                   QLIKLGALFHDIGKPSAQKVDETGRVRFRGHEITGAEIVKVYGEKLKLSVKEQQMLYRY
FT                   IELHMGPLVLYKSNDVSGKALYKLFKEMGEETLDILLIAFADIVATRKLLDPEEEMGMF
FT                   KIHIEYIANNYITRYKPIENISHIISGKEIMETLNLPEGILVGEIVEEVKKAIYFGKIP
FT                   PEKERVLKYIKEIY"
FT   gene            complement(111825..113273)
FT                   /locus_tag="Amet_0094"
FT   CDS_pept        complement(111825..113273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0094"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="TIGRFAM: putative nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase and related; KEGG: dsy:DSY0787
FT                   nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46337"
FT                   /db_xref="GOA:A6TJG9"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJG9"
FT                   /protein_id="ABR46337.1"
FT                   /translation="MRNHTLLTDLYQLTMMNGYFENNSHEDTVIFDLFFRKNPCNNSFT
FT                   IIAGIEQVIDYIENLGFTEEDIQYLRSLNLFGEAFLDMLKQFTFTGTIYGVQEGSIMFP
FT                   HEPILRVKASVLQAQLIETALLNMINFQSLIATKASRIVEAAKGDPVFEFGLRRAQGPD
FT                   AGIYGARAAVIGGCVATSNILAGKLFDLPVVGTHAHSWIQKFDSELEAFRAYAKAYPDK
FT                   CLLLVDTYDTLKSGIPNALTVFNELREKGYEPKGIRIDSGDLAYISKQARRMLDDAGYE
FT                   KVGIVASSDLDEDTIDSLKLQGASINSWGVGTNLITSKDCPALGGVYKLSAVEKSGTLI
FT                   PKMKLSDNPGKITNPGYKKVIRIYEAENNRAQADLILLEEEEIDTTKPLTIFHPLYTWK
FT                   KKTFSNYKVREMLMPIYEDGKLVYPRKTVNEIRAYVRQELSTLWPEYKRLNRPQLYKVD
FT                   LSQKLWSLKHNMIQSLKKDKKDDE"
FT   gene            113529..114104
FT                   /locus_tag="Amet_0095"
FT   CDS_pept        113529..114104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0095"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mta:Moth_1356 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46338"
FT                   /db_xref="GOA:A6TJH0"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH0"
FT                   /protein_id="ABR46338.1"
FT                   /translation="MNHIWFFMIMVAMGVAIFTGRGEIISEVILSDSQEAVMFAISLTG
FT                   IMVVWLGLMNIAKESGLINGFARLMTPITRILFPDIPPNHPAISAMMMNFVANLFGAGN
FT                   SATALGLKAMEELQTLNKKKKVASNAMCLFLVINMSSIQLIPLTVLKIRADAGSAMPTE
FT                   IIGPGMIATAISTVVGIVTCKLLERGEG"
FT   gene            114104..114640
FT                   /locus_tag="Amet_0096"
FT   CDS_pept        114104..114640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0096"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ctc:CTC00239 spore maturation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46339"
FT                   /db_xref="GOA:A6TJH1"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH1"
FT                   /protein_id="ABR46339.1"
FT                   /translation="MEAMAMVSILAIPAMITVILLHGWIKKVPLYDSFVAGGKEGFQTA
FT                   VRIMPYLVAIFLAIGLMRKSGAMDYLIQLLMPLARLVGIPSEVLPLTLMRPLSGSGSLV
FT                   ILKDIIGTYGADSFPGRVAATMMGSAETIFYTMAVYFGAIGVQRSRHTVPAALIAHFAS
FT                   VIASVVVWSVLLRRL"
FT   gene            114705..115664
FT                   /locus_tag="Amet_0097"
FT   CDS_pept        114705..115664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0097"
FT                   /product="peptidase S58, DmpA"
FT                   /note="PFAM: peptidase S58, DmpA; KEGG: cno:NT01CX_1082
FT                   peptidase family T4"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46340"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH2"
FT                   /protein_id="ABR46340.1"
FT                   /translation="MKRGIVDVPGIKVGHASDFQGQTGCTVVIYEEGAVAGVDIRGGAP
FT                   GSRETALLDPVNMIEKVHSIVLAGGSAFGLDAASGVMKYLEERQVGFDVGVTKVPIVPC
FT                   SVLFDLAIGDYRARPDQAMGYLAAEEANQDEYRQGLIGAGTGATVGKILGNDRVMRGGI
FT                   GTWSIQVGELIVGAIVAVNAFGDIVNPGTQEIIAGAKAEDGKRFANTWEIMKKAIGGVG
FT                   NAFAQNTTIGIVATNAILTKAQAKKVASMAHNAYAKTIRPVHTQYDGDTIYAMATGQIK
FT                   SDVNIIGMLAIEAMEQAIVEGVKAGNERDMPQIIKKER"
FT   gene            complement(115941..116507)
FT                   /locus_tag="Amet_0098"
FT   CDS_pept        complement(115941..116507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0098"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B; KEGG:
FT                   sao:SAOUHSC_02261 accessory gene regulator protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46341"
FT                   /db_xref="GOA:A6TJH3"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH3"
FT                   /protein_id="ABR46341.1"
FT                   /translation="MHSLIDIFAYKIYKEKLLSHADIRKMKYAMTVIWNEIVKFIILLI
FT                   IFSVLDKRNLFLFSLCLLLPIRTFSGGLHFKSSFICFVTSLMFFLLSVVILPNLFTMNI
FT                   NLTIIFITVSILIIYIYSPIPSSFRPILDKKRKRFLKYLSVFFTILSTFILFTFALTYN
FT                   KAFFECGIWTICMQAFQLMLGKELK"
FT   gene            116857..117228
FT                   /locus_tag="Amet_0099"
FT   CDS_pept        116857..117228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0099"
FT                   /product="bacteriocin, lactococcin 972 family"
FT                   /note="TIGRFAM: bacteriocin, lactococcin 972 family; KEGG:
FT                   dsy:DSY2024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46342"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH4"
FT                   /protein_id="ABR46342.1"
FT                   /translation="MKNNLSRIFKKSVLGAVVISSLLTSQGVFASSNTPLAGGSVDLDK
FT                   ISGQLITPFSVQEVGGGRWEYGVGSVNVYSYYQHMTKEHSATVKGLRERKDRQLAGTEA
FT                   RATTAKNPLGGNRAWWNTY"
FT   sig_peptide     116857..116949
FT                   /locus_tag="Amet_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            117324..119636
FT                   /locus_tag="Amet_0100"
FT   CDS_pept        117324..119636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpe:PCP08 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46343"
FT                   /db_xref="GOA:A6TJH5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH5"
FT                   /protein_id="ABR46343.1"
FT                   /translation="MKRTYKTLLFVFFLLFTIVFTKYYGIYEHSRIFTGRYDFSINLRI
FT                   VEDISKEDVLSILEEYGERYDMDMERTIAFPGDGKYRRSLTAYVFINDFDWFNRTLRIE
FT                   DGKKLTSNLEEGEFLSNIETTDENQVGKFSIFDDNSQEIYIRPLADMKNRVVESNYKVH
FT                   LNNDKYTLEEIINTINQEQESLYVEKGSSIPIYVDINEYDIYFMYYIGITLLFILILGI
FT                   ISFIYDIIGRNKNFGIKKLYGHSNFKIIFKIFKEDIFKVIIFSNISSILVITILLYFKN
FT                   GFIGFGKYFSTYFLALCAIDLILMITLTTMTVFFKGRNNIQLMLKGKRRNIIFLNANMK
FT                   IIMSTIVILMLIVNLVIFNSYNIKNNNLNNWDKAKNLGFIGVNFSYTIDISDNIQFYPY
FT                   SVKLGNLWNDINDNGGIMAEYQQLFRSDIIEKEKMLSNLAYGMLINENYLKENIIFDEN
FT                   GNRITQIDDDKDTLTVLVPSQFKEKEELLKKGLRYFHLGNYDLGYKERLELETGTRKES
FT                   RDLPEFIEYIEKEYSFLNQKIIYTKDNQKMFTYDTGEMELYRHDFKEYYNEVDNTITDS
FT                   ILVVVSNDNLKETRKYAAIMSGTMKFRFEDYKYPEDGIVPLLEKNGLLDALAEVTTVYD
FT                   YAVDEINNTRTMLILSVGISIICIVIMLGLIFYESSNYLYRNKKKIGVFKLYGLGFLKR
FT                   YKSHFIMISIINLITIILSIIIGPIFLERFIDSSVKIYYLIIVLGILFYLLELIITYLF
FT                   LNKRENKSILIVLKGEL"
FT   sig_peptide     117324..117389
FT                   /locus_tag="Amet_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.815 at
FT                   residue 22"
FT   gene            119636..120268
FT                   /locus_tag="Amet_0101"
FT   CDS_pept        119636..120268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0101"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ctc:CTC02098 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46344"
FT                   /db_xref="GOA:A6TJH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH6"
FT                   /protein_id="ABR46344.1"
FT                   /translation="MSLVSLKNISKSFGKNKILEDFNLEIEKGESIAIVGDSGSGKSTL
FT                   LNIIGMLDDCDSGELVIAGKKKLTSSSKDAEKLRRYEIGYIFQNFALIDNMTVSENLDI
FT                   ALAYRKKSENKETIKANMLEEMGLRDKLNNKVYELSGGEQQRISISMVFLKPCSIILAD
FT                   EPTGSLDDTNKEIIMNLLQRVHKDGKTIIIVTHDKDVSKICERIVKL"
FT   gene            complement(120431..121693)
FT                   /locus_tag="Amet_0102"
FT   CDS_pept        complement(120431..121693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0102"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   KEGG: swo:Swol_2401 signal transduction histidine kinase
FT                   regulating citrate/malate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46345"
FT                   /db_xref="GOA:A6TJH7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH7"
FT                   /protein_id="ABR46345.1"
FT                   /translation="MQWYEIFILSILETVSILIVWSKLNRKVNVFSKKGAFIVIIISII
FT                   AVLFFIYETDIGFAINFFILCTTIIFLFNVAIKETILQFFIVLSIMISIQLTFTYILYW
FT                   VTESMVFSFNNGVVVNIGIIVVSALIYKFIIFDEIYKYLVRYRNYIIIIMINISGAVLL
FT                   LIYIWQINKEFITSYIAYLLLAVFIWEALNLYFLYQSIRIREQQKVIDIHEKYTPFLKS
FT                   MVQEVRQKQHDFKNHLNVLYGLIQIQDSGQVNMEIKEYIEKLIENIKSTDKLLNIKDQV
FT                   LSAIIYSKKVLADEKNICFDVEFISQIPVYPLEKYELVELFGNLLDNAIEAAETRKDEY
FT                   PPKVVLILGIEGDFKVVEIKNTGGTLQNEEIGKIFHRGFSTKKGKHRGYGLYNVKKIVS
FT                   RHSGTIELSFDDDYTIFKIKF"
FT   gene            complement(121716..122486)
FT                   /locus_tag="Amet_0103"
FT   CDS_pept        complement(121716..122486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0103"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: tte:TTE0561 response regulators of cell
FT                   autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46346"
FT                   /db_xref="GOA:A6TJH8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH8"
FT                   /protein_id="ABR46346.1"
FT                   /translation="MKCLLSNVISGGGNLNILVVEDNEYEINNIARVLQSISKEFRIYK
FT                   ALTGEECFKVIEKADIDLFILDIELPDISGVKIAEKIRNISKYELTYIIFITTHIYLQL
FT                   EAFKTIHCYDFLEKPYKKEELIKIIMRLSRGISSEKQQNKLDRQQVSFQMKDFIIKVYI
FT                   DEILFVEAQKRNCIIHTKEKVYTIKSMAIKKVIEILPKECFMRTHRSYIVNLKNIHKIE
FT                   KSEKNSWIIYFEGYFLPVYVSNSCKKEFLELFCG"
FT   gene            complement(123522..123989)
FT                   /locus_tag="Amet_0104"
FT   CDS_pept        complement(123522..123989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46347"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJH9"
FT                   /protein_id="ABR46347.1"
FT                   /translation="MAKYYIGNPNRVSYRPIEQRPVHFSNHAVEYKQRDSSCRCNNVLG
FT                   IKVPIDYLVNILAVLGLYFFKTQNLNIDTFLSLLTINDNNVENLIKQFMNTLNPSSQEG
FT                   KVDLNSIQSIINKVVSSMNPSNKNIDPSSIENMIKQVMGVVDNLDLESIKN"
FT   gene            124354..124602
FT                   /locus_tag="Amet_0105"
FT   CDS_pept        124354..124602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46348"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI0"
FT                   /protein_id="ABR46348.1"
FT                   /translation="MEKQSNTNATTSKVCPQLPGTVLRVFIPAGAVINLLNLLEITSPS
FT                   GICIIVRLPILGAGGLNISSIVNTIQQAGGTIEFMSE"
FT   gene            124879..125219
FT                   /pseudo
FT                   /locus_tag="Amet_0106"
FT   gene            complement(125266..126558)
FT                   /locus_tag="Amet_0107"
FT   CDS_pept        complement(125266..126558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46349"
FT                   /db_xref="GOA:A6TJI1"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI1"
FT                   /protein_id="ABR46349.1"
FT                   /translation="MNNLENLKDYVNENIENIKITEDIRSNIIKRSGKNTSNKLMYTAM
FT                   IVTPILLISCLFFNDQISYATQRGLRYLPGVSKLFYTDIEHQAYGLSGSIEMPIGEKYI
FT                   KVNSSYSEGNTVTIIIEGNIPFDQLIVMDEYKKAAESMSWDIIGDADFEQWSGRMTCTF
FT                   TDSIKRFYLVYDKYEIPIIMTELPEVFSKDRNYVSVEGIGIDIAVLTNYVEDKLEVNLL
FT                   AQTNNPAKTISFPLSDIYLLNDKGEKYYATNSNLENILYFDRKLEPGIRLVIPYISITD
FT                   ESLQSKVTISKDDEAPINITVGDNVLVINSLEWIQYVERFNFRTPQNDYHLVEEVAQKV
FT                   KLNFNKSLVGTNELKLHNILADVDENQLNKYIVEGVNVIYSDPSEENNSEMANDKELIL
FT                   SNIKEDQQEIDITFTRPVFYTSKEVIIPLQP"
FT   gene            complement(126551..127066)
FT                   /locus_tag="Amet_0108"
FT   CDS_pept        complement(126551..127066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0108"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: ctc:CTC00553 RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46350"
FT                   /db_xref="GOA:A6TJI2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI2"
FT                   /protein_id="ABR46350.1"
FT                   /translation="MSGEILNEQDFNRLINEYGTEILRLSYLYLKDYQLAEDACQDTFL
FT                   QVYKKFHNFKGDSSEKTWITRICINICKNYLRSSWIKSIVLNDKKLNDKAVSDKELFNK
FT                   LENNDLFKLIMDLKPKYKEIILMYYYQQFTVKEIAKILGISESNAFTRLSRARKDLKDR
FT                   KIGGMICE"
FT   gene            complement(127234..127812)
FT                   /locus_tag="Amet_0109"
FT   CDS_pept        complement(127234..127812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46351"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI3"
FT                   /protein_id="ABR46351.1"
FT                   /translation="MKKLLMLSLSFVLISSSMVVYASQGNEKSDSLVDSTAIIIKGEEN
FT                   IKAYEEAGIIRSVPRVRSKSFEIEGNQTSNSDFSIVSTSIPTSTWDLKVRSRDFTYSFM
FT                   SHIYSNYRYLPARDSLSSTGFGIYHMFEPNSRQRMTIFCYDVDGDYISGRTLTMDDVTL
FT                   YGLAVRNKAHYFKYESPGGTRISGSGLVY"
FT   sig_peptide     complement(127744..127812)
FT                   /locus_tag="Amet_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            128720..130687
FT                   /locus_tag="Amet_0110"
FT   CDS_pept        128720..130687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0110"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; tRNA synthetase class I (M); KEGG: cth:Cthe_2096
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46352"
FT                   /db_xref="GOA:A6TJI4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI4"
FT                   /protein_id="ABR46352.1"
FT                   /translation="MSKGTYYLTTPIYYPSAKLHIGHTYTTVAADVLARFKRTRGYDVQ
FT                   FLTGTDEHGEKIQEAAQKNGMNPKAYVDEIVEEIKKVWKSMDISYDIFIRTTDEEHERA
FT                   VQKIFQTLYEKGDIYKSEYEGWYCTPCESFWTETQLKEDKGCPDCGRPAHLAKEEAYFF
FT                   KLSKYQDRLIEHFEKYPEICYPESRKNEMLNNFLRPGLEDLCVSRTTFDWGIPVPFDPK
FT                   HVIYVWFDAVCNYITALGYTSENEEQYKKYWPANVHLVAKEIVRFHTIIWPAILMALEV
FT                   PLPKMVYGHGWILFGSDKMSKSKGNIVYPEPLIERYGIDALKYFLLREFTFGQDGNYTN
FT                   RTFVTRLNADLANDLGNLVSRTVAMIEKYNSGIIPEPKVAGEFDEDLRTVATGAAAKVE
FT                   KAIDQLQFHEALEEIWKVVRRTNKYIDETTPWILAKDEENKERLNTVLYHLADTLRIVS
FT                   VLIQPFMEATTNKIWEQLGIDANQGTTWEDASLFNQIPSGVKVRKGESLFPRLDVEKEV
FT                   AELEEINAQYAKSMNSGQEDKKEEEVVLETKEQITIDDFDKVDLKVAKILAVEKHPKAD
FT                   RLLVLQLQVGNEKRQVVSGIAEHYTAEALIGKQVILVANLKPVKLRGIESHGMILAAVT
FT                   GEKLVLGTIDGEIEAGTTIS"
FT   gene            130702..131469
FT                   /locus_tag="Amet_0111"
FT   CDS_pept        130702..131469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0111"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: cth:Cthe_2095 hydrolase, TatD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46353"
FT                   /db_xref="GOA:A6TJI5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI5"
FT                   /protein_id="ABR46353.1"
FT                   /translation="MLFDSHAHIDGGRFDQDRHQMIENAKTNGVSYILNPGADLSTSVK
FT                   AVNLAEKYDCVYAAVGVHPHDVKDMDEDTIEILRSLTNNKNVKAIGEIGLDFHYDHSPR
FT                   DVQRKWFKKQVELAKELQLPMIIHDRDAHGEVFEILKEHNAGEFGCVMHCYSGSIELAQ
FT                   EYIKLGIYISLAGPVTFNNAKKTYEVAQGIPLEWLLVETDSPYLTPVPYRGKRNEPAYV
FT                   KHVADKIAEAKGISFEEVARQTTKNAKRLFGIK"
FT   gene            131658..131774
FT                   /pseudo
FT                   /locus_tag="Amet_0112"
FT   gene            131924..132112
FT                   /locus_tag="Amet_0113"
FT   CDS_pept        131924..132112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46354"
FT                   /db_xref="GOA:A6TJI6"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI6"
FT                   /protein_id="ABR46354.1"
FT                   /translation="MSIKKMQILIFIGALIHITLSLLKFNNPLEKYKTESEIGIFLLVV
FT                   YLIIIFFAYKTKTKVKS"
FT   gene            132215..132970
FT                   /locus_tag="Amet_0114"
FT   CDS_pept        132215..132970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0114"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   tte:TTE2528 predicted transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46355"
FT                   /db_xref="GOA:A6TJI7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI7"
FT                   /protein_id="ABR46355.1"
FT                   /translation="MPRTAREKSKSGIYHVMIRGANRQEIFHDEQDCLRFLEILDRYKV
FT                   KTEIKIYGWCLMNNHMHLLIQEGKEELATTMKRIGVSFVGYYHQKYDTTGHLFQDRFRS
FT                   ENVENDEYLITVIRYIHQNPVKAGLVSKPVDWKWSSCSGYYGKKEYLQGLLDSERILGL
FT                   FSNDRESAIKEFRKFNEQENKDNCLDDVIITSLRDEEARLEIEKILSGINIGQIKSLPK
FT                   DQRDKIIREAKCIEGVKQRQLARLLGVSQ"
FT   gene            133051..133362
FT                   /locus_tag="Amet_0115"
FT   CDS_pept        133051..133362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_2283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46356"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI8"
FT                   /protein_id="ABR46356.1"
FT                   /translation="MKSSENKEKWQLHINSQLSSGQTQIQWCEEQGVKIHSFRYWKNRL
FT                   QIKPEQAKESTGFVAIKPVTLQKVSKMRIRIGKATVEIDDDVDPILLTSVIRVLTDYV"
FT   gene            133473..133754
FT                   /locus_tag="Amet_0116"
FT   CDS_pept        133473..133754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0116"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: swo:Swol_2282
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46357"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJI9"
FT                   /protein_id="ABR46357.1"
FT                   /translation="MSLIVQEKFKLDPFSRSLFVFCNKKRDKIKVLEWDTTGFWLHYKR
FT                   LEKDVFQWPEVTDNTHVEVDERAFRWLLDGLSIRERHAHKTIEERQII"
FT   gene            133833..135434
FT                   /locus_tag="Amet_0117"
FT   CDS_pept        133833..135434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0117"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: swo:Swol_2281
FT                   transposase and inactivated derivatives-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46358"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ0"
FT                   /protein_id="ABR46358.1"
FT                   /translation="MKTIENSTHSITSTTEDRLAFFENELAQKEQKIEELEAKVKFYEE
FT                   QFRLSQAQKYGSSSEKTDPDQMSIFNEAEKFSVKLDEEPEAEEVLTKRRTGKSKSKKKY
FT                   EDLPIEEVHYTLSDEERQCPKCDHTLHEMKTEVRKELKIIPAQVKVVHHIKQVYACRGC
FT                   DAIDSDNGGTIITAPMPKPVLPGSMVSPSVLAFIMENKYNQALPLYRQEASFVNYGIDL
FT                   SRQNMASWIIQGAEKWLSPLYDRMHTHLKQSPVIHADESPLKVLDEKDKSQSYMWLYAT
FT                   AETSEYPIYLYEYQPSRAKKHPKQFLEGFTGFLQTDGYAGYNGVENVVQVGCLAHARRK
FT                   YTDAIKALPEGSDVSLTKANEGLSLLRKIYRLEKSFKEMEPEVRYEARIEQTQPVLDAY
FT                   KTWLEVEEKRTLPKSKLGQAISYSLKQWDKLAAFMKDGRIAIDNNLAERGIKPFVLGRK
FT                   NYLFAKSPKGATASALCYSIIETAKANKLIPFQYLTYLFEQLPNLDIEDPEALDAMLPW
FT                   AESLPNEVRHKTEKND"
FT   gene            135705..137579
FT                   /locus_tag="Amet_0118"
FT   CDS_pept        135705..137579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0118"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   tte:TTE2604 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46359"
FT                   /db_xref="GOA:A6TJJ1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ1"
FT                   /protein_id="ABR46359.1"
FT                   /translation="MEGLCMYISKSKRPNGKYFISIAKGIRDPETKKSKKIQIKGFGTH
FT                   DLDSKSGKKALVQAEAELKEMIRLDEASRGFENFEDFIVSMSKDKLSLKHKNIGYLPYL
FT                   EIFNQLELQSFFSKMVKDSKLDYSFSDMMFYQVLGRLFNPSSKLEVATRKDDFLYDFNF
FT                   VNNDNIYSSLDVFSGFNKHKSKALQDGIQVINDMEILLDTVDSEAKKILETNINNTSHE
FT                   LEELITSYDSNFEMNENKLFKHLNKHMEKIVPERNISLAFYDCTTYYFESFDEDGFRER
FT                   GMSKDNKRNETQVVMGLLIDTNGIPISYRLFKGNKHELHTMEEVIDDILNNYTIKEIII
FT                   VADRGLNSRANLEMIRGKGLNYIVGSKGSAVPKDLKEKKFNSSWNITSKAEAKYKSGYI
FT                   TSKRKVSHNDETYDELIIKKYSDVYKEREMFKQDKMLERAKKNIKDFTINSTTKSKSKY
FT                   YKAVDNPKEKINIEIDEEKIKQEQENFGYFYIVTNKVEMNPADIMVAYKSLYKIEESFR
FT                   ILKTNLKARPVYHFKERRIRSHFLICYLALVIQRVLEYKLEEKNVEISTHEIINGLEGF
FT                   VIDEIDYKVDKLYMISDKLFKSKINQDIFKIEKNVLLSNEISNIIKKM"
FT   gene            137650..138087
FT                   /locus_tag="Amet_0119"
FT   CDS_pept        137650..138087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_2192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46360"
FT                   /db_xref="GOA:A6TJJ2"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ2"
FT                   /protein_id="ABR46360.1"
FT                   /translation="MMFRSQVLWYQTLLDLTMCVGFYAYEQIMRRIAGSYVYWYNWKYD
FT                   RIGNLFQDRFKSEPVEDNTYFLTVLRYSHQNPIKAGVTKDIKNYKWSSYKEYLEGKGLT
FT                   DREYVLEFFHKDPSIALGELVKYSDTLNEDKCLEIDENQKS"
FT   gene            138150..138269
FT                   /pseudo
FT                   /locus_tag="Amet_0120"
FT   gene            complement(138305..138898)
FT                   /locus_tag="Amet_0121"
FT   CDS_pept        complement(138305..138898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46361"
FT                   /db_xref="GOA:A6TJJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ3"
FT                   /protein_id="ABR46361.1"
FT                   /translation="MITILDIEIIKQNKFTILSIVIFVSALSKNIKLLIESPNEYMIWI
FT                   TILILFLLISKICLPFINNKKLFYKSILIVSLSIIYLIIGAMFIRYNAEHIDYEMNKEQ
FT                   KAGTKVRYTFYMTGRMNSPISVIKVIPIGAKGLEKHEINSRYTRDIRDSSIATTMTFVI
FT                   SEENIKLPTRTIVIYRALGVIPMINIRTNELAGM"
FT   gene            complement(139281..140108)
FT                   /locus_tag="Amet_0122"
FT   CDS_pept        complement(139281..140108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46362"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ4"
FT                   /protein_id="ABR46362.1"
FT                   /translation="MKRIMSLIIILGILLSISTVGAASTSQYPIKELKQNNIDEYNLLY
FT                   QHYKEANNQALKYILENKTMEGLSDFRTSEYEMYIREHTNNKSDFSVKSADSIELINII
FT                   DGLIIDDTYSTIYIYSDSSFIIESMKFTDTFNDKILEATLLDISMNSADRSKTYVIENF
FT                   SIPTRSPIRTETSYTINLGLTGFQLNTFVDVKDSNTVDLAYHNTNGTYNLDPYVSIEAS
FT                   SRELDENNLSNMCFTEGMYTTKDLLWEKDHFIQKAVVLEYDKLLVTSYFYFDR"
FT   sig_peptide     complement(140040..140108)
FT                   /locus_tag="Amet_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.747 at
FT                   residue 23"
FT   gene            complement(140128..140961)
FT                   /locus_tag="Amet_0123"
FT   CDS_pept        complement(140128..140961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46363"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ5"
FT                   /protein_id="ABR46363.1"
FT                   /translation="MKKTPVLIMMLVTLFSILTIGSVSAIQDSTKEISQDVVYDYNLLQ
FT                   EHYERSNNKALEYILENKTIEGINTFRTSEYDLYVQGVKNNEIHINGVTTDSIELVEVI
FT                   DDIFIDSAYSTIYIYSDSSFIIESMKFIDTSNDKIIEATVADISVNSADSSYTYVVEDF
FT                   DIPNRTPIRAEAWYTVNLGLVKFQLNTFIDVEDVSTVNVAYHNTNGSYSASPTLDLVEQ
FT                   SSRELNDNNLSNVCFTEGLYTLRGGFNSLSDSYIQKAIVLENSRLLVTSYLYFDQ"
FT   sig_peptide     complement(140884..140961)
FT                   /locus_tag="Amet_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.712 at
FT                   residue 26"
FT   gene            complement(141199..141819)
FT                   /locus_tag="Amet_0124"
FT   CDS_pept        complement(141199..141819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0124"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B; KEGG:
FT                   cth:Cthe_1310 accessory gene regulator B"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46364"
FT                   /db_xref="GOA:A6TJJ6"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ6"
FT                   /protein_id="ABR46364.1"
FT                   /translation="MKMINKLATYTVNKMNETITIDKEKIDFYIYGTELFIITLIKGIG
FT                   LILIASILGLLTEALIFILAFSILRIQAGGIHANSFWKCFLLTDMITFTAIYLVYLIPS
FT                   NSMLTFQAFFSFFSILLVLYYAPVESPNKPLTSHEKRIYKDRSCFIVLIGIVITLTISW
FT                   ISPYHSMYGLIFSLGFFCEGITLVPAFQRRLYKLKIRKWRCLD"
FT   gene            complement(141939..142367)
FT                   /pseudo
FT                   /locus_tag="Amet_0125"
FT   gene            142451..142660
FT                   /locus_tag="Amet_0126"
FT   CDS_pept        142451..142660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0126"
FT                   /product="transposase"
FT                   /note="KEGG: swo:Swol_2198 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46365"
FT                   /db_xref="GOA:A6TJJ7"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ7"
FT                   /protein_id="ABR46365.1"
FT                   /translation="MPRTAREKNKSGIYHVMIRGANRQEIFHDEQDCLRFLEILEIYKV
FT                   KTEIKIYDCCLMNNQANNRDGSFD"
FT   gene            142710..143483
FT                   /locus_tag="Amet_0127"
FT   CDS_pept        142710..143483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0127"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   tte:TTE2528 predicted transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46366"
FT                   /db_xref="GOA:A6TJJ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ8"
FT                   /protein_id="ABR46366.1"
FT                   /translation="MPRTAREKSKSGIYHVMIRGANRQEIFHDEQDCLRFLEILDRYKV
FT                   KTEIKIYGWCLMNNHMHLLIQEGKEELATTMKRIGVSFVGYYHQKYDTTGHLFQDRFRS
FT                   ENVESDEYLITVIRYIHQNPVKAGLVSKPVDWKWSSCSGYYGKKEYLQGLLDSERILGL
FT                   FSNDRESAIKEFRKFNEQENKDNCLDDVIITSLRDEEARLEIEKILSGINIAQIKSLPK
FT                   DQRDKIIREAKCIEGVKQRQLARLLGVSQTMISIA"
FT   gene            143592..144113
FT                   /locus_tag="Amet_0128"
FT   CDS_pept        143592..144113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46367"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJJ9"
FT                   /protein_id="ABR46367.1"
FT                   /translation="MYKRIILIIAALFIFAACGEKLQYSVPSLEQVNEFISDNSVNALA
FT                   IKEAEDFTIVLYENENGFGHYVLHRDQNNKLYDGKVIAMRHKDYQQNTLSLGGVASGKN
FT                   PFVTVIINDDNVLDKATELEILFTDGVKVKEPIDNKGIIIIHTNNESDKIINYLKVTIY
FT                   DSDMNILYEK"
FT   sig_peptide     143592..143651
FT                   /locus_tag="Amet_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.955 at
FT                   residue 20"
FT   gene            144336..144704
FT                   /locus_tag="Amet_0129"
FT   CDS_pept        144336..144704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0129"
FT                   /product="regulatory protein, ArsR"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: cth:Cthe_0245
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46368"
FT                   /db_xref="GOA:A6TJK0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK0"
FT                   /protein_id="ABR46368.1"
FT                   /translation="MEKERITMDTCNCTIIHEDIVNRVKESMPQEEKLYDLAELFKVFG
FT                   DTTRIKIIYALFESEMCVCDIAALLGMNQSAISHQLRVLKQAGLAKYRREGKVVYYSLD
FT                   DEHVKNIFDQGYTHIAHK"
FT   gene            144718..147084
FT                   /locus_tag="Amet_0130"
FT   CDS_pept        144718..147084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0130"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: dsy:DSY0829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46369"
FT                   /db_xref="GOA:A6TJK1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK1"
FT                   /protein_id="ABR46369.1"
FT                   /translation="MSYVSHVIKKELILEGMDCAGCTSKIEVAIAKLVGVKEVSLNFVT
FT                   KTLTIEIDDESKMESVVSAAKDIVNQFEPHVIVKEKMIDKVSKKALVLKGLSCVSCATK
FT                   IEDKVKELKGVHSVYMDFTSEKLVIEAKTHDWHRITKEVTAIVKHIESDVEVIDESRKK
FT                   DEQGHSHGGGDNKMELIRLGIGAILYAIALAFQMSDSIEFVLYFISYLLIGGEVLLKAG
FT                   RNIRRGQIFDENFLMSIATIGAFAIGEFPEGVAVMLFYQIGEFFQGLAVNRSRKSIGAL
FT                   MDIRPDYANLKVGNDVKKVSPEEVTVGDHILVKPGEKVPLDGVVIEGQSMVDTSALTGE
FT                   SVPREVEVDSNVLGGFINKNGVLTIKVSKEFGESTVSKILELVENASSKKAPTENFITK
FT                   FARYYTPVVVFVALALAIIPPLVIDGATFSEWIYRALVFLVISCPCALVISIPLGFFGG
FT                   IGGASKNGILIKGGNYLEALNSVDIVVFDKTGTLTKGVFKVMEINVEQNISKEELLEYA
FT                   AYAESYSNHPISTSILKAYGKEVNKEEIESYNEISGHGIKIKVKDKEILAGNIKLMDSE
FT                   KIAYEPVEAIGTIVYVAINGKLAGSIIISDEIKEDSQRAIKELKAIGVKKIVMLTGDNK
FT                   QVGIKVAKQLGIDEVHTELLPDEKVEKLEQLDRQKSPKGKLVFVGDGINDAPVLARADI
FT                   GVAMGGLGSDAAIEAADVVLMTDEPMKLVSAIKIAKRTKRIVWQNIIFAFGVKGIVLLL
FT                   GAGGLATMWEAVFADVGVALIAVFNAMRVLNVKNL"
FT   gene            147192..148448
FT                   /locus_tag="Amet_0131"
FT   CDS_pept        147192..148448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0131"
FT                   /product="UV-endonuclease UvdE"
FT                   /note="PFAM: UV-endonuclease UvdE; Protein of unknown
FT                   function DUF1722; KEGG: cno:NT01CX_0232 UV DNA damage
FT                   endonuclease (UV-endonuclease) UvdE"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46370"
FT                   /db_xref="GOA:A6TJK2"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK2"
FT                   /protein_id="ABR46370.1"
FT                   /translation="MSIGYACLTVGVENTDQKSCMLKNASESRLSEIVAYNLSALENII
FT                   DYNIKNQIKLFRISSDLIPFGSSPMNTLHWWDVYRSDFSKIGEKIKKSGMRVSMHPGQY
FT                   TVLNSPREEVVERAIQDLNYHARVLDCLGVGPEHKIVLHIGGIYDDKKEAMDRFIRNYQ
FT                   SLEEAVKKRLVIENDDKSYTISDVLEIGAILNIPVIFDNLHNEINPSDQERDELYWIGA
FT                   CRKTWEEKDGNQKIHYSQQNPEKRAGSHSESIGINEFMVFYQKIKRDDLDMMLEVKDKN
FT                   LSAVKCINSTSTQKKIKALELEWSKYKYTILETSPVNYLEIRKILKDKDGYPAISFYTL
FT                   VEEALQKERTIENAVNAAQHVWGYFKDVASEKEKQAFLKNMDKFIKKETSIRSIKRNLW
FT                   KLAVKYKEEYLLSSYYFVL"
FT   gene            148749..149123
FT                   /locus_tag="Amet_0132"
FT   CDS_pept        148749..149123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0132"
FT                   /product="regulatory protein GntR, HTH"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   swo:Swol_1621 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46371"
FT                   /db_xref="GOA:A6TJK3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK3"
FT                   /protein_id="ABR46371.1"
FT                   /translation="MEFNNSKPIYLQIIDYIKKQLIRGELKGGDKISSQREFAQQMKVN
FT                   PNTVQRAYREMESMQLVETIRGQGTFICNQEEMLAVIQEEMAGDLLRHFIEEMYSLGYS
FT                   KEAMVQLIEKWKTEVREEEK"
FT   gene            149120..149821
FT                   /locus_tag="Amet_0133"
FT   CDS_pept        149120..149821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0133"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mta:Moth_1174 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46372"
FT                   /db_xref="GOA:A6TJK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK4"
FT                   /protein_id="ABR46372.1"
FT                   /translation="MIEFKGVTKKFGSTIAVDNVTMTFPKGKIIGLLGPNGSGKSTTLK
FT                   MIASLNKPDQGEITIDGKSPSKETRETLAYLPEIDYLYPWMTIEGAGKFMKSFYDDWNE
FT                   EKFQSLMKFLNLEPQMIIKKISKGMRAKAKLLLVFSRNAKLVLLDEPLSGIDIFTRDQI
FT                   IDTIIQDYCEGEQTIILSTHEIHEVESLLDYVVFMHQGTILRQGEAEDLRSEENKSLVE
FT                   LMKEVYRNENI"
FT   gene            149808..150611
FT                   /locus_tag="Amet_0134"
FT   CDS_pept        149808..150611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46373"
FT                   /db_xref="GOA:A6TJK5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK5"
FT                   /protein_id="ABR46373.1"
FT                   /translation="MKTSRVGMIYSLYKKELVAAKNELLMIMTFILGANAFLFYKHQTG
FT                   WPVEASFIFSLFLLLFVVATTFFRAFSVVRNEWKENTVYLVMSLPITGVDVFLSKLLAL
FT                   LTQLIGLSIIALIGASLFIPIIPEVSYVLEQIQMEFTSVRLIWNALKIGLLGILGMNQA
FT                   IIFAFFSAVVGKLFKKFSGLITLITFIGISMINSKFIDWIGNFFIDQGMGERIESQLMG
FT                   LDVTMMTAMETMLNVYTLLFTIITVVTSAGVFFATAALYDRKVEL"
FT   gene            complement(150790..151818)
FT                   /locus_tag="Amet_0135"
FT   CDS_pept        complement(150790..151818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0135"
FT                   /product="SCP-like extracellular protein"
FT                   /note="PFAM: SCP-like extracellular protein; KEGG:
FT                   cth:Cthe_0779 copper amine oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46374"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR029410"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK6"
FT                   /protein_id="ABR46374.1"
FT                   /translation="MKFFLFLLCIVILSFGFLQFFDLPIEFSLDFIVEPQATPSEEPSF
FT                   PHAPGPEEIELAAPGEDFAFSYRGISLGTSLDKVHSILGAPHSILPSEYPFQWYIFHED
FT                   YQQYVQVGIANGHVVALYSNDAQWQNPWAFDFNTLSTTVESVLGNSLDRIQKDNIIYLL
FT                   PEDRHYLLFEVERFYLTVFFDIHNNNQVTSFLLIDQEIENKYHAPLDPDIALAEAYKEQ
FT                   VFYLTNAIRVRHDLPLLTWHEGAAVTALGHSKDMAVQNFFDHRNPQGEDPFDRMAAQGI
FT                   MYRRAGENIAAGQQNSIFAHEGWMNSLGHRQAILGDFNSLGVGVHLGGPLDAYYTQNFL
FT                   SQ"
FT   gene            152247..153278
FT                   /locus_tag="Amet_0136"
FT   CDS_pept        152247..153278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0136"
FT                   /product="3D domain protein"
FT                   /note="PFAM: protein of unknown function DUF348; 3D domain
FT                   protein; G5 domain protein; KEGG: tte:TTE0112 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46375"
FT                   /db_xref="GOA:A6TJK7"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK7"
FT                   /protein_id="ABR46375.1"
FT                   /translation="MESHQSSKRLLNSKVIIAAIVGSLLLILVGTISLHKTVVVAIEGQ
FT                   EIQVSTLASTVEGVLRKEGIEIGEADRTVPELNQRVKDGERIVIHRAYEIQLIESGNTQ
FT                   SIITAVETVKSLLQSLNIELQDMDIVEPPLGVSIGEGDTVKITRVTEELTAETQEIPYQ
FT                   TVIKHNNEMDYGKMNQLQEGKPGLQEVKIAIRYEDGEEVERSIIEEYVTTEAVNEIMER
FT                   GTANLIATSRGNSRYTKALTMTATAYDAGYESTGKRPGDQYYGVTRSGTQVRPGVVAVD
FT                   PNVIPLGTKLYIESTDGTGNYGYASAEDTGGAIKGNKIDLYYESRSEALRFGRRTVKVY
FT                   VLE"
FT   gene            153455..154009
FT                   /locus_tag="Amet_0137"
FT   CDS_pept        153455..154009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0137"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein;
FT                   KEGG: ctc:CTC00246 DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46376"
FT                   /db_xref="GOA:A6TJK8"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJK8"
FT                   /protein_id="ABR46376.1"
FT                   /translation="MIKEIIVVEGKDDVSAIKKAVEAETIITGGFSLPERVMKQIETAA
FT                   KRRGVIIFTDPDFAGDKIRKRIANRVPGCKHAFLPKEEAMKDGDIGIENATPKSICAAL
FT                   AKARSESMEKREVFTRVDLIGNGLMGDNQASYRRDEIGKTLGIGYGNAKQFLNRLNHYG
FT                   VTREEYIEALKNLDEVGMKNG"
FT   gene            154002..154865
FT                   /locus_tag="Amet_0138"
FT   CDS_pept        154002..154865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0138"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   btk:BT9727_0037 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46377"
FT                   /db_xref="GOA:A6TJK9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJK9"
FT                   /protein_id="ABR46377.1"
FT                   /translation="MDKIVSPSKTKAIVEKYKFRFSKSLGQNFLIDQNILEDIVDGADI
FT                   QPDDCVIEIGPGIGTLTQFIAEKAHKVVAIEIDRNLIPILKHTLADYQNVEVINQDVLK
FT                   VDLHQLIADKFEGKPVKVIANLPYYVTTPIVMRFLEEKVPVDSLVIMIQKEVAVRMQAG
FT                   PGTKDYGALSIAVQYYCNPEILLKVPPSVFIPQPKVESIVIKLQVYPEPKVKVERDDLM
FT                   FALVKDAFGKRRKTLLNALSSGLLQLSKEIVRESLEAANIDENRRGETLTIEEYATLTK
FT                   EVAARQ"
FT   gene            154949..156295
FT                   /locus_tag="Amet_0139"
FT   CDS_pept        154949..156295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC00249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46378"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL0"
FT                   /protein_id="ABR46378.1"
FT                   /translation="MSRRYKRYFVMLEGEDRGFELSKSQEPKGYGKIEVRNEQGTLSLH
FT                   CQNLKKVDPIGARYRWYLVNTRKTGEPIIVDIGPMEVDVNGKGELVWEFNGENVKGSNS
FT                   KIDGFNILALVVEEKGEKKEFSAPLVGYIDKEKTGWKDYLAKHLSVPAKKSFEPIKESK
FT                   RDSPKKDVALDPKEKPKPTLESKKEETKKLKPTLEPKEKPLDLKEKPLKKVPEKTPEKT
FT                   PEKAQEKPTPTLESKDPKEKGQSPQENPVKDQGPRAPQVKQETPKIKVEKKEAEAVPHP
FT                   KLKEEKEENIEAQKKNIESQNKGLQVYVESTLKGFPKADPFTKRFDDYQWWQIQYDQQT
FT                   MYRSAMPFIGYIEGQHHPYYYYYPSEYQRLIYTYQHYLFGMSYDGDQGVKYYVYGIPGS
FT                   KLPKDQPYRGSTGFTNWYSCNGDHTNPNTSGYWLLHIDAKTGEIATALK"
FT   gene            156612..157619
FT                   /locus_tag="Amet_0140"
FT   CDS_pept        156612..157619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0140"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: rfr:Rfer_1133 sodium/calcium exchanger membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46379"
FT                   /db_xref="GOA:A6TJL1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL1"
FT                   /protein_id="ABR46379.1"
FT                   /translation="MFNTYALFLFSAVLVIISGMKLSKYGDVIANNTSLGHGIVGGVLI
FT                   AAATSLPELVTSVSASLMGAPDIAIGNVYGSNIFNLMILAVADILHGQGRFLQTVKMNH
FT                   ILAGLFGVLLSALGALSILINQIGGLDLEIGWVSINSLIIFITYSLGSILIIRYENKLS
FT                   RMTPPKEIEEVAEVQDTSIKHAIIGFGLAAAIIIWAGMTLAQAGDQIAMVTGLGHTFVG
FT                   TLLIAGTTSLPELVATIAAIKIGAHDMAVGNVFGSNIFNMIIITVADLAYSPGSIFSDI
FT                   NIDHTITAMAGIVLSAIALIGLFYRTQRTILNIGWDSVFILVVYLTTVYLILIT"
FT   gene            complement(157638..158084)
FT                   /locus_tag="Amet_0141"
FT   CDS_pept        complement(157638..158084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0141"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: chy:CHY_0566
FT                   rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46380"
FT                   /db_xref="GOA:A6TJL2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL2"
FT                   /protein_id="ABR46380.1"
FT                   /translation="MRIFLIKKRNLYIAVGVIIALIIGAIFFTAVTRDRTVSSQHLKYA
FT                   YRNLLPEEANDLITNNPHVLILDVRSPEDYTQGHLHNALSVPYKELKGQLDEFAQENTY
FT                   LVYSQSGKESTKAAKLLSESGFPRVFTLVGGYHKWPYGITKVSQ"
FT   sig_peptide     complement(157986..158084)
FT                   /locus_tag="Amet_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.964 at
FT                   residue 33"
FT   gene            complement(158251..158700)
FT                   /locus_tag="Amet_0142"
FT   CDS_pept        complement(158251..158700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46381"
FT                   /db_xref="GOA:A6TJL3"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL3"
FT                   /protein_id="ABR46381.1"
FT                   /translation="MKGWTFYLSVFLIGFLMGLGIMNLFQMHTLDRLYRTQNQLTSQLL
FT                   DQELKLERLNENLKSQQVFVVKDLSIVVDFDGNPLVQDEIENNIRFYLSDLVGRELSRI
FT                   DGEMIYKIVQDRILHIGERQILLEMKYIIIEEKIQIGVKATVLDK"
FT   gene            complement(158697..159026)
FT                   /locus_tag="Amet_0143"
FT   CDS_pept        complement(158697..159026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46382"
FT                   /db_xref="GOA:A6TJL4"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL4"
FT                   /protein_id="ABR46382.1"
FT                   /translation="MLVFSQNMVYNFFIALGVMLGACLFGGVAATLNGHPPLKTMLDLG
FT                   DKIKIWAAVVALGGTFPSLKIIEIGIFNGEFRGLIKQMLYIVSALVGAHVAYKLMVYLE
FT                   GSGRL"
FT   sig_peptide     complement(158922..159026)
FT                   /locus_tag="Amet_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.394 at
FT                   residue 35"
FT   gene            159128..159556
FT                   /locus_tag="Amet_0144"
FT   CDS_pept        159128..159556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46383"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL5"
FT                   /protein_id="ABR46383.1"
FT                   /translation="MALLHKMYRKKGGISMPYHYDDYCGMPPQHMDLYEDRRRLMAMYP
FT                   DSYHRLYPRVQEICGRMDIPSNPRMYPYVDPTLLDEMVEEIYRQEISEVQSEQFTRGPF
FT                   RDLITILLIQQLLGRRGRRAPIRPPVRPPYRPPYGPWY"
FT   gene            complement(159718..160185)
FT                   /locus_tag="Amet_0145"
FT   CDS_pept        complement(159718..160185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46384"
FT                   /db_xref="InterPro:IPR021525"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL6"
FT                   /protein_id="ABR46384.1"
FT                   /translation="MYIIYYGTGTALTTSVAASIHLSDLTNPEAFQKELVRKINEFWLL
FT                   EQQSLGHLYYLGTDSLSHDVFLMNVAQSETIVLPGFKSVFEILQLRSTQYLLVDTTSFV
FT                   TVYNLLGFNLYKRNLFRKLGHRCLLKGIEKNLSKIFLLVENTKKQLENKDG"
FT   gene            160620..162173
FT                   /locus_tag="Amet_0146"
FT   CDS_pept        160620..162173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0146"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier; AbgT
FT                   putative transporter; short chain fatty acid transporter;
FT                   KEGG: ctc:CTC01323 aminobenzoyl-glutamate transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46385"
FT                   /db_xref="GOA:A6TJL7"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL7"
FT                   /protein_id="ABR46385.1"
FT                   /translation="MSAKIQSSNKKGLFTKFLDVIEVVGNKLPHPVTLFAIFSLAVVII
FT                   SAMAAAAGTTVDFDRVDMATGETELTTVVAISLLTAEGIRRIFSEAVTNFTGFAPLGTV
FT                   LVAMLGVGVAEGTGLVQAALRKLVLATPKKLITAVVIFAGIMSNVASDAGYVVLVPLGA
FT                   LIFLSFGRHPLAGLAAAFAGVSGGFSANLIVGTIDPLLGGISQQAAQMYSPGYTVDPTA
FT                   NWYFMIVSTFVITIIGTIITEKIVEPRLGAYTGGEKASIEKVSDHETKGLKWAGISLLG
FT                   LLLVMLALTLPANAVLRSDSGSLMSGSAFMAGLVPIIALFFLVPGIAYGMAAGTVKSDK
FT                   DIAGFMGKAMSTMGGYLVLAFVASQFVAYFNWSNLGTILAVKGADVLQATGMTGIPMLI
FT                   GFILVSGFINLFIGSASAKWAIMAPIFVPMLMRLGYSPEFTQIAYRIGDSTTNIISPLM
FT                   SYFAVIIAFAQKYDKKTGIGTLISTMIPYSLVFLAAWIILFVAWFALGLPLGPGAYIRL
FT                   "
FT   sig_peptide     160620..160775
FT                   /locus_tag="Amet_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.719 at
FT                   residue 52"
FT   gene            162673..164226
FT                   /locus_tag="Amet_0147"
FT   CDS_pept        162673..164226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0147"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier; AbgT
FT                   putative transporter; KEGG: ctc:CTC01323
FT                   aminobenzoyl-glutamate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46386"
FT                   /db_xref="GOA:A6TJL8"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL8"
FT                   /protein_id="ABR46386.1"
FT                   /translation="MSVKTQDVKKGGLFNKFLDVVERVGNKLPHPVTLFVIFSLAVIII
FT                   SALAAGSEVSVNFDRINMETGETEASTVAAVSLLTVEGIRRIFSEAVTNFTGFAPLGTV
FT                   LVAMLGVGVAEGTGLVQAALRKLVLSTPKRLITAVVVFAGIMSNVASDAGYVVLVPLGA
FT                   LIFLSFGRHPLAGLAAAFAGVSGGFSANLMISTLDPLLGGLSQAAAQMYQPGYTVDPTA
FT                   NWFFMIASTFIITLVGTVVTERIVEPRLGAYEGESDGAIQGIGTHEAKGLKWAGFSLLG
FT                   FFLIMLALTLPSNAVLRSDAGTLLSGSAFMGGLVPIIAMAFLIPGVFYGIASGTVKNDK
FT                   DVAGFMGKAMSSMGGYLVLAFVASQFVAYFGWSNLGTILAVKGADVLEATGMTGIPMLI
FT                   GFILVAGFINLFIGSASAKWAIMAPVFVPMLMRVGYTPEFTQLAYRIGDSTTNIITPLM
FT                   SYFAVIIAFAQKYDKKTGIGTLISTMIPYSLMFLAAWIILFVIWFAFGLPLGPGAYIRM
FT                   "
FT   gene            164401..165516
FT                   /locus_tag="Amet_0148"
FT   CDS_pept        164401..165516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0148"
FT                   /product="peptidase T-like protein"
FT                   /note="TIGRFAM: peptidase T-like protein; PFAM: peptidase
FT                   M20; peptidase M42 family protein; peptidase dimerisation
FT                   domain protein; KEGG: cpe:CPE2463 probable peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46387"
FT                   /db_xref="GOA:A6TJL9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJL9"
FT                   /protein_id="ABR46387.1"
FT                   /translation="MVNQDRLVNEFLELIQIDSLSSKEGQVAKVLIQKLKDLGLEVTVD
FT                   NAGEKIGGETGNVIARKKGTKSGKTILFSCHMDTVTPGEGIKPIIKEGVIYSDGTTILG
FT                   GDNKAGIAAVLEGLRIIKENNIEHGDIEVVFSIWEEGGLFGAKNLDYSLLKADYGFVLD
FT                   SGGSPGEIIITGPAQDKVNATIKGKSAHAGVAPEEGVSAIMIAARAINNMNLLRIDEET
FT                   TANVGVISGGTATNIVTPEVQVKAESRSINEAKLDAQTKHMMEVFQKAAEELGGSVELD
FT                   IERMYPPFNIGEDEEIVIKVKEVFTALGIESYTKATGGGSDTNILNGNGIKSVNLGIGE
FT                   KKPHTLEEHLHIVDLVNSARMVSQIIQTFAN"
FT   gene            165739..167214
FT                   /locus_tag="Amet_0149"
FT   CDS_pept        165739..167214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0149"
FT                   /product="Orn/Lys/Arg decarboxylase, major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   cth:Cthe_1918 Orn/Lys/Arg decarboxylase, major region"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46388"
FT                   /db_xref="GOA:A6TJM0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJM0"
FT                   /protein_id="ABR46388.1"
FT                   /translation="MSYYLNQNQTPLFTALKEHSQKKVIPFDVPGHKQGRGLKEFTDFV
FT                   GTTVMELDVNSMKSVDNICNPIGVIKEAKELAAYAFGSDHAYFLVNGTTSGVQAMIMSA
FT                   CEPGDKIILPRNAHKSAIAGLILAGALPIYIQPEIDENLGIAMGVSVESVVNIIGRHPD
FT                   AKAIFLINPTYYGATSDIKEIIHIARRNGIAVLVDEAHGAHLNFHEGFPMSAMELGADM
FT                   SAVSTHKTGGSLTQSSILLLKEGAIDPYTVKKNLNLMQTTSGSYLLMASIDVARKQLAT
FT                   EGEEIFTRVLKLVRNARAQINKVDGLYAFGTELVGNPGVYDFDESKLGVNVRKLGLTGF
FT                   EVYDILIDEYNIQVELADYYNILAIVSVGDEEEQVTALVEALKDIAEKHRRPEEIKVIS
FT                   NVLKNPDAIVSPRDAYYSSKKVVNIEDAEGEISGESIMAYPPGIPIVSPGERITKDMID
FT                   HIKLLKEEETLIQGTEDPYAEQVRVLGQGNGKG"
FT   gene            167466..167788
FT                   /pseudo
FT                   /locus_tag="Amet_0150"
FT   gene            167814..168044
FT                   /pseudo
FT                   /locus_tag="Amet_0151"
FT   gene            168266..169228
FT                   /locus_tag="Amet_0152"
FT   CDS_pept        168266..169228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0152"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   tte:TTE0026 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46389"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJM1"
FT                   /protein_id="ABR46389.1"
FT                   /translation="MKVFLKVFAISFIIFVLVFSVGVMAFNTLMKEDSADFDEVVARVE
FT                   EDDHYDKDVEEIDELLRLVQESNRINFIVLGLDDTRSDMMMFVSFDPDEKRMDGISIPR
FT                   DTYYPRQGYTGPGKKKINAAHGDHGANGVKTVVTDILFDVPVDYYITMTYQGVGAIVNS
FT                   LGGVPVHISKPMIYDDPYDNPPLHINFAAGNHVLKGPDAVKFLRYRQPNPGSGALDRHG
FT                   DIGRIDAQQEFIQSAISKAMGPRLPSVAGQAFRHVRTDIDLQDVMRLATAAVGMDMANV
FT                   QIATLPGEASYQGGVSYYFHDPEATRDRLMEIYKGSTEE"
FT   sig_peptide     168266..168343
FT                   /locus_tag="Amet_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(169403..170785)
FT                   /locus_tag="Amet_0153"
FT   CDS_pept        complement(169403..170785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0153"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein; KEGG: tte:TTE2575
FT                   UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46390"
FT                   /db_xref="GOA:A6TJM2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJM2"
FT                   /protein_id="ABR46390.1"
FT                   /translation="MIAFNMDEHQLKHIHLIGIGGISMSAIAEILLENGYHISGSDMKE
FT                   SNLTHKLRDHGAEIFIGHASENIQNPDLVVYTAAVKADNPERIRAEELGIPLADRAEML
FT                   GQIMKKYEKAIAVAGSHGKTTTTSLISLLMEYSNLDPTILVGGELDEIGGNIKIGQSQH
FT                   FITEACEYVESFLKFYPFIGIILNIDEDHLDYFKDIEHIKSAFKKFAQRIPKEGFLIAS
FT                   YDDAHVREISRDLDCHVITYGIKTKSQFMAHNIEFSFEGLPSFDVSFEGKTIGSFSLNI
FT                   PGLHNVYNSLAAIATTYVLGVDPVAISKHITRFKGIHRRFDLLGEVKGAKVIDDYAHHP
FT                   VEIRATLEAAKKYPHKKIWCVFQPHTYSRTQALLKDFAKSFYLADHVIITDIYAAREKD
FT                   EGIVNSQGLVNLIVQEHPAQYIGGFEEISRYLYDHIEAGDIVLTMGAGDVYLIAQMLLA
FT                   EK"
FT   gene            171020..171841
FT                   /locus_tag="Amet_0154"
FT   CDS_pept        171020..171841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0154"
FT                   /product="purine operon repressor, PurR"
FT                   /note="TIGRFAM: pur operon repressor; PFAM:
FT                   phosphoribosyltransferase; purine repressor-like; KEGG:
FT                   tte:TTE2574 purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46391"
FT                   /db_xref="GOA:A6TJM3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJM3"
FT                   /protein_id="ABR46391.1"
FT                   /translation="MTKLKRNERIAAMVKILGDHPNHIFTLNYFTEKFNAAKSTISEDI
FT                   VVVKGAMEKMDLGKIKTISGAAGGVKYIPITGAKKSQQILQNICEKMNSSHRILPGGFL
FT                   YMTDIIYHPQTIHNLGELFATQFNYENVDAIITVETKGIPLALMVAKAMNLPLVILRRD
FT                   NKVTEGSTVSINYISGSSDKISRMSLSRRALKPGARVIIIDDFMKAGGTAKGMIDMMKE
FT                   FEVEVEGIGVLIATKEPRKKLVDEYVPLLILEDIGESQGKIDVVPNPIIIE"
FT   gene            171978..172274
FT                   /locus_tag="Amet_0155"
FT   CDS_pept        171978..172274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0155"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: cac:CAC3223 stage
FT                   V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46392"
FT                   /db_xref="GOA:A6TJM4"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJM4"
FT                   /protein_id="ABR46392.1"
FT                   /translation="MKVTDVRIRKVAAEGKMKAIVSVTFDEEFVVHDIKIIEGQNGLFI
FT                   AMPSRKMGEGDFRDIAHPINSDTRSKIQDAIFAEYAIMNEEVQVQVQVTEEAL"
FT   gene            172516..173886
FT                   /locus_tag="Amet_0156"
FT   CDS_pept        172516..173886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0156"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: cpe:CPE2490
FT                   glucosamine-1-phosphate N-acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46393"
FT                   /db_xref="GOA:A6TJM5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJM5"
FT                   /protein_id="ABR46393.1"
FT                   /translation="MKLKAIILAAGTGTRMKSKMPKVLHKVCGQTMLGHVIDVSKDSKA
FT                   EECIVVVGHGAEEVQKTLPEGVKTVLQAEQLGTGHAVMVAEEHIETQGTVLVLYGDGPL
FT                   ITEETLNALMTYHQEGKYSATVLTAELENPTGYGRIIRDDDDRLKTIVEEKDTTVGEKE
FT                   VREINSGIYCFDSKVLKETLPKIQNNNSQKEYYLTDALTIIKQEGLKVGVYQIENYEDI
FT                   MAVNSREQLAEVEEVMQRRIVKKHMEAGVTFIDPQSTYIEKTVKVGMDTILHPGVILKG
FT                   ATEIGEDCIIGHNSRIENSILKNGIEVQSSTIIESTIDDHATIGPYAYLRPQSHIGKHV
FT                   KVGDFVEVKNATIDDHSKAAHLAYIGDAEIGKHVNIGCGVIFVNYDGIKKHKTIIKDHA
FT                   FVGSNSNLVAPITIQESAFVASGSTITREVPAGALAVGRSRQENKEGWVARKGVGKK"
FT   gene            173936..174883
FT                   /locus_tag="Amet_0157"
FT   CDS_pept        173936..174883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0157"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; KEGG: cno:NT01CX_1015
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46394"
FT                   /db_xref="GOA:A6TJM6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJM6"
FT                   /protein_id="ABR46394.1"
FT                   /translation="MNTSGSGIKIFCGNSNTELASKIAEILGGEIGEAEVSTFSDGEIS
FT                   VNILETVRGADVFVVQSTNPPVNDNLMELLIMIDAFKRASAGRITAVLPYYGYARQDRK
FT                   AKARDPITAKLVADILTTAGADRVLTMDLHAAQIQGYFNIPVDHLLGVPILAKYFKEKN
FT                   LKDVVVVSPDLGSVTRARNLANHLDAPIAIIDKRRPKANVAEIMNIIGEIEGKNVILID
FT                   DMIDTAGTITQGANALKEFGAKDVYACCTHPVLSGPAMERIENSVIKELIITDTIPLPP
FT                   EKHSDKIKIMTVAPVFAEAIRRIYNNVSVSKLFD"
FT   gene            174900..175457
FT                   /locus_tag="Amet_0158"
FT   CDS_pept        174900..175457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0158"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: cth:Cthe_2631
FT                   aminoacyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46395"
FT                   /db_xref="GOA:A6TJM7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJM7"
FT                   /protein_id="ABR46395.1"
FT                   /translation="MYIIVGLGNPGKKYSGTRHNVGFDVIDLLAHRLGITVNKLKHKAL
FT                   YGEARIGGEKVILAKPQTFMNLSGESIREMMQFYKIDPENLIVIYDDIDVKVGSLRIRQ
FT                   SGSAGTHNGMKSTIYQLQTDAFPRIRIGVGRPEFGDLSNYVLGSFTKDEIPLMKESLER
FT                   ATLTVESIVIDGIDKAMNRYNG"
FT   gene            175575..175955
FT                   /locus_tag="Amet_0159"
FT   CDS_pept        175575..175955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46396"
FT                   /db_xref="GOA:A6TJM8"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJM8"
FT                   /protein_id="ABR46396.1"
FT                   /translation="MGIIAGIIAALLAYLLNKWALKGVGERGLIALVPFIEEAAKSGVA
FT                   FLLKTSFIQAHFVFGCVEGVYDMMTSSKKIGKWAALASILSHSFFGGITYFVYTQTQAL
FT                   LLSIMAAWIFHSGWNWYITKYL"
FT   gene            176043..179567
FT                   /locus_tag="Amet_0160"
FT   CDS_pept        176043..179567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0160"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   helicase domain protein; transcription factor CarD; TRCF
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: tte:TTE2565
FT                   Transcription-repair coupling factor - superfamily II
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46397"
FT                   /db_xref="GOA:A6TJM9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJM9"
FT                   /protein_id="ABR46397.1"
FT                   /translation="MDKKMLLSPLRQSLEYHQLLDRVNLEKTPVAIHGLNDSQKGHMSY
FT                   GLFDDSNEQVCILTYSEVEARKIEQDLKFYIGDRGLFFPSREVIFYDLKAQTDHAQQER
FT                   METLQKIATGEKHVVVASIESLLLKLIPPALYKKDQISFKVGESIDLEKVTETFVKQGY
FT                   ERVEQVEGNGQFSIRGGIIDIYSGGEISPYRIELFDDEVDSIRQFQVDTQRSTQKVQEL
FT                   LIYPVAETIIEPSAVESVIQAIEAEGAALSKKLKGGPKERLAEKVAEVSNKFREFGHFN
FT                   GVEQYAPYLYEQEASLLDYLNPNALVIIDEPQRCKERVRGYEGEFKENFKTLLERGEVL
FT                   PTQGNLLLAYDKLVKSVLERRVITLSLLPKNTPDFPPKEIINFMARPVQSFHGKINLLI
FT                   DELKSLQYKGYKIVLLPGTKERALRLLELLRERGIPVEFVVSHKEEIVSGQIFIMQGSI
FT                   NRGFEYSSMKYMTITDYEIYGVHKRKKKERRRKDAVSIKSFVDLQVGDHVVHEGHGIGK
FT                   YIGIEELSVEGIKKDYIKIRYSGEDHLYVPTDQMNLIQKYIGSDKGSPKLNKLGGVEWV
FT                   KTKGKVKKAIEDMAEELLKLYAERRRNKGHAFGNDGEWQKQFEDLFPYEETPDQLKSIE
FT                   EVKADMEQEGAMDRLLCGDVGYGKTEVAIRAGFKAVMDSKQVAFLVPTTILAQQHFNNF
FT                   KQRFSGFPVTVEMLSRFKTPAQQKQVLEGVRTGNVDVLIGTHRLLSKDIEFKDLGLLIV
FT                   DEEQRFGVKHKERMKQMKESIDVLTLTATPIPRTLHMSMVGIRDMSVIEDPPEERFPVQ
FT                   TYVIPYNESMIIDAITKEMARGGQTYYVYNRVDGIHQVARKLQELIPEARVAVGHGQMG
FT                   ERELEMLMMDYLDGVYDVLVCTTIIETGLDISNVNTIMIHDADKLGLSQLYQLRGRVGR
FT                   SSQQGYAYLMYQRDKILSEVAEKRLKAIKEFTEFGSGFKIAMRDLEIRGAGNLLGSQQH
FT                   GHMASIGYDLYIKLLEETMAEMKGEVVEKYEDTNMELNVNAYIPERFIGSSTHKIEIYK
FT                   KIASIRNQEDLYAIEEEIEDRFGDIPMSVRNLLMISYIKALGNQIRVQTITQKEKEIRI
FT                   QFTRSQKLKPENIGSVLHQYPRKVSFHGSDQPYLIYQIRTADQYKLLTEIKEVIEKISG
FT                   FHNEADSV"
FT   gene            179607..180566
FT                   /locus_tag="Amet_0161"
FT   CDS_pept        179607..180566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0161"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: tte:TTE2564 parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46398"
FT                   /db_xref="GOA:A6TJN0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN0"
FT                   /protein_id="ABR46398.1"
FT                   /translation="MKKIKNKSIGLLTALLAIMLLITACSTPAQLSQDAAAEVNGATVS
FT                   MEEFDKTLALFKLSYEMQYGYNEDIFQQDIGGMTLLENIKEGIMEKLISDVLIAEKAVE
FT                   SGLTVSEEEITEAYEPYRVYEESDENFSAFLKENEIDETFIREQVKKDILLFKYRDFYN
FT                   ENLEMTEEAARKFFDENPEMFSTQEASARHILVADLALADELVVRLESGEDFATLAQEY
FT                   STDPGSAVQGGDLGFFPRGVMVPEFEEASFTQPIGEVGAPVQTQHGYHIILVEDRVDNS
FT                   YDFDEMKESIMGYLKNLEFEKHLEELVGNAEVQKRESL"
FT   sig_peptide     179607..179702
FT                   /locus_tag="Amet_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.594 at
FT                   residue 32"
FT   gene            180682..181233
FT                   /locus_tag="Amet_0162"
FT   CDS_pept        180682..181233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0162"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   Sporulation stage V, protein T; PFAM: SpoVT/AbrB domain
FT                   protein; KEGG: mta:Moth_0083 transcriptional regulator,
FT                   AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46399"
FT                   /db_xref="GOA:A6TJN1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN1"
FT                   /protein_id="ABR46399.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFTDREGEVI
FT                   LKKYSPIGELSEFATEYAESLHEALGHIAMVTDRDTVVSVAGGSKKEYLEKRVSKSLEK
FT                   AMEEREVSVLNKGDKLHPLVIDEGEEPRFLAQVIAPIVTHGDPIGSVILCSKDQNITMG
FT                   EMEAKIAETAAAFLSKQMEQ"
FT   gene            181462..183060
FT                   /locus_tag="Amet_0163"
FT   CDS_pept        181462..183060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0163"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: swo:Swol_0081 stage V sporulation
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46400"
FT                   /db_xref="GOA:A6TJN2"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN2"
FT                   /protein_id="ABR46400.1"
FT                   /translation="MKKETFLKGAFILGMAGLVVKVLGAFFRIPLGIIIGSEGLGYYQV
FT                   GYPIFTLLLSFSTQGFPTAISKLVSEKRAKGNPGGAHKVFRTSFSILLGLGVIGSLTLG
FT                   FGAHYLVTKVVQSPNAYYAVLALAPALFFVPLLAAFRGYFQGMKNMAPTAISQVVEQAG
FT                   RVILGLTLAVVLLNRGVHYAAAGAAFGATIGGVFGLSVISIIYLRHKKRILAQFDRLPD
FT                   EQEEPTRGIIKDLVTIAVPITIGGAVMPLINIVDTMIVLRRLQAIGFTYEEANSLFGQL
FT                   TGMAATLVNLPQVLTVALAMSMVPVISESKTRGDYDTIRADTQSAMRVSIMIGLPAAIG
FT                   LAVLSGPIMQLLFPNEPASVGEILFFLSLAVLFLTQLQTLTGVLQGLGKPFIPVRNLMI
FT                   GAGTKLVVTYVLTGVPALNVRGAAIGTVVAYLVAAVLNFIDVKKYTGTKFDLYQTFVKP
FT                   IVAVIFMGVTVGVTYAQLSGIIGNSLATISAIGIGAVIYGGILLKTDAITQDDFDLLPG
FT                   GGKISKVLKKAGLMK"
FT   gene            183074..184534
FT                   /locus_tag="Amet_0164"
FT   CDS_pept        183074..184534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0164"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; MazG
FT                   nucleotide pyrophosphohydrolase; KEGG: cpr:CPR_2489 MazG
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46401"
FT                   /db_xref="GOA:A6TJN3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN3"
FT                   /protein_id="ABR46401.1"
FT                   /translation="MGKLIIVGLGPGGDEHITVAGLQAMKNHEHVYLRTERHPVVSYLK
FT                   TEGIRFKTFDAVYEEVESFQGVYDQITNQVLTMMEQGDVVYAVPGNPYVAETTVQQLIK
FT                   KCDELQLERKVYPAMSFVDAMFVALELDPVDGFQLVDGLQLEEQRPDPSRANIITQVYD
FT                   PFIASEVKLRLMDYYDDEQEIFVVKGAGIPGVQRIEQIPLYQLDRLDWIDYLTSVFIPR
FT                   IDSPQKKYYNMNNLIEIMERLRGKDGCPWDVEQTHESLKPYLIEEAYEVLETIDEKDDF
FT                   GLEEELGDLLLQVVFHAQVAHERGAFRIQDVIEGICQKLVFRHPHVFGEVEAEDSTTVL
FT                   KNWEALKKEEKQITSLSQSMKSIPKELPALMRAYKIQKKAKQVGFDWPDVREAVEKVHE
FT                   ELQELLEAKAEGEVEHIQEESGDLLFAVVNVLRFFKVDPEVALNKTNQKFVKRLHYIEE
FT                   AAKSQKLNLEDMTLEEMDILWEKAKKNE"
FT   gene            184646..184924
FT                   /locus_tag="Amet_0165"
FT   CDS_pept        184646..184924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0165"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: tte:TTE2453 Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46402"
FT                   /db_xref="GOA:A6TJN4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN4"
FT                   /protein_id="ABR46402.1"
FT                   /translation="MNKADLVAKMAEKSELTKKDAELALNSFMESVEEALVDGDKVQLV
FT                   GFGTFEVRERKPRQGRNPRNPEQVIEIPASKAPVFKAGKTLKEKINV"
FT   gene            184973..185221
FT                   /locus_tag="Amet_0166"
FT   CDS_pept        184973..185221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0166"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   cpf:CPF_2801 S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46403"
FT                   /db_xref="GOA:A6TJN5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN5"
FT                   /protein_id="ABR46403.1"
FT                   /translation="MRLDKYLKISRIIKRRTVAKEACEGGRVSINGKTAKPGTEVAVGD
FT                   EIEIRFGDKVLRAEVTRLAEHVKKDEAKEMFQIIENN"
FT   gene            185320..185640
FT                   /locus_tag="Amet_0167"
FT   CDS_pept        185320..185640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46404"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN6"
FT                   /protein_id="ABR46404.1"
FT                   /translation="MDEKVFSLLEKMYIEMQEMKSSMATKEEMQEIGSTMATKEEMQQG
FT                   FRKVNQDMARLEAKMDENHKALYDGYKQSIEGINAINERVDRLADKVDNQELKLQVVKS
FT                   AK"
FT   gene            185796..186791
FT                   /locus_tag="Amet_0168"
FT   CDS_pept        185796..186791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0168"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation D domain protein; KEGG: tte:TTE2451 sporulation
FT                   protein and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46405"
FT                   /db_xref="GOA:A6TJN7"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN7"
FT                   /protein_id="ABR46405.1"
FT                   /translation="MLKFRKISILFFVMILIVALIGCRAAERPEDDQTPDQAEEGEQPP
FT                   IPDEITRGEGEEPVLKVYIHETGEIREMSIEEYLIPVVAGEMTNDWPEEALAAQAILAR
FT                   TFVMEFITDKGGSKYEGAHVSTDIEEAQAWSEEEVNDLVTQAVETTRGQVMVYEGQYVK
FT                   SWFHAHAGMQTATAQEGLGFEAEEPPYIQVIESPDSQEAPEDDANWTETFTKAEIIAAA
FT                   QESGQEPGDFTAIEVAETGPSGRATQLQIGEATVAAPAFRIALDSTRMKSTKLESVQVE
FT                   GDQVTMSGTGYGHGVGMSQWGAYQMAQDGSSAEDIVNHYFKDVQIMKLWE"
FT   sig_peptide     185796..185873
FT                   /locus_tag="Amet_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.907 at
FT                   residue 26"
FT   gene            186860..187150
FT                   /locus_tag="Amet_0169"
FT   CDS_pept        186860..187150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0169"
FT                   /product="YabP family protein"
FT                   /note="PFAM: YabP family protein; KEGG: tte:TTE2450
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46406"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN8"
FT                   /protein_id="ABR46406.1"
FT                   /translation="MEERKKTNHRGHSLILENREKLSISGVEHVNSFNSELIVVETIDG
FT                   VLTLKGEDLDVSKLSLDDGNASIQGRIYSMIYSDRSSLGTKGSGLLSKMFK"
FT   gene            187283..187792
FT                   /locus_tag="Amet_0170"
FT   CDS_pept        187283..187792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0170"
FT                   /product="Spore cortex biosynthesis protein YabQ"
FT                   /note="TIGRFAM: Spore cortex biosynthesis protein YabQ;
FT                   KEGG: tte:TTE2446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46407"
FT                   /db_xref="GOA:A6TJN9"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJN9"
FT                   /protein_id="ABR46407.1"
FT                   /translation="MMYSISQEAYILLATIYGGILIGFIYDLYRIFRGVFKPSKKATVI
FT                   QDLLFWTMIFFVSFYVLIFSNQGALRFYNFLGFVIGAVGYQLLLSNLVLRALVFIIRKL
FT                   QHFFKDLYQIAVYPFRLGKFMLAGPVTYCKNKGKPVYYKTKKLSRLPGRIKKGITKSVG
FT                   TYFKKK"
FT   gene            187819..188121
FT                   /locus_tag="Amet_0171"
FT   CDS_pept        187819..188121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0171"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46408"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP0"
FT                   /protein_id="ABR46408.1"
FT                   /translation="MKRKKKRFNKMKIYMLGIVVLVGGSVTTTLYDQQKEMRYLDQREA
FT                   ALHEEIERLSGDVQHLRTRLEDSGTDEYINGIAREQLKMVGEDEIIFIDLNRSKN"
FT   sig_peptide     187819..187911
FT                   /locus_tag="Amet_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.559 at
FT                   residue 31"
FT   gene            188282..188698
FT                   /locus_tag="Amet_0172"
FT   CDS_pept        188282..188698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0172"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   cth:Cthe_2662 RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46409"
FT                   /db_xref="GOA:A6TJP1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP1"
FT                   /protein_id="ABR46409.1"
FT                   /translation="MPVQVGTVVEGTVSGITNFGAFIDLGEGQTGLVHISEVADDYVKN
FT                   IRDYLKDDQKVKVKVLSIGKDGKISLSIKQTALPKKKSVKPAEVDFRKTESNYGVSFDD
FT                   KVSRFLKDSDEKMQSVKSKGKDGRKGNGYNSKRA"
FT   gene            189070..191472
FT                   /locus_tag="Amet_0173"
FT   CDS_pept        189070..191472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0173"
FT                   /product="Sporulation stage II, protein E"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: cth:Cthe_2681 serine phosphatase; TIGRFAM:
FT                   Sporulation stage II, protein E; PFAM: Stage II sporulation
FT                   E family protein; SMART: protein phosphatase 2C domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46410"
FT                   /db_xref="GOA:A6TJP2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP2"
FT                   /protein_id="ABR46410.1"
FT                   /translation="MADREKITPYIRATVELEGLQSITKSRFSIPYLSKKIVILHLIGF
FT                   LLGRASILEGLTPFGIAFFAALIVKESKGATVGLSTLIGIITIQGISGSVHYGVTLAII
FT                   TGLFYFVLNGKKLSTIQVALISSGIYLGIGSLAFTFQDFYVYDLAMLSFETIVVFVVIY
FT                   IASYALPVGLHRSNRKILSTEEIICVTIIAALALSGVNDIMIMSLSLKNILGILLTILF
FT                   AYNGGAGVGAAVGVTLGLITSMSTGSTPVVIGVFAFSGLLAGIFKDLGKTGSALGFLMG
FT                   NAILTFYINGYYEVLIQFREVMGAFILFILMPKEWIAQLEKFCNTKNGILNTSRSHSER
FT                   MKKITNERLLDFSSTFAELSATFESIAEKQQIFAQEDLSKLMERAVNKVCGDCGMKRSC
FT                   WEKNFNTTYQAMNDLLIQIETTEELDPKDLPSGLQKRCIYPKQILENMIHVYEINQVNM
FT                   LWQNRLRESRDLVGEQMKGVSKIIGELAQELNGSIKFDVELEDAIYVALDQHGLAVKNI
FT                   MVANDEGGNLEITVEKRPCYNRESCTQSFIPVISQVVGTKLVKQPKNCNLKNAQEGCRF
FT                   TLVEARKFDASTKVARAKKEGNTLCGDSYTFMDLRNNQYMMAISDGMGTGDKAYIQSNA
FT                   TISMLEKMMEAGFEREIAINTINSMLMLKSTEEMFSTIDLALLDLYKGTVDFVKVGSAA
FT                   TFIKERGGKIKEINSSTLPIGILSGIQVEGNVKELKDDEFIIMVSDGILEIDEAGDGKW
FT                   LRRFLANIDTRNPQELADKILYRAMEFTNNKALDDMTVMVTKVWKTK"
FT   gene            complement(191711..192133)
FT                   /locus_tag="Amet_0174"
FT   CDS_pept        complement(191711..192133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0174"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   tte:TTE2174 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46411"
FT                   /db_xref="GOA:A6TJP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP3"
FT                   /protein_id="ABR46411.1"
FT                   /translation="MNSIGERIRFSRKANHLTLTDVNKLTGLSIGNLSELENNKFMPST
FT                   NALLAFKKLFQVSIDWLLTGKYSNEMTTNPQIEVSDITYESGPVSFYSLSSDEQRLIES
FT                   YQGLSVEDQRAIWGFISVASKKYAKDKTSPLPKQQK"
FT   gene            192289..192516
FT                   /locus_tag="Amet_0175"
FT   CDS_pept        192289..192516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0175"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   tte:TTE2173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46412"
FT                   /db_xref="GOA:A6TJP4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP4"
FT                   /protein_id="ABR46412.1"
FT                   /translation="MRRGMVKRRLTRLGSAVHGRLVQLNMTQRELAKEIGTSEVYLSMI
FT                   LRGRRSGNKYRMKIVEQLDLDETFTDTNNH"
FT   gene            192553..192720
FT                   /locus_tag="Amet_0176"
FT   CDS_pept        192553..192720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46413"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP5"
FT                   /protein_id="ABR46413.1"
FT                   /translation="MAFYNEVAELKKRVKELASQVEEGKAEEQLKKVQAHSQEVDQILK
FT                   EYMMKNKANG"
FT   gene            193020..194423
FT                   /locus_tag="Amet_0177"
FT   CDS_pept        193020..194423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0177"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; Peptidoglycan-binding domain 1
FT                   protein; peptidase S41; KEGG: cth:Cthe_1930
FT                   carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46414"
FT                   /db_xref="GOA:A6TJP6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP6"
FT                   /protein_id="ABR46414.1"
FT                   /translation="MKNIIKLMKMKKPTIVLVFLIALLTTSAVYAQPASDYEMELIRHY
FT                   IRGSYVEPIDLDEITGQTPEEMFSGLDDYSTYFPKEDLEMFLEDVRGEFAGIGVYITEQ
FT                   MGKVIIAEPIENSPAQRAGIQPGDEILSVDGEDVKGRPLDVVAAMVKGPEGTQVKIEVK
FT                   RQGQEDTIIFSMDRAFITVNPVAHQVIEDIGYIEIKSFNEHMTENIEKVLMGFKEQNVD
FT                   KLIIDLRNNPGGSLDEAVKLSRLLLPKGPIVHIQYRDHQTTVVSYLEEPPFENMVVLIN
FT                   EASASASEIFAVAAKESGIATLIGKTTFGKGSVQRVYTLPTGTGFKLTEARYLSPEENE
FT                   IDNVGVAPHIEVERFVPDVLTVDFLPLKMTRKPQIGDEGSDVEGAQQRLKAMGYTIKDP
FT                   QGVMGESTYQAIYQFQEDAGLYPYGILDFSTQGALDRLFNQWIQGPDQDEQLKHAVRHF
FT                   SGYSMFVVK"
FT   sig_peptide     193020..193115
FT                   /locus_tag="Amet_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(194513..195079)
FT                   /locus_tag="Amet_0178"
FT   CDS_pept        complement(194513..195079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0178"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: cth:Cthe_2384
FT                   S-layer-like domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46415"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP7"
FT                   /protein_id="ABR46415.1"
FT                   /translation="MKKKLTLVLVLILFLHVGLVSATASPLEQKAGDTLRGLGIYSGYE
FT                   DGTLRLGNSITRAEFTTLAVKIVGLSHQHESRMGKTPFSDVPSDFWGSGYINIAVDESL
FT                   MSGYPNQTFRPEGNITYAETLSVLVSLLGYKDDAVKLGQWPENYLQQAEGLNLTKNISH
FT                   DANHVVTRGDVAVLIHNALSVQLKK"
FT   sig_peptide     complement(195011..195079)
FT                   /locus_tag="Amet_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.667 at
FT                   residue 23"
FT   gene            complement(195233..197347)
FT                   /locus_tag="Amet_0179"
FT   CDS_pept        complement(195233..197347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46416"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP8"
FT                   /protein_id="ABR46416.1"
FT                   /translation="MRIQRIIFILLLCILLLSSSASALPSGYSRSIVGEFHDMDITINN
FT                   DFIRLEEDPFFYSGLLYVPLESLSTYLPMEIDYNQGSGYIDLLTGGFTNYRTEEEYSVT
FT                   LLQRNYLLAKLNQEQKQLETQLNNREFTPHQRITTLAEMEDYLQDRYDQLLEIPMTIRL
FT                   RRGTGDYYRLQITFPYEDRQDFREVAKRRIEYWVEDMLYSVRDLHDPYAQVEGWIRDDR
FT                   SDYTIDHTSYVDFESSQRWIDFDFIYDDSRVRRLHLHEAAYADEKKQGSSEKSIRHQPL
FT                   AIWVQNLEVRLDGQRLPLRGEVYQINNEIYLPLVDLADSFYFSFSYDETAHQLDIFNDN
FT                   FLWGDVPFQPNQLGQKQDSIDNVLKEIVSLEQELRRSRDRLYPHRQISSVTRMEAYLRD
FT                   YFSDYDGMELRIHFTEYRDHEYRLRIRISEEDSRLFDRNNHYILLDLVSDMWDVIQDLY
FT                   DPDAILVGSIRSSADDSDDSFYVFFESDEDYLDFDFADYDTSTTESVDAERLERELQRS
FT                   LRRYNRRSLEVTFRYEAISTRRDIDLNIYFTQSRFYEWELEDKMDYLFDLQREIESLYG
FT                   EIGVNGRIIDESRDETALRFSFEQGHIRSYDLLTEIEAYLNRHYSRFSFGGEVFSFDFS
FT                   LSERDLDAFDLRLAGDFAQQENSWRAVEESEGDEFHAFVQQAVSYIKRFWNVDVHPKVF
FT                   DRNLSTIDLL"
FT   sig_peptide     complement(197276..197347)
FT                   /locus_tag="Amet_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            197652..204251
FT                   /locus_tag="Amet_0180"
FT   CDS_pept        197652..204251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0180"
FT                   /product="Fibronectin, type III domain protein"
FT                   /note="PFAM: cell surface receptor IPT/TIG domain protein;
FT                   Fibronectin, type III domain protein; KEGG: tte:TTE0165
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46417"
FT                   /db_xref="GOA:A6TJP9"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR031148"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJP9"
FT                   /protein_id="ABR46417.1"
FT                   /translation="MKKESQEKRLYKNKYKKKINIRRIIALSMVFTMLFTMLGIETLMV
FT                   FAEEDPNPIINKISIFRSYSNIENPDTYYIDIEGNHLEDIEILIRRPDGEIEELDDYIY
FT                   RSRVYVQVKVDPDNIADAIRVSGIGWVEIGEDDMPAIGSFDPSSRRVKAGQTLSIGGES
FT                   FANIGEANQITARYSRGNTITPITDEAGNIDINNNEINISNISGSGFQTIRFKKDLEGQ
FT                   VLGGQEFDVEITHLYANIFQIYDDLSVSDDITIFPNQGVAGSRFTLEGESLLNTNNMSV
FT                   FFLRDLEAEHFTGENKARNINFIEGDDGAKDRFIAEVPEDISVGEYYIVLTNHVADGED
FT                   AQEVVSREKVIEDKFLVIQDTNLGRITSVDPNKGPDSGVNNVTIEGRYIGSISPNIFSP
FT                   AEGVEATKTFGARSLQLTYGDGTTAIGEYNQIGGDDLEVVKLERTLRAVIGNEITFRPE
FT                   TSTNPHGQDRIRVNIPTYDLVEEDTPVDITFMIETEITYRESGVENTLTLTEEIIREDG
FT                   FTFQPSSYVPEIDVIIPERIEVEEGDGFYHLKEEEMLVAIYGENFMVTRFEHDGQTFTR
FT                   YPAILLGNEIILNRNEEDYDDENVPPASDEDRIKNASNTDLDMRIYNDDNQLVDGTEGN
FT                   ELGSKMVIRIPRDHEADLYRISPGRVGILQDVRMYNPIKDSSEYGNSITGAGKVRFVEV
FT                   EQGLRPRINNVNPDVVTTEGGEEIVIRGSNFRENVRVFLDGEEITNFDRSGAGDTITFM
FT                   APPGNPGETQLQVLNPEGGIATAPFRYVETYTDPVLLDFSPKEGSTDTLVVVKGENLLK
FT                   PDPTGTSTRDEEMKLIGTRVRLQGEDINNYNLDANRNINFIGYEALVDNKLLQRENDRG
FT                   NRVTLSDYYHSVVLKDENTGNFYTITYDNQRNIILSDGLSNAYIIESVHTEVNSRFITE
FT                   DGQELLLRSEGGQDFIDINGKTLGVYTPYRVDVNTGEITGNKVRVNHQGELMFRVPILP
FT                   GDGYYDVEIVNPDTNRDGRYGNDGFRYYSQPNTNPRIEEIIPNEGSVEGGYTIRITGSD
FT                   FLETATMKAGVHINGVEVPGGDIDISPAGDEITLRVPSYEGNLREDFGVNRLSVPVVVV
FT                   NPDGASDGIEDGFTYVVPTSNPEISSIRPGNGNASGGELVEIRGNDFRFYEPFDDENRD
FT                   GIWNVEEEFNDLNKNGRWDDFRHFTMNDVENYLLYLHYKEDIEGDIDSITPSYQWLGKD
FT                   KTSILETVDEALKDLSQEALDEIIEKGFDETIRPVMPRVTFGGRQAKIMGFGRGFIEVE
FT                   TPQHPEGNAPVLVVNNDAGMSPAHNFVYTSSDPTIEEIIPPRGSRLGGDRIDILGRDFD
FT                   RSTRRIYTGNTIENNSLVSEYTEDNNPLVRFTAIGNRELPFEHDNSGRLTGTNRATVVL
FT                   AGELTLRYDGSNRTVEVEIKDGDDFYKTTIEGYQGGLKYIPTSILKDEEDNPYIEENPD
FT                   EALSLRGDELISIEVDDNRFLVERGYARDTEYVNNRQIRVNTPAYFTVGNVPVFIINPD
FT                   GGKSEGSFEYLFPDSRPRIIEILRDGQEPQVREEEGETIKILRVIYSGGNMIHIYGEDF
FT                   RENTEVRIASIANIPSEDIEQDRVENPFNTGPEILDRLTFEMPNVGEETVGERHRVVVS
FT                   NRDGGSAYSDGLVPPIYIEFFRGESNPSVENIEPMEGPASGGTRVRIEGDDFREAMEGF
FT                   EDGALNVHFGEVSIDEDDINYIDYRTLEVVAPSSERAGTVDIRVENPDGTLAIYRNAFT
FT                   FISKPKIERTDPRGIFANDVEREVTIEGRMFQGGAMVVIGGSLVRSDDVTADMEVQGEG
FT                   IYDVDESGNNIEYSVVGGRQLPNVIVEDQYKMTLRFLEDTELDNHDLIIINPDGGISDP
FT                   YNDFDYEIPIPTKPLVLEAIPGFEGTVQLIWSDSDPGVLNAADHYEIYGRRSGDSQYSL
FT                   LSDTEAAQYLVRGLENGVRYDFMVRALNEYGSAIEFAEITVRTLSAREDDKAREKEEQL
FT                   EREQQQLDQEGKEEVINGTLVKTLGRDQIPVGQGAYVVDFSPAQYSSHDRFVVAIPVEV
FT                   LNTITRQVTITDGRGSFTFSPSAFYTREVIQIPRDEQKDATVRIIFEKVNGQAEQSLIG
FT                   AIPRTQRRASDIYGIDFELQTGRNTTALHRMLTQGRFNLNFDAYRYPNANGNGIFMAQY
FT                   DASQGQFTGLGNNNQVAVQYPGRYMLLSDR"
FT   sig_peptide     197652..197795
FT                   /locus_tag="Amet_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 48"
FT   gene            204333..207137
FT                   /locus_tag="Amet_0181"
FT   CDS_pept        204333..207137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0181"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: tte:TTE0166
FT                   S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46418"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ0"
FT                   /protein_id="ABR46418.1"
FT                   /translation="MGKMLQRRLAGCMGILVLFSLLLVPTYAIEGLSSHPVYEGVSDPI
FT                   ERYNETQFNDIDNHWAREAIQEAAAFALMSGVDNQRFQPDGILSYADALTVIVKAIGQE
FT                   GEAQQLGENQAPADVRNLSLLSTADHWIQGTIQVAIENGIVTPEEAGEISNLTPNQLET
FT                   IGEQIEDQLDNYNEGNYTAQELAAIEQQIRQKLEINSTWNQPTTRQQVGQWIARALKLD
FT                   PVYGDKMTKVRQFKDWENIDTEKVPFIEAMLQGNYMSGTSGTTFVPRGQLTRGQMAQII
FT                   TKAHDDMMDARGITKYTGDITAVETVQQDQQDVTLFTIRKQDQSHHVLSAVAGSHDFIV
FT                   KKDGTMGLSNRLRRGDVLRYYINEENKVLYGVVEPLQSREIEGFVELVNSESRQLMVTD
FT                   FADQRHVLQVAPNADITVNQRASSLNNILYGQEVVVTVKGNNVTKIEAFLEEDPDRHGY
FT                   IPPESRIKVGDILFIDENEVEIRVDNQREKYRIVNGTQVLRNDQRANLFEVKVGDRVIL
FT                   TFDDIYSPDISSIRVEDHERHIDGIYRGRLEQVNPRGNEIVLGSLVRYENGRWQSVRDT
FT                   QMKLRVDNGNLYQGPSQTDLTGLSRFRGSEVYVAVENSYGTPGVAKLLTKDGSTLYYDS
FT                   QISDVEFATNRMVVDGHSMGFHPGTIVVQNNRLVDVLNLDRGQTIHLAGDLNRGGRDAA
FT                   FVSIEGSSIIDDRIDSSRIVVYRGNIEDIGHYGVTIGRLGYQLNYLQLENHRWQEVGRR
FT                   EKFTLTEDSFIFDSELELEIDSSHFIDSRFIDPQDIEDDELRRRVEDDFYFDKSAYFVV
FT                   RERTYGDTVDREVLALNITPHVIYDRGSVQTEHSATASIEGVDLDQGQITLGNVRNWNG
FT                   LNNRWERSQGQQEIDIHKTVILLNDRPISQEEVYLLRSGAQAYLIKNKNVSTQDDAYIL
FT                   IVEQ"
FT   sig_peptide     204333..204419
FT                   /locus_tag="Amet_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.769 at
FT                   residue 29"
FT   gene            207154..208629
FT                   /locus_tag="Amet_0182"
FT   CDS_pept        207154..208629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0182"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: tte:TTE0167
FT                   S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46419"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ1"
FT                   /protein_id="ABR46419.1"
FT                   /translation="MKKTVMICFVLLLFMAASVQGFALQIPGYEGGIQNEMAYREVIFI
FT                   TGEPIVVEGTLNITDRGDRVSYIYRDLSNAARGVTMTRNVTIDKEIIENGSGQRQEIYS
FT                   VSRYRESIRVDGVRYELTEQNHPWSKSNIYHQKPGVTYFAGNWDGKKVYTINRNEGSVT
FT                   VQTTGNVVGYDHNWGTTETQTISHYIDYDRQVDEEDSIRWQGTVEVDVANNRTKSYHYE
FT                   PNTPSQISFRGGYLLTQRDESVLKYSYDLPRVDEEGFTLRGRNIGTESTSLNTNPMNQR
FT                   LTIPAMRDISGHWAERHVLLLASLEAVYPNSTDFGPNLPMSRGDFARAVAILMDIKQEE
FT                   PENIRRIRGQEPVEAPQTFNDVSQAHPNQSFIEAVYERGIMAGVGDNSFKPNESLTRAQ
FT                   AAVVLIKALGFENLAPIQQYSTGFRDDQHIPLWARNAVYLARELGLVSGSTDGYYYPNN
FT                   TLTKAEAAAMLTNFIDYLREDIRYDYRERILNY"
FT   sig_peptide     207154..207225
FT                   /locus_tag="Amet_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.549 at
FT                   residue 24"
FT   gene            208903..210507
FT                   /locus_tag="Amet_0183"
FT   CDS_pept        208903..210507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0183"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase; KEGG: cth:Cthe_1923 CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46420"
FT                   /db_xref="GOA:A6TJQ2"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ2"
FT                   /protein_id="ABR46420.1"
FT                   /translation="MATKYIFVTGGVVSSLGKGITAASLGQLLKSRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSKNSSVTSGKVYWSVITKER
FT                   KGEYLGGTVQVIPHITNEIKERIYRVSKEGNFDVVITEVGGTVGDIESLPFLEAIRQVK
FT                   YDVGQENVMYIHVTLVPYLGRAGELKTKPTQHSVKELRSIGIQPDVVVCRTEKALSNEM
FT                   KDKIGLFCNLDPGNVVQNIDADSLYEVPLLLKEEGLDTMTLRRLGLEAGEPQLEEWQEI
FT                   VRRDKNPQNSITIALVGKYVELRDAYLSVSEALTHAGIHNEAKVNIEWIHSGELAKDNV
FT                   GEKLGQAHGILVPGGFGDRGVEGKILALQYARENEVPLLGICLGMQLAVVEFARNILGL
FT                   AGAHSSELDPETPYPVIDLMPEQKDVEDMGGTMRLGLYPCKIYPKTKAKEAYGEDLIYE
FT                   RHRHRYEYNNEYRDQLIQAGLVISGISPDERLIEIVELKDHPWFVAAQFHPEFKSRPTR
FT                   PHPLFREFVRASVENKK"
FT   gene            211296..213587
FT                   /locus_tag="Amet_0184"
FT   CDS_pept        211296..213587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0184"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   mta:Moth_2343 copper amine oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46421"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ3"
FT                   /protein_id="ABR46421.1"
FT                   /translation="MKQNSYLIKALLKEAQPQKRIQITRRVLQVKRKLALLLALVMVIS
FT                   MIPMSAFAASGNTETIIRGGVPRVADDYDSEVRRGEFTSLNSIIIRQDNYSVDATNFQL
FT                   RIENGSWSGNAAYSVTDGVYGVDHDGEYSIASRTDRVLDIQLDRAITSGNDFEMPLYFK
FT                   ADGSGPVRVTVDPLDSGITGGTFTVANTAAGATITTIDDVITFSEVGSLDPIRIEETSM
FT                   GSLGEGTHRVRLRLPSNFEWTGSEPTVRFINGLNGKASDNVTRYDGQRDLEIEITIDEQ
FT                   SRTRGAILIEGAQIYATSAAREGDVEVRVSGGDVTSETFLVAKYSDFDVTVKADGEPAE
FT                   LISGRFESNFDDEAHELQTLVIEEEVRDALLNNRRTTVELPSWVKILGVDVDVSGGDSN
FT                   ITFHGVEDDNEDRIENVRSGLYIFEEEDRGSNDIEFTIDSDSSDETKVELTFYVSVQAS
FT                   REGDIEAVVSGRSGAEGTVVLGTARKAVDFEVVGAVTTLDIGTKGQPIPDMIISEIDAE
FT                   DILEGELIVNLSGGVTWDDYTVTVVDGDLEIDDVDDSNNQLILTFTNSDTSSVPSTIEI
FT                   TNAAINVDRTPADGAVNARIAGDAVRPNFSSANGATDEGYFDTGWVHSVKIADILAGGV
FT                   APGTDMPKVVLTIGSSTFTVDGNAEVAPAAPYIDAQNRTMLPLSIIGRTLGAEVDWNEA
FT                   SRTVLVTKGSDRVLFTIGSDAMVVNGMSIPMRSQAVITGDRTFIPLRDLGIALGVDVQW
FT                   DEATRTVTIN"
FT   sig_peptide     211296..211457
FT                   /locus_tag="Amet_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 54"
FT   gene            213738..214517
FT                   /locus_tag="Amet_0185"
FT   CDS_pept        213738..214517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rno:690765 hypothetical protein LOC690765"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46422"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ4"
FT                   /protein_id="ABR46422.1"
FT                   /translation="MKFKKCSLFVAGILIGGISMLGLTVYGDIANQVTAHLASHITFEF
FT                   DGVMKPVPRGYTTLSYEGRTYVPARFIAEGLGAEVVWDEADQNIIITGPEKEELKEPEE
FT                   QKPDLSEDEMTGEEEQEEEEQEEQEEEETRIIYDALPITYYDGDIRLRVQTIVIDDDQT
FT                   RVFVSLLNEGNVSIQLDQSATVITIDGKEYKQLDTRIVNPYVSAWYNDIRKDDNVDSLV
FT                   RMPVIPEDTEKLTIKFLVRENTLHAPQEKEVVFDIKL"
FT   sig_peptide     213738..213821
FT                   /locus_tag="Amet_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.917 at
FT                   residue 28"
FT   gene            214933..216078
FT                   /locus_tag="Amet_0186"
FT   CDS_pept        214933..216078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_0134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46423"
FT                   /db_xref="GOA:A6TJQ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ5"
FT                   /protein_id="ABR46423.1"
FT                   /translation="MKNYKNYVAAMTLGVLLASTGSGLTVYANTNTQQNTLNVEDQTEV
FT                   EGEEAFVLTYEEALEKALKQSYDQKSLMETIDQLEEIRKQAAQGVRFIPYGPQGDELAI
FT                   RSLFGLRSTEINLQMAKKQEVTLEDMLAFKVRTEYDDIVKKKKEIELQVKMIENVEKQL
FT                   QQLSRKAGVGTASNYEHQVQLNKYNEENQKKSALEQELDNLYLKLNTTMGIDRTERYDV
FT                   ALEKEVEWMEDVNVDTHAKRMRSQHPSVWSQEQQIRLNELDIQLHVFNSSDSPYEAKES
FT                   ELRKSQIELSSLKENIEQSVKSTYNQMKQLETQYETMKIMLEKAENDRDMAQLRYDVGM
FT                   GIALDVEMAEMPVTSIKNQMETLLISYEQVRMMFEKPWLVV"
FT   sig_peptide     214933..215019
FT                   /locus_tag="Amet_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            216408..217619
FT                   /locus_tag="Amet_0187"
FT   CDS_pept        216408..217619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0187"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dsy:DSY3360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46424"
FT                   /db_xref="GOA:A6TJQ6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ6"
FT                   /protein_id="ABR46424.1"
FT                   /translation="MTKKVIYFLLLTLLLTTVLVGCSGEEEATTILEEEAYVPVEVERA
FT                   ETKYIGNGVNLNGKIHANDEAMVLPKIPGRVTSVNVKLGDFVQKDSVLFTIDQKDVLRS
FT                   IEQAEQSVNLAQRSVEQAENAVETTKISFETTKENIENAEINLQRTKELFDAGAASRSQ
FT                   LEQAELAASRRPLETVENQIRQAEIGYQQALNQLSQAQIGYRQAQDALEDTVVRAPMSG
FT                   VISILNVVAGELAGGTQPLATIADINRVYFQVDVTENIVNMLGDGQEVVVNIPAALEGE
FT                   IIGTIDFISSTANPNTRLYTVKVNIDNQERKIRTGMSGSMDLDLDGRDNVLVINSRAVL
FT                   NQEGEDIVFVVEEDHAIERQVVLGMNTGAEVEIVEGLREGESVIVKGQQYVVDGERVKI
FT                   VGGE"
FT   sig_peptide     216408..216482
FT                   /locus_tag="Amet_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.318 at
FT                   residue 25"
FT   gene            217623..220772
FT                   /locus_tag="Amet_0188"
FT   CDS_pept        217623..220772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0188"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   dsy:DSY3359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46425"
FT                   /db_xref="GOA:A6TJQ7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ7"
FT                   /protein_id="ABR46425.1"
FT                   /translation="MSLSKIAVNKPVTTAMLMLVILLLGGISLARLPLDLMPDIEIPVV
FT                   IVTTSYSGVGPHEMENLVTRPIEDTVATVSDLEAVTSVSSQGSSMVMARFDFGTDMDFA
FT                   ALEMREKVDMARGRLPDGATSPMVMKLDPNAMPVVMLSLSNGADLFELQTLAEDTIQPR
FT                   LERISGVASVSIIGDYTNEIEIKVDQQQLNAYGIGIDQLTQVISASNMNMPGGTVERGA
FT                   EKLTIRTMGEFETVEEIGELPITLPSGSIIRLKDVAAVEVIQKEISTISRTNSQNGIGI
FT                   QIQKQSGTNTVQVANSIDREVEKLRAEHPEFELITIMNQAEYIQDSITSVAKNAVVGGL
FT                   LAVLVLYVFLRNIGSTLIIATALPISIIATFVLLYFNGITLNMMTLGGLALGVGMLVDN
FT                   AIVVLENIYRYRSEGHSRKDAAIEGAKEVSMAVSASTLTTIAVFMPIIFVGGITSILFG
FT                   EFAMTVALSLAASLLVALTLIPMLCSKILKVETAVVGKPTEGMKPKKKRRFPGFYEAFD
FT                   RGFEALEQTYKKALGWGLRHRKSTVLLAILIFVGSVSSVFFVGVEFMPSADQGEISINV
FT                   TLPTGSQLYETDDVLKQIEALIEPLEEIEITSTTVGGGGGLGGGLMGSSENQGSMTVML
FT                   LGLSERSRSDVEVADEIRDLAKDIAGAEISVSTADGMAMGGSPIEIKVKGDDLTVLEGI
FT                   TDDFRRSIRQVEGTRDVETSFTEGIPELQIHINKYEASTYGLTTAQVANAVRSFAFGNT
FT                   VSQFRESGDETDIVIRGEESIRQDLANLEQLSIQTPMGGTVPLNQVADIHITQGPTAIN
FT                   REDQQRLATVTSDISGRDLVSVTRDIEALLVEYEMPEGYLYEIGGENEQLEETFADLIL
FT                   AVVLAVVLVYMIMASQFESLMHPFTIIMSVPLAFSGGLLALFITGRTLNVTAFIGLLML
FT                   AGIVINNGIVLVDYINTLRSSGKERSEAIQIAGPVRLRPILMTTLTTTLAMVPLALGIG
FT                   EGAEMQAPMATTVIGGLLLSTVLTLLVTPVIYTLMDDFSAAVKRKLKGKDKTAISSQKL
FT                   G"
FT   sig_peptide     217623..217715
FT                   /locus_tag="Amet_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            220777..221364
FT                   /locus_tag="Amet_0189"
FT   CDS_pept        220777..221364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0189"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: swo:Swol_0177
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46426"
FT                   /db_xref="GOA:A6TJQ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ8"
FT                   /protein_id="ABR46426.1"
FT                   /translation="MVREMKEKKILILESALRVFRQYGFHESKISMIAEEAGIGKGTVY
FT                   EYFDSKKEIYEETIFYTADIYLQEVERIILENHSIRERLIAIAKHLGNFTEKNMGTVEN
FT                   LIRNSNILSQETKVGLLEIREKLYNALSKTFSQWEDKLEIRDDLNSKMITMIFLGMMKE
FT                   FYEDALIFNKEDQGEIEIEDMIDVLLEGISKK"
FT   gene            221516..223780
FT                   /locus_tag="Amet_0190"
FT   CDS_pept        221516..223780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0190"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG: cth:Cthe_0239
FT                   cellulosome enzyme, dockerin type I"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46427"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="InterPro:IPR026876"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJQ9"
FT                   /protein_id="ABR46427.1"
FT                   /translation="MQDKKRFFLLGIGLVILIVTILILLPGEQADELLVINEVMSSNGY
FT                   TVSDEEGDYADWIELYNGGEEPINLRGYFLSDDNTTVTKWQFPGVTIEPKAHLVVWASG
FT                   KDMATEAGQVHTNFSISSQGEPIFLTRPDGRTIVDAIEVMAIPRDVSYGRETDGDSQWV
FT                   FFDIPTPGRSNNQVAGHEELLRGPTFSHVGGFYTDEITLALTTDESSKIYYTLDGSEPD
FT                   ENALVYQGTITITPQMLEDHFPMQDIQQGDAPKAPLSFINTTAEDLSEEWGYDRYRWVA
FT                   PQGEQMMGAVVRARAYGEEGQASRIITHSYFVDENIYERFDLPVISISTDSKGLFSYEE
FT                   GIYIPGKVFYEWRNQNPTERVIGNTPANYNARTIEAERTAHIEFFEPNGVLGFSQGAGL
FT                   RIHGGFTRAWAQKSLRLYARRDYDQDNSFRYEVFPGATKAVNHEPLNEFRRLILRNSGN
FT                   DWSVTMFRDAFIQELVKDFNIDTQAHRPAIVFINGEYWGIHNIRERYDANYLETNYDVN
FT                   PEDVVLINTSGPVVEEGFPEDYEHFENMLRFLEENDIKEQSNYEYIKTLMDVENFIDYQ
FT                   IAGIYIANTDWLANNVRLWRLRTEEYQPGAPYGHDGRWRWMLYDVDFGFAFDNQEMVQH
FT                   NTLQWATTDQGEDRNAPQYTFLLRTLLQNEEFRNEFINRFEDHLKTTFQEEYVINLINE
FT                   MQSGIEKEMGYNIQRWPNFGSISVWNDNVEVMREFGRKRPAYMYEHLMRQFDLQEEVHV
FT                   N"
FT   sig_peptide     221516..221608
FT                   /locus_tag="Amet_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.748 at
FT                   residue 31"
FT   gene            223887..225806
FT                   /locus_tag="Amet_0191"
FT   CDS_pept        223887..225806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0191"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: sth:STH3168
FT                   S-layer associated protein, putataive"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46428"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR0"
FT                   /protein_id="ABR46428.1"
FT                   /translation="MKKNRKLIMIILTVVMVLATASAAYASSIAFDDINEVPWAKEHIQ
FT                   RMVDKNIISGYVDDSTLKLVFKPANPVTRLESMQLIYKTLQETGQLESSSNYASKYNSI
FT                   LENNNIPWGQPAVAYALEYEIIDEDDLAQFMSNGKQVNATREQIAMYFGRAMASSGDLR
FT                   QSPNLSFLDSEMINKDVVTYVDFLVRESIISGDNNNRFNPKSTITRAEMAAICSKAYDV
FT                   LESEPDIIIDISNPNNNNDKEEPAANSKTITRTIEQVNATDYILFAYNDKDQLELYQVE
FT                   RNAVIEIRGEREDLRDLRKGNEAELTFENDKLVKIEVNPQRDRVDGEIRNITHFDDEEY
FT                   ALIVIEDPYRSSTRRTLRVDRSTQVIIFDDESSYDRLEVGDEVVVYYEDNNAIKVEVYE
FT                   DDRQIVGILDSNISFNRYPFTMEVRSFNNQLITYEIDHDATVQIDNRRRQVEDLKRGDI
FT                   VTLRMKDGKVTSIDASTTSTGRSNNEEGRIVSLTAGRPNNLIILTEDNEEIQYELADNV
FT                   VIYLDDSRADFYDLRTNYEVELEIEGGLVTEIEATKRGQNNAIEGEITRFYDSIDRMIV
FT                   RHRVQSTGRYEETSVYVTGDTVIIDEDGERIEMRHLDRGDEVFVNGSYEDDIFVANRII
FT                   VLND"
FT   sig_peptide     223887..223967
FT                   /locus_tag="Amet_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 27"
FT   gene            226053..227249
FT                   /locus_tag="Amet_0192"
FT   CDS_pept        226053..227249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0192"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   cth:Cthe_2347 lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46429"
FT                   /db_xref="GOA:A6TJR1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR1"
FT                   /protein_id="ABR46429.1"
FT                   /translation="MEEISLRELIETLLKQKKLIIGITMIAVLTTGLFSFFMLEPVYET
FT                   RMVLMASNFTERLQPNQLSGNGVEGMLESLSQYPAMTLDTYRQQVTAPRVMRATIEELG
FT                   LEEDYDVERLARAISLETLQNTNLITIKMQHGDPEKAALIVNTVGEKFVEFVSEKAQEH
FT                   ASQSSQYVVSQMEVEEAQLDDALVELREFLSQPRGVSELQMELDARLSQATSFKTQLTD
FT                   LEIREPALQSAIQVAQAEGNTNSQIMINDNAGSQQITLESTETLLKIELAEVQSNIQSF
FT                   RTQITEIQDEIEELQVELQDKKHQERLINQRVNIAENNYDAFVKKYEELRVAESSQIGD
FT                   ASITVISRAFPTTTPIGPRKTLNVAIAGVLGVMIGVFAAFFIEYWKTSGKEQEALEIK"
FT   gene            227335..230301
FT                   /locus_tag="Amet_0193"
FT   CDS_pept        227335..230301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0193"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: TPR repeat-containing protein; O-antigen
FT                   polymerase; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: tte:TTE0644
FT                   TPR-repeat-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46430"
FT                   /db_xref="GOA:A6TJR2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR2"
FT                   /protein_id="ABR46430.1"
FT                   /translation="MLKVLTKGTKGKTKAGVTKQSKRQSVLLFILLGVLVFYPPFFRGL
FT                   FFERERLLTHALSFGLFMTYLMDQIIKGEKIDVNSPFDYIGGLLIFAYVLPVVFFQWAN
FT                   LREAVGMILWQVNLFVVYFMVKEYAQEEKYRRWILDIVLLSGVITAIVGILGAVGIVNL
FT                   ADVVLGNRIASTFQYPNTLAALMMALFFIVTGLQSQEENSWKKYFYATSGFLMIFTFIF
FT                   TYSRAAWMMLPIFALLYIAFAPGKSRTDGIFYMIAVAVPNILILQPFTSSLSAEEANLG
FT                   GIIIVAVGMLVFAVLYMGLEIVKRKLTEKHQRLIYVLLAVIFVAAGGFVYVALNITEPL
FT                   TFDNTTVSENRTNQIQRTIQQVDPLSQYELQLQVESTSIDESQWPWRVQIYGVDEAGQR
FT                   QLLEQRIGEINESGEVRIPFDTLERTTDVVLYLRNQHPETKVTFEQVSLYDNQDNLIKD
FT                   VKLSYKYLPETLVSRFNAIDLSEGSSTTRFAYYRDSLSIFKEHPLIGAGGGAWSGIYTK
FT                   YQSEPYHSTEAHNYYSQTLVETGMVGITLITGLIVLIATLGYYAMKGKNIVQYSIVMGI
FT                   IALLGHSAIDFNFSYLSIALILWVLIGLLDVTPLKQLKGLKSLKEREFKVGGQLSALVI
FT                   TLPLLLVTLSFYSAHQASGQGIYAMETGDHQRGFQLLESAVTRDPFNENLRLDYAQVLR
FT                   GIVTEDGQANFMKEAEEQLLNAEKYAPYKPEVLQRLAGYYLSTGNFAQAEVYVEKLVQI
FT                   APLRESSYEVKANIYSAIGDYYLSESQDELALQMYEKVLEVIEDLRRTNQELDKPFSLT
FT                   SEMMSQVFNARYIVENIDSEEKLANLDNIIFSAYLDIHVSEENTLPQGWWTWNREGGEV
FT                   KVKVTEEGANVTNVGTDLGILLSPRLELNPSKTYGVDVQISSDVKDDDIQIVVHSRSGT
FT                   ATQFSQRSLGEPMEGNLYRFTFETTDDIEPGGQDIRFYHYGDSEQSFTVNQVMIYEIE"
FT   gene            230434..230949
FT                   /locus_tag="Amet_0194"
FT   CDS_pept        230434..230949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0194"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: gme:Gmet_2889
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46431"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR3"
FT                   /protein_id="ABR46431.1"
FT                   /translation="MDKEYMVLEEIKENQHISQRQLAHSTGLSLGSVNILLKKMVKEGL
FT                   IKVESIPANRVAYMVTPKGIVEKANKTYNYIRQHYKVIEETKKKVKELLLQLMEECKTV
FT                   YIQLQEDEISQLVRVAVEELGVSEKVLLVGKEEQDIQPGAILITVNLTNDEFDETRYEK
FT                   VINLVEWL"
FT   gene            230975..231376
FT                   /locus_tag="Amet_0195"
FT   CDS_pept        230975..231376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0195"
FT                   /product="nucleotidyltransferase substrate binding protein,
FT                   HI0074 family"
FT                   /note="TIGRFAM: nucleotidyltransferase substrate binding
FT                   protein, HI0074 family; PFAM: Nucleotidyltransferase
FT                   substrate binding protein, HI0074; KEGG: tte:TTE1987
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46432"
FT                   /db_xref="GOA:A6TJR4"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR4"
FT                   /protein_id="ABR46432.1"
FT                   /translation="MDHLKNVRWKQRFINFEKSYNLLNQYINQPIETELERAGIIQFFE
FT                   ISFELSWKLMKDYLESQELSVKSPRETIKQAFQIGLIDDGHIWIDALSDRNLTVHTYDE
FT                   KLARKMVDDIAKVYFPELKKLYHKLVKEL"
FT   gene            231379..231696
FT                   /pseudo
FT                   /locus_tag="Amet_0196"
FT   gene            231712..231816
FT                   /pseudo
FT                   /locus_tag="Amet_0197"
FT   gene            231835..232173
FT                   /locus_tag="Amet_0198"
FT   CDS_pept        231835..232173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1265 type IV pilus assembly protein
FT                   PilA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46433"
FT                   /db_xref="GOA:A6TJR5"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR5"
FT                   /protein_id="ABR46433.1"
FT                   /translation="MDKKSNGFTLVELIVVIAILGIIVAIAVPRLTGYIRIAEERVCAA
FT                   NRKTVEKMYSAFLLENDHEDSIFSQFLIENFDEVCPTGGVLRYEYEKVKCSVHEDGNEE
FT                   PGDEVPWL"
FT   gene            232387..233121
FT                   /locus_tag="Amet_0199"
FT   CDS_pept        232387..233121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46434"
FT                   /db_xref="GOA:A6TJR6"
FT                   /db_xref="InterPro:IPR040829"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR6"
FT                   /protein_id="ABR46434.1"
FT                   /translation="MNENIIAFILSVLAGLVSGWLVWIFRYVIGNRKHLLITIKAMRLW
FT                   NTEIRVSISYLFRIRVSGKYMLVKGNRIDQYQPVGGVFKMLPSFKDIKHNYEITDDDRL
FT                   PIDETSKDDLRIRVQGKHLVKLLSWFYTRKNREVGVHREFYEEMIKTGILEIDSLRSFT
FT                   PEYCKTVNTNIHYSKHFKCKEILIYEIYELDLTEQEEKRIVEYVRDNSNKAILASQDDI
FT                   CKECIDLDGSSKKIGEHAKHIL"
FT   gene            233140..234666
FT                   /locus_tag="Amet_0200"
FT   CDS_pept        233140..234666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_A0043 RC169"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46435"
FT                   /db_xref="InterPro:IPR040511"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR7"
FT                   /protein_id="ABR46435.1"
FT                   /translation="MLLFSEIDDYYEQLYKELDIPESYYEKANTSYSSFSNWLGRDDST
FT                   LREHQPQIFLQGSFKLGTVIKPIGENDSYDIDMVCKFNNLSKQEISQKELKTLLGQEVT
FT                   TYAKSKGMINEPKNGKRCWTLNYHDEAKFHMDILPCVDDSKKFIDQLEIFKYAETTSYK
FT                   ERAIAITDKRSEAYNMISNDWEISNPQGYYLWFQEQSNFIEKRAMLAEKFQMKAEELKE
FT                   YKVKTPLQKTIQILKRHRDIMFKDNPEKKPSSIIISTLAAKAYRGGDNIRDVLKYVVDN
FT                   MNGYIQEINGEYRILNPVNPLENFADKWNGDQSLKNHFDTWLKEAKKSLTPYNESIDIY
FT                   GDDFQKKISEQLGISEAKSKDLVKADKVMTRVEAIPHRQKPNWNVYSWVDIYIKATKTK
FT                   SGFSFPKQFNSGDFLTKNVDLKFEAKAENIKQYEVHWQVTNTGTEAKSSNCLRGDFYDG
FT                   QIVEGKRIRKESTSYVGTHIIECYLVKNGVCHGKSKPFIVNIRDGFSMEW"
FT   gene            234714..235337
FT                   /locus_tag="Amet_0201"
FT   CDS_pept        234714..235337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0201"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: bha:BH3716
FT                   galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46436"
FT                   /db_xref="GOA:A6TJR8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR8"
FT                   /protein_id="ABR46436.1"
FT                   /translation="MVYLKIKRLIDIILSSLGLIILSPVFLVLILAIKVDSPGPVLFKQ
FT                   KRVGIHKSHFNILKFRTMRIDTPKDTPTHLLDNPDQWITKVGKFLRRTSLDELPQIINI
FT                   FKGEMSIIGPRPALWNQYDLIEERDKYGANDVPVGLTGWAQINGRDELEIDVKAKLDGE
FT                   YAEKIGFMMDVRCFFGTVISVLRTDGVVEGGTGTKKADKESVRQ"
FT   gene            235359..237137
FT                   /locus_tag="Amet_0202"
FT   CDS_pept        235359..237137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0202"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   gme:Gmet_1501 heparinase II/III-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46437"
FT                   /db_xref="GOA:A6TJR9"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJR9"
FT                   /protein_id="ABR46437.1"
FT                   /translation="MDNKLILFMNTIKYLKPSQGVYRLTNRLKRELYKRKILVINTPSE
FT                   IKAIKKAKFLIPSLDFDSEYLNRFDIEGILNNEFDFINISHKVSLDSAWNDKSLQHLWR
FT                   YNLHYFEYLYKLGFQYLNGDKNPKYYEKYKELIINWIVNNPCPYGDGWHPYTISLRITN
FT                   WITTYELFIDEINNDIDFRDQIAKSLYTQYSYLQKNLEKDVLGNHYFENIKALIIGSIF
FT                   FGKEQVKSKFTKELLKQLEEQILEDGMHFELTPMYHKIILEDLIKITVRLKNESVYAKL
FT                   SEYIKKMIDVMYSFEEGFGKTPAFNDSTDGISKNYDCLLETCKQEFDLTPKYIDSFKDS
FT                   GYYILRNDQYKLILDCGEICPSYLPAHGHCDALSYELSMDGIPILVNSGTYQYEGGEWR
FT                   NHFRKTKAHNTVMIGNREQSQFWGSFRVANRISDVIRRRFNYKGLSFISGAYKTYFGAK
FT                   HTRYIGEIDENVLLVLDKVEAKASEEVRSYVHLNPNVKVSLSETVKIKKDSMNINIIHV
FT                   SAKDVSISKGWYSSAFNLKEENEHIVFTKSDDLDFFGYLICLKDIKCNAEISNDVLTIR
FT                   TDKEFIINLNKLGEKI"
FT   gene            237134..238351
FT                   /locus_tag="Amet_0203"
FT   CDS_pept        237134..238351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0203"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   gme:Gmet_1502 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46438"
FT                   /db_xref="GOA:A6TJS0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS0"
FT                   /protein_id="ABR46438.1"
FT                   /translation="MKIVVICHYFPPEIGAPSARLYEMSKRWVELGNEVHVVTCFPNHP
FT                   TGIIPDEYKGMKYKLENMDGIHVHRNYVYATPNKGFIKKTLGHISFMFSSVFYSMKKID
FT                   KPDIIITSSPTFFSIFSGYWYSLRKKADFVLEIRDLWPAAMIELGVMKEGFITRVLEKM
FT                   ELFFYRKSKKLIMVTQSFKDNVVNRGISGDKVHVITNGVNQDLFYPKEKNQELINKHNL
FT                   EDKFVVSYVGAHGISQNLSTILEVAKKLRIYKNIEFVFVGEGAEKDKLKQILREEELKN
FT                   VQFIDAQPKELIPEFYNLSDLCLIPLKNIELFKTFIPSKMFEIMACGVPIVASLEGEAA
FT                   QILQDSKAAVVVKPDNSDEIAAAIEELINDKEKYNQMKASGPEFVEKNYLRNKLAERYL
FT                   EIINNA"
FT   gene            238363..239223
FT                   /locus_tag="Amet_0204"
FT   CDS_pept        238363..239223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0204"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility C-terminal domain; KEGG:
FT                   pme:NATL1_08611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46439"
FT                   /db_xref="GOA:A6TJS1"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS1"
FT                   /protein_id="ABR46439.1"
FT                   /translation="MILLTGATGFLGGFVLEEMVKRGHKVTCFVRETSNLEKIKELNVP
FT                   YIFGKLDDYESICNALKDKETLINIASLGFGHAPHIVNACQEMNINRAIFISTTGIFTK
FT                   LNPDSKGIRLEAERLIKESNLDYTIIRPTMIYGTPKDRNMWRLVQYLKKFSVLPILGNG
FT                   TYLQQPVYVKDLAWAVVSAYETDKSIKKAYNISGLKALTYNEVVDVMGRVLGKKILKIH
FT                   VPMKLSYSLLKIYENISSKPKLKAEQVLRLNENKAFSHDEATKDFGYKPISFEKGIELQ
FT                   VKEVN"
FT   gene            239288..240424
FT                   /locus_tag="Amet_0205"
FT   CDS_pept        239288..240424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0205"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pab:PAB1604 LPS biosynthesis RfbU related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46440"
FT                   /db_xref="GOA:A6TJS2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS2"
FT                   /protein_id="ABR46440.1"
FT                   /translation="MNNIKKIFLVVFPHTPNPRMIKRVKALLINYDVHVIYWDRNLGNK
FT                   KINELPKESKVTVIKRKANEGSPIKRLGATISVIREIIAIAKRVEPDVLYLSKTDILFA
FT                   AVLYKKITKTNVRLVYEVSDLHTLMVDQQKKTYKKLISKLIKKTEKSLCKSIELLIVTS
FT                   EFFYNQFYQDFISKDKVVFMPNTPDPLVFDGFHRKTNEKFTVGFIGAIRYAEQLEMLID
FT                   ASIEANINVLIAGAGKDYLRIKEYAKNYENVEVYGEYKYNEEIKKLYEHVDCIYSVYDA
FT                   ELKNVQIALPNRLYEAAFTSTPIIASKNTYLGDIVEKYDIGKTILFNSKTELIKVLSLL
FT                   KEDLNYLKSIEEKSQLFRNDWDLNKHNKNLIKAIGKII"
FT   gene            240436..241665
FT                   /locus_tag="Amet_0206"
FT   CDS_pept        240436..241665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0206"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase, dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase-like; KEGG:
FT                   cpf:CPF_0468 UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46441"
FT                   /db_xref="GOA:A6TJS3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS3"
FT                   /protein_id="ABR46441.1"
FT                   /translation="MTSKINVIGLGYIGLPTALMFAKSGVEVVGTDLNEKLIDSLAKGK
FT                   LTFEEEGLEELFNDAIEKGIKFTTEYQKTDTYIIAVPTPYINSSKKLDPKYVISAVNTV
FT                   LDVCEKGAVLIIESTISPGSIDKYVRPEIAKRGFELGKDVHLVHAPERIIPGNMIYELE
FT                   YNSRTVGADDLIIGEKVKEIYSSFCKSEIVVTDIRSAEMSKVVENTYRDVNIAFANELA
FT                   KICRTDKMDVYEIIRIANKHPRVNILQPGPGVGGHCISVDPWFLVGDYPDLTNLILTAR
FT                   KINDSMPTHVLGRIRDIMREHKITDISKIGIYGLAYKENVDDTRESPTLQLLERMDEHL
FT                   AFGVKVYDPFIKERIVDHQFMNFEDFLNEIKILVIITAHDHIKNNLDLVKDKFILDTKN
FT                   ICDFDGVYKL"
FT   gene            241682..242773
FT                   /locus_tag="Amet_0207"
FT   CDS_pept        241682..242773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0207"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   spn:SP_0357 UDP-N-acetylglucosamine-2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46442"
FT                   /db_xref="GOA:A6TJS4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS4"
FT                   /protein_id="ABR46442.1"
FT                   /translation="MKKIMVVFGTRPEAIKMCPLVKELKTREKLNTVVCVTGQHREMLD
FT                   QVLNAFDVVPDYDLSIMKAKQTLFDVTVNILEKMKAVLEEVRPDVVLVHGDTSTTFVTA
FT                   LACFYLQIPVGHVEAGLRTYNIYSPYPEEFNRQAVGIVSNFNFAPTEMSKENLLKEGKD
FT                   LETIHVTGNTAIDALKTTVRGDYSHEHLRWAADSRLIMITAHRRENLGEPMRNMFRAIK
FT                   RIIDETADIKAIYPIHMNPIVRKAAQEILGDTDRIRIIEPLEVLDFHNFLSRSHLILTD
FT                   SGGIQEEAPSLGKPVLVMRDTTERPEGIAAGTLKLVGTDEEVIYKTFKQLLENQNEYDK
FT                   MSQASNPYGDGFASKRIADILCR"
FT   gene            242913..243170
FT                   /locus_tag="Amet_0208"
FT   CDS_pept        242913..243170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0208"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="KEGG: cth:Cthe_2340 UDP-glucose/GDP-mannose
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46443"
FT                   /db_xref="GOA:A6TJS5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS5"
FT                   /protein_id="ABR46443.1"
FT                   /translation="MVIGLGYVGMPLVVAFAKKIDVISFDLNKKKIELYKAGIDPTNEV
FT                   GDEGIKQTSVEFTANEARLKEAKFHIWNIIAESYNALYKS"
FT   gene            243195..244343
FT                   /locus_tag="Amet_0209"
FT   CDS_pept        243195..244343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0209"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pac:PPA0673 putative glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46444"
FT                   /db_xref="GOA:A6TJS6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS6"
FT                   /protein_id="ABR46444.1"
FT                   /translation="MYILIIARGYPTDKYKMNGIFEFDQAKALVQAGHKVIYAAIDVRS
FT                   IRRWRKWGGESFEQDGVQVEAINIPGGRIPKTILRQIQMQGLKNLYKRIESKYGKPDII
FT                   HAHFLGYGNISTEVLAKQNIPIALTEHLSAMNNKALEPSLITLGTETYPNVDKLITVSE
FT                   ALANNIEEKFEVKATVIPNMVDTESFNYINRRKENDDYVFVSTGGLIPRKSMDVLIDSF
FT                   NIAFKDKKKVKLYIFGEGAERSKLEQMIAEYKLTEQIFLMGLRDRKEIAKRMHESDCFV
FT                   LVSKLETFGVAYIEALAAGLPVIATNCGGPEEFVHKDNGILIEVDDAEALTNSMLKMYN
FT                   ESNKFDREKISKEMVDKFSPEAIAKRLTETYRNVLKDRKVQL"
FT   gene            244340..245611
FT                   /locus_tag="Amet_0210"
FT   CDS_pept        244340..245611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0210"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: bsu:BG12692
FT                   biosynthesis of teichuronic acid, polymerization"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46445"
FT                   /db_xref="GOA:A6TJS7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS7"
FT                   /protein_id="ABR46445.1"
FT                   /translation="MKKSVLLIVASSLMAADFISISLGFMELSLFRISLMLLAILTIFN
FT                   YLKSNKKFALNNLSIQSKIIRFYLLWLFYAILSLGWVKDYDYWIRAVFYITVGFLCIWT
FT                   FSVYLKEKKDFSKVFLVFFIMLVIHNLIGLNEVSTGVYRFADMTRIDRHGQFGYNAVAR
FT                   TPVSMFGNTNDFATVITLGIFITYIVFVNTNSKILKSISIFNLISSIYLLVRTDSRANM
FT                   LGLAIGILVFTYLNFYRKLTVKTILLMFGVPLLIFNPFVLNQILTFVSDRLNFNFAGTG
FT                   SDGIRVGLIKNGLLFLKETIGFGVGAGNIDFWMENYKVYYTGTIRNMHNWWMEILVGYG
FT                   VFIFMGYIWTYLKMFKIFYKAYIKSDDKFIRTTSLGLISLMSAFIVSAISSSSNVGSSW
FT                   MWMIWGVVIAFVGYVENKRKQISY"
FT   sig_peptide     244340..244387
FT                   /locus_tag="Amet_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.982 at
FT                   residue 16"
FT   gene            245637..246746
FT                   /locus_tag="Amet_0211"
FT   CDS_pept        245637..246746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bad:BAD_1383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46446"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS8"
FT                   /protein_id="ABR46446.1"
FT                   /translation="MDINNKQNIATIAFHRAINYGAVLQVYALQKRIEELGGNCTVLDY
FT                   RNDLLESKHRETKIGDCKTIKDYIRFIFLSKNNNLKYKAFRAFSESYLNLSKPYYTIDE
FT                   LKKDEQKYDKFITGSDQVWNGNLSNTDPAYFLDFVNDSRKKNSYAASFGFEKIPDNKIG
FT                   DYYNMLKGYKEMSVREIQGTKIIKELLGMDVETVLDPTLLLTKEKWFEIAEDYTKNENY
FT                   ILVYGFGEAKYKMNFAKNLSKKTGCKIVHIANPYYNERGILYEKSLGPKEFLGILKNAQ
FT                   YIVTNSFHGTAFAINFNKEFFVEPLSEAFGTNSRLTNILDLFGLKDRLIFSEDVSMYDK
FT                   TIDYDNVNKVLNGERKNSVKFIREIINSN"
FT   gene            246845..248014
FT                   /locus_tag="Amet_0212"
FT   CDS_pept        246845..248014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0212"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: dps:DPPB80 related to F420H2-dehydrogenase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46447"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJS9"
FT                   /protein_id="ABR46447.1"
FT                   /translation="MISVFDIKEDCCGCTSCQHICPTKAIEMKPDEEGFLYPEINQELC
FT                   NDCGLCRTVCAFQNGYDISDDFAAPKVYAVKNKHEDVRMASSSGGIFSAISDHILDSDG
FT                   LVSGVAFDENMNVVHKIAATKEERDEFRGSKYVQSELNHVYSEIKNLLKQNKAVLFTGT
FT                   PCQNAGLKSFLDLARVKTENLILCDIVCHGTPSPLLWKEHVSFLENKNEGKLLQHSFRW
FT                   KEAGWRGYNVYAAFDNGKSKLNTADVKSFANIFSSDAALRPSCHYCRYANLKRPSDITI
FT                   ADFWGIEKTMPQFDDNKGISLTLINTAKGQKLFEDIKSKIIYRESNTKDCLQRNLQESS
FT                   KVSEKREQFWQDYHLRGYEYIVKKYAGYNLKASIKRKVKTALIKMGLQA"
FT   gene            248199..248771
FT                   /locus_tag="Amet_0213"
FT   CDS_pept        248199..248771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46448"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT0"
FT                   /protein_id="ABR46448.1"
FT                   /translation="MLVYGIKAPKSAERIWINPRDCKYLIKDIGRKGSGKVVKEWPPRG
FT                   AHIVNVDEIEKIKYLKLHWEDGVPWSDCGIYEYNYRLIERGVFDDGCKNKEDVILKYKK
FT                   LDNVFEKIKKENKLLTRAELDEKAFRENGGVYIHLGPNGEPYFGGAGYHRFAIALVLGI
FT                   PLIPAQIGFVHISALGKLKDYRCNNSD"
FT   gene            248847..250412
FT                   /locus_tag="Amet_0214"
FT   CDS_pept        248847..250412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0214"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM: multi
FT                   antimicrobial extrusion protein MatE; polysaccharide
FT                   biosynthesis protein; virulence factor MVIN family protein;
FT                   KEGG: tte:TTE0176 uncharacterized membrane protein,
FT                   putative virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46449"
FT                   /db_xref="GOA:A6TJT1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT1"
FT                   /protein_id="ABR46449.1"
FT                   /translation="MTQSQKAVQSVLIIMFFTLASKVLGFIREILIAAKFGSGVETDTF
FT                   FIALTATTLFTTFFTQSINTTMIPILSEVERKEGILGKRSHTNNLLNIVMVISFFLVIV
FT                   AWFLAPLIIRILAHGFEGEQFNQTVLLMRIGLPVFFFASAVGIFRGYLQSEMKFTESAI
FT                   AQFPFNFVYIFFLVFLADLLGIKGLMVASVLAVGAQILIQIPGLRKINFQYQFIFDVKD
FT                   YYVKKILHLVPPVLISVAVSDINKIVDRSLASTLIDGSVSALNYSNRLKGLIIGIFTAA
FT                   IVTVLFPLLSQKADKNNHDEFKSVFRYGVNTILLITVPATVGMIVLAEPIVRLSFERGA
FT                   FDATASYMTAGALIFYSIGIVGMGLKSFLNRAYYALQDTKTPMYNGFIAIGVNIVLNFI
FT                   LVQFMAHRGLALATSISAILSSLLLLYGLKRKIGPLGIKNMLTTGIKVLASSLIMGFAT
FT                   LHVYRYLSFSFTGSTLIDLIVLSVSIGFGALVYLLLIYLMKVKELFWFINLFKKKLSRK
FT                   KKSR"
FT   gene            250607..251038
FT                   /locus_tag="Amet_0215"
FT   CDS_pept        250607..251038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bfs:BF2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46450"
FT                   /db_xref="InterPro:IPR025393"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT2"
FT                   /protein_id="ABR46450.1"
FT                   /translation="MEKSIERFKKGAKYVNIESAVRRDHLTSINDTSDDYLNLKCVKFI
FT                   PASGAATRMFEDLYKYLDDKIATESINQFFDELENITFYEEIKDFIEKENIDKNVTSDR
FT                   IKIIDYILNSNKMNYGNLPKAVIKMNSYKDFSTTPIEDA"
FT   gene            251357..252193
FT                   /locus_tag="Amet_0216"
FT   CDS_pept        251357..252193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0216"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   swo:Swol_0164 transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46451"
FT                   /db_xref="GOA:A6TJT3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT3"
FT                   /protein_id="ABR46451.1"
FT                   /translation="MGRKPRVEYRGGVYHVIQRGNNREYIFEKKEDKAYLLELVAEYKV
FT                   VMNFELYGFVLMDNHYHMVLKTLDAPLQDIMHRINNKYSKYYNYQNKRTGHVFENRYKG
FT                   ILVKDEKYLLSLIRYVHQNLVRAKMCEKVKDYQWSSDPYYRKNRQGEMVDIGFILNMFS
FT                   RDRQEAIKEYKRFMDRDKMEEGSTFEEVLIIGENQETTMSKPVEVIQRKSLDEILYEVT
FT                   KDEAIHDEIKKGSRKRNLTVYKQKYISRSLAANYTMREIGENISVSEVAVYKMHCK"
FT   gene            252280..253194
FT                   /locus_tag="Amet_0217"
FT   CDS_pept        252280..253194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0217"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   tte:TTE0736 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46452"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT4"
FT                   /protein_id="ABR46452.1"
FT                   /translation="MNKNRKNLIALISIVSILLIIGSVGFQKYQNIVDPHQAFEKNLQQ
FT                   EKDNREKEGMDENRNVVKILLLGVDSSEVREGRAMGYRSDAIMIASMDLDAKNVKLVSI
FT                   PRDSYTDVPGNDNKDKINHAMAFGGGPRNKGNQYAVEAVEGLLDINIDYYLTMDLDAVK
FT                   DIVDTIGGVTVDVERSMDSGGIRIEKGEQKLDGQQVLAYLSNRNAPTGDFARIEQQQKF
FT                   MKALFQQTKEKGKFSDVLPLYLKMQSKIFTNLEIDQMGALLLFLKSVQSENIELFTLRG
FT                   EGMIIDGIYYIDIDEDYMKEIFS"
FT   sig_peptide     252280..252357
FT                   /locus_tag="Amet_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.538 at
FT                   residue 26"
FT   gene            253695..254633
FT                   /locus_tag="Amet_0218"
FT   CDS_pept        253695..254633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46453"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT5"
FT                   /protein_id="ABR46453.1"
FT                   /translation="MGIIHQPHDKFFKEMFGNLALAKDFMTNYLPLELLKIVDIETLTP
FT                   EKEHYIEDDLKESFSDLLFKANINGREGYLYFLFEHKSYPSKRIAIQLLHYMVRIWDDK
FT                   SLKEKKEKIPMIIPMTVYHGKENWNVALRLSDLMEGYEELPEEIRKYIPEYEYLIYDLS
FT                   GYTDDEVKGDVQLQIVIKILRSIFRNDEEFFKVFKEAVEVLDKLEKQEKGIEYFKTFIY
FT                   YILSARKGVTLTEIYDLVKEVSVERSDEIMTIAEELLKEGMEKGMEKGMEKGKLEEKRE
FT                   VARNLIGLGVELDKVMKATGLSEEEINKLLN"
FT   gene            254937..255203
FT                   /locus_tag="Amet_0219"
FT   CDS_pept        254937..255203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46454"
FT                   /db_xref="GOA:A6TJT6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT6"
FT                   /protein_id="ABR46454.1"
FT                   /translation="MSLIVETGDFVNVEIYIEMPESYSNLTEQEKITILYMKDNDGKVT
FT                   TKEVMKILDIKDRRGRKILKDMVDKRLINVRGQGRSTYYVLKH"
FT   gene            255586..257124
FT                   /locus_tag="Amet_0220"
FT   CDS_pept        255586..257124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0220"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; KEGG: tte:TTE1455 predicted
FT                   ATPase with chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46455"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT7"
FT                   /protein_id="ABR46455.1"
FT                   /translation="MASVVKGFSLLGVDGYVVEVETKTIDSQPMISIVGLGDTAIKEAK
FT                   ERLEAVLNHGDYHFPKMKIVINLAPSDLKKAGTHFDLAMAVGLLMESGQIRPKEIQKYG
FT                   FIGELSLNAKLRSCVGVLPMVMAAKESGIKNIIVSKENIQEASLVQGMNIFGFSALKEV
FT                   ADFLEGKKEYEIPLELTPKHQEQHLYGLDFNEVQGQDAMIEYIVVAAAGGHNLLMIGAP
FT                   GCGKSMIAKRIPTVLPSMMEAESLEVTKIYSVAGLLRKRGYLIEDRPFRAPHHNASTNS
FT                   LIGGGNNALPGEISLSHNGVLFLDEIAEFNKKTLEALRQPMEDRRVTISRVRYTNTYPA
FT                   NFMLVAAMNPCPCGHYGSDRCQCSDYEVIKYRQKISGPILDRMDIQKYVQPVDFLQLSE
FT                   HTSGRSSAELRERVEFARDIQKTRYASMEAINCNAQMTPSLIKEYCELEADGTKLLRLA
FT                   YDRFQYSARTFHKFLKVGRTFADMEGSEKIRKKDIAAALMARDLDKEQAGMLVL"
FT   gene            257136..258272
FT                   /locus_tag="Amet_0221"
FT   CDS_pept        257136..258272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0221"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: cth:Cthe_0459 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46456"
FT                   /db_xref="GOA:A6TJT8"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT8"
FT                   /protein_id="ABR46456.1"
FT                   /translation="MLYWIWLSEVKGIGPVMQKRLLAYLQSPKAIYTASSEELMNVPGI
FT                   GCHLAEEITTSSLKRAQEILGMCNGLNIQLLTFHDERYPSRAKEYPLCPILLYYRGHLV
FT                   ENSIGVGIVGARRCSSYGKEIAKQAGQYLAQNNIPVISGMAKGIDGYAHISCLKAGGYT
FT                   LAFLGSGVDICYPKEHDELMARIMESGAVLSQYPPETKPKPQYFPKRNALISAWSEKIL
FT                   VVEAGAKSGALITAQYTKQLKREVLAVPNQIYSQMGKGTNQLIKEGATIYLGPEQLINT
FT                   EPVMNVEAKIIGDNGLKPVKGNKKRKAMEAMKIASPQVNTPTEQRVIDALFGTPKTMAQ
FT                   IVEETKLQQLVLLEVMTILELEGKISSLPGGKWVKEVI"
FT   gene            258377..259870
FT                   /locus_tag="Amet_0222"
FT   CDS_pept        258377..259870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0222"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: mbu:Mbur_0507
FT                   divergent AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46457"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJT9"
FT                   /protein_id="ABR46457.1"
FT                   /translation="MKIEKLKEIISGGENITVEFKESKNKLNKDVYESVCAFLNRYGGH
FT                   LFLGVKDNGDITGVDKDSVEQLKKNFVTSLNNPQMLNPTFYLNIEDVEVEGNVILYINI
FT                   PESSQVHRCKGKIFDRNEDGDFNITDNTTLVSKLYMRKQSTYTENKIFPYAEMEELESE
FT                   VFTKVRKLAANQKANHPWTSMDDLEILKSVGLYLRDPNTGKQGITLGGILIFGKEESIH
FT                   AALPHHRTDAILRRENLDRYDDRDDIRVNLIRSYERLMQFIAKHLNDKFYLEGDQRVSL
FT                   RDKIFREAISNLLIHREFSNPFPAKLVIEMNRVYIENSNKPHGNGIIDPENFSPYPKNP
FT                   TIAKFFKEIGWVDELGSGVRNIYKYNKIYSGADPEFIEGDIFKTIIPFKPLASTHVNMD
FT                   SSTHVSTHVSTHVNNTNEDEKIKALLEFCQEPRSRSEIQDFLRLKSRKHTLSKFINPLV
FT                   RGGLLKLTIPDKPRSPKQKYYCENRWKEQRTQGARHLTY"
FT   gene            259919..260167
FT                   /locus_tag="Amet_0223"
FT   CDS_pept        259919..260167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46458"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU0"
FT                   /protein_id="ABR46458.1"
FT                   /translation="MKALFQQTKEKGKFSDVLPLYFKMQSKIFTNLEIDQTGALLLFLK
FT                   SVQSENIELFTLRGEGMIIDGIYYIDIDEDYMKEIFR"
FT   gene            260697..263663
FT                   /locus_tag="Amet_0224"
FT   CDS_pept        260697..263663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0224"
FT                   /product="putative DNA helicase"
FT                   /note="KEGG: stm:STM4489 putative DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46459"
FT                   /db_xref="GOA:A6TJU1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU1"
FT                   /protein_id="ABR46459.1"
FT                   /translation="MNYKTEAITKYLRSAVAAQANMGIDFKKDEFHIIDKEDLIQGKIG
FT                   LEVCQSIFAEASKSAFENENESNEKSFIKVIICAKAIKTIFEANEKTQDEIDELTGIFY
FT                   IPVILDQQGMLSYNQIDKKIPWFPREYLHPMVEPKLAIGNAETVDDYISNHVDQIEKIK
FT                   SWSDYTAFFKTFYESIAESKFEEKTIRNMEDQASALELENNMYVFIDKTVHSTFHIMRL
FT                   YNHLMKEDQPKPLYDNFISTEIANINPLVENDIARMQVHSGQMGGEYSLSPSQREAVNH
FT                   FNCMEDGEILAVNGPPGTGKTTLLQSIVADMYVKRALNQEKAPLVVASSTNNQAVTNII
FT                   ASFGNIKKMGISNLEERWIEGVDSFAAYFPSGSKIKEAKSQGYQYTNQKGEFFFSDVED
FT                   KGNIEKSEGKLIESCNEYFKTQYKDINACKNRLHEELLFFEKSKNTLLSLAQEAAQYDL
FT                   NGQTLDQYLIGLQDEMKVKQEVVSTIGQRVKDWEDCYNRMPFFCKLLKFIKPFSRKIQT
FT                   AFRLFMNNEEQGFINEYMSLDEIKEKYSQQYAVYNKGTYDLRKKKDSVEKIKSRYDKEL
FT                   KELERHHIFFYEKEEEKYRLEMDFINDVLDKKIRYITFWLAVHYYECRWVSGEDKLSKK
FT                   QKGRNFKNVLDQFYSRLSMITPCLVMTFYMLPRQFLAYGDQKNFFLYNYIDLLIVDEAG
FT                   QVSPEIAAGAFSLAKKAIVVGDIYQIEPIWAINPGLDKALAWSHGVVESLGEFELLEKA
FT                   GLNTSRSSVMKVAAKCCKYEKFDERGLFLREHRRCYDEIINYSNKLVYKGNLQPMRGKG
FT                   SQDQKLAIKEWPQMGFRQVDTDVSYRKGNSRCNQREAEKIVAWLKGNVNLIEEVYSQEP
FT                   VENLVGVITPFRAQVGCIKKELKKQMPRYATKISIGTVHTFQGAERRIIILSTVYGRHD
FT                   GCFFIDENESLMNVAVSRAKDNFFVFGDINCLKDTQNSASGLLKKAIGSNAVPTVATQ"
FT   gene            263768..265660
FT                   /locus_tag="Amet_0225"
FT   CDS_pept        263768..265660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0225"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor,
FT                   interaction domain-containing protein; Propionate
FT                   catabolism activator domain protein; ATPase associated with
FT                   various cellular activities, AAA_5; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; AAA ATPase;
FT                   KEGG: chy:CHY_1254 sigma-54 dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46460"
FT                   /db_xref="GOA:A6TJU2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU2"
FT                   /protein_id="ABR46460.1"
FT                   /translation="MKKDILFISPFEDLYKIAKKLIKFQGFEEIDVQMGDLEEGAKKAR
FT                   VAVNNGTRVIISRGGTYNAILKEVDVPVVEVGITAFDILKSFKLIQQIKEPLAIIGYHN
FT                   VIKGYDIIEDLFVDMDVTKIILDNTKSVEGQIKECVNKGVKVVVGDTVVNRIAPQYGCK
FT                   SILIESGEEAVLSAMNEAIRVLKAAQVESDRMQRFMAVIDYTSDGVIATDKDGRVTVFN
FT                   RNAEVILGTTKEKAKGQLISQIFKYDQISKLIESPSIKVDSIYDLGSTKLALNHVPIFV
FT                   DGDDTGSIITFQDISKIQSLEKKIRLELSKKGFVAKYNFQDIVHQSSLMQKCIKRARTY
FT                   GGYDSSVLITGPSGVGKEIFAQSIHNISKRKTGPFVPINCAALPANLIESELFGYVEGA
FT                   FTGAKKGGKPGIFEMAHKGTIFLDEISELPLDLQARLLRVIQEREVMRVGDNKVIPVDV
FT                   RIICATNRDLKEMVIEGDFRRDLLFRINILSLNIPSLNERREDIELLIEYFISLFCDEY
FT                   KKGSMKISSDTLGYLERHHYDGNVRELQGMIERAVITCTGDEIKLDDIIESDAYNVDQI
FT                   ISNHSNIFDEEYSLKELEDKYIKYISNKYSDSKQEICHILGIDRSTLWRKKKKK"
FT   gene            265925..267202
FT                   /locus_tag="Amet_0226"
FT   CDS_pept        265925..267202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0226"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   mta:Moth_0726 type III effector Hrp-dependent outers"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46461"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU3"
FT                   /protein_id="ABR46461.1"
FT                   /translation="MIYIISDDLTGANDTGIQYTKQGFRTLVTVKTDVEFLETTSKSYD
FT                   VISINVDTRSKLPDDAYHTVYDLVKKFENTGVDYIYKKIDSIVRGNPGVELDAVMDASN
FT                   AKIALVATSFPEVGRKLMNGKLELIDWEGNKSVIDVIELFTDDMKRKVRGINLSTVKEG
FT                   ISSIVEVVERGTSEGVEVFVIDAESDEDLAVIKGAATSLKVPPVLCGSAGLAKQLSLSG
FT                   REIFNKKSNEVTQIEDKATLILIGSRNNITSQQLKVLEEEMRIPVLTLMTGEVLNGGRE
FT                   AIIENTRGEVSSLIDNGCRLLAIVVDTLFQGFTVQLKDSEAALMDSNYIAHAIGELAKL
FT                   IYETNSIDTIVSSGGDTSQKLLDALNAKGIHLESEILSGIPVGRVIDGIADGMTIVTKS
FT                   GGFGDQDSLIKVIEYLEDRKNKLAYA"
FT   gene            267254..268414
FT                   /locus_tag="Amet_0227"
FT   CDS_pept        267254..268414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0227"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   3-dehydroquinate synthase; KEGG: msu:MS0069 EutG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46462"
FT                   /db_xref="GOA:A6TJU4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU4"
FT                   /protein_id="ABR46462.1"
FT                   /translation="MMMEQYQLVMPKFVYSGTNSLEKIADIITREKAKKVMVFTGKEIL
FT                   KIGICDKVFEVIRECGADYDVISDIRPEPGTVDVEKVLKQLNQSDGELVVAVGGGSVMD
FT                   MAKLCAAMKGASYTIHQLLEDNSIMENGLPTVMVPTTCGTGSESTFNSIVAVESKQLKV
FT                   GIVNTNMMADYVILDSSMIAGLPKHIVASTGVDALAHAVECFTSNRANPFSDLVAKEAS
FT                   KLIFENIVKSYHEPGNMEAKTNMLRAAFLAGVAIASSGTTAVHALSYPLGGKYHIPHGI
FT                   SNAILLAPVMRYNMAACEERLAILADTVSPGGIARSNKEKAEEIVKRIEEIVRDTHIPS
FT                   SLSEYNVGKEDLDQLVASAFEVKRLLNNNRKELTKEDIKNIYLEIL"
FT   gene            268426..269466
FT                   /locus_tag="Amet_0228"
FT   CDS_pept        268426..269466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0228"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA; KEGG: mta:Moth_0727
FT                   4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46463"
FT                   /db_xref="GOA:A6TJU5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU5"
FT                   /protein_id="ABR46463.1"
FT                   /translation="MNKLPILGITMGDPCGIGPEITAKALVHKNVYEVCRPIVVGSAKV
FT                   LEAAIAICNKDLKVNVVSNVKEAKFAFGTIDVFDQDHVDVWSLVRGQVSKIGGQGAYEA
FT                   IEKVIDLAMKGEIDGTITGPLNKEALNIAGYHYGGHTEIYAKLTGTKDYSMMLADGNLR
FT                   VVHVSTHVSLREACDRCTKERVGSVIKLAEEACKSLGINRPRIAVAGLNPHSGENGLFG
FT                   REEIDEIIPAIEKAKSEGLDVEGPEPPDTLFSKALGGQYDIVVAMYHDQGHIPVKVVGF
FT                   QYNHELKRWNTVSGVNITLGLPIIRSSVDHGTAFGQAGKGTANEESLVNAIDYGARLAV
FT                   TRLENK"
FT   gene            269498..270385
FT                   /locus_tag="Amet_0229"
FT   CDS_pept        269498..270385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0229"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: msu:MS0067 DapA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46464"
FT                   /db_xref="GOA:A6TJU6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU6"
FT                   /protein_id="ABR46464.1"
FT                   /translation="MVNIHGIVPAMVTPMNEDETINEKELRAQVNRQIEAGVHGLFCLG
FT                   TNGEFYILNQEEKLKVMEIVIHENAGRLPVFVGTGAIGTKETVQLSQKAQELGADVLSV
FT                   ITPYFAAASQNEIYEHFKTVANSVDIPILPYNIPMRTGANINVDTLKRLSQIPNITGVK
FT                   DSSGNFDNILQYIESTDDSFAVLSGNDSLVLWTLQAGGKGAICGIANLFPHTMASIYEL
FT                   WKAGEFAEAKKVQDSIREIRNCFKLGNPNTIVKIATNLLGHPVGPCRKPFYTNSESIRE
FT                   EIQRVLHTYYKDFK"
FT   gene            270564..271649
FT                   /locus_tag="Amet_0230"
FT   CDS_pept        270564..271649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0230"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: eba:p2A97 hypothetical protein, putative
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46465"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU7"
FT                   /protein_id="ABR46465.1"
FT                   /translation="MKKRGFLLAIAFMLAIGLLTGCAGTEPEAPTDSTPDEAVEENDES
FT                   QAAGLTDPVRLVFSTQDLGTSFNSMTNAFNTVFMPELPRGSSIDVETTSPGGIAASYII
FT                   SAEVADLTIGNTAPANWATSEGIDDRGVAEGVASLGGGFDEPVLVVIFTEAFQKRTGFT
FT                   TLEEVIEAQHPVRVATKATGSFGEMSANKVLSLFDVTYDDIKSWGGDFTLTSSSNVVDM
FT                   LRDNRADMTIDHTNINQPNYVELSMTTPLYYVQLQDETLDRLHEMGYAYQDIAEGSFNN
FT                   YVKEDIKTVGSPTALLVREDMDEEVAYTLTEAMAEGKSKLVTSFAAFEAFDPTKAWEPA
FT                   NAGAPLHPGAERYYREMGYMK"
FT   sig_peptide     270564..270635
FT                   /locus_tag="Amet_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.567 at
FT                   residue 24"
FT   gene            271776..273716
FT                   /locus_tag="Amet_0231"
FT   CDS_pept        271776..273716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0231"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: dsy:DSY0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46466"
FT                   /db_xref="GOA:A6TJU8"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU8"
FT                   /protein_id="ABR46466.1"
FT                   /translation="MDKQIASNSLMEKLIAIGWRKIAIVMVTVTFFAFQMYLAFIRPLQ
FT                   PLMQNPLHFILALAIAILYYPVVKKTKDDELPKWKKMLPIIDMIILASLIFMAYYYMTN
FT                   EYRIVHRIQNIDPLITMDYVIMFMTVGILLECVRRILGANLLIFIFLFIGYAWLGPYMP
FT                   TVISHSGFTLRRFTELMVMGTGGVYGAPLNASAGFLYYFIIFGALFADCGSESVLMDIG
FT                   MKAGSKGSGGPAKAAILSSGLLGMINGSAVANVSTTGVMTIPMMKRIGYKSHEAGAIEA
FT                   VASTGGQIMPPIMGVGAFIMAEMIGVPYGQIALAATIPALAYFGSLFILVDLLARKRQI
FT                   SGEHVAEEIKTEPILKRLYLLIPILLVVIFIVRGASLMRSALIGTAAIIVINILRGKNG
FT                   LSAKELINSFFKGTKQVAEIAVPTASSGIIIGIVVMSGLANKLAAIISSVGGNNMAFAL
FT                   VITTLGCMVLGMALPTVAAYLAAYILFMPSLINLGIPSLPANMFIFYFGIIAQITPPVC
FT                   LASFAAAGIAEASAWKTGWTAFRYALVAFLVPFVFVYKPEILLMGTVMDTILATIVLFI
FT                   GTFFLASAIAGHLFIPLNTKLKRYSLLICAIMVILPEPLTSMIGIVAGIAIATVYFKSS
FT                   KKITEVTVSGT"
FT   gene            274037..274888
FT                   /locus_tag="Amet_0232"
FT   CDS_pept        274037..274888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0232"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   tte:TTE0676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46467"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJU9"
FT                   /protein_id="ABR46467.1"
FT                   /translation="MARVARERSSTGIYHVMFRGINRQTIFEDEEDLNGGDIKVKSYII
FT                   RIELEKSNPLIWRRVIMPAGATFNRLHDVIQNVTNFQSGYPSSGYHLFEFDLTEENMLV
FT                   TNDEQAYLEHQHYKKNKAMYEERLKTIPPEMIVFEKNYQERLKIEVRKPTGLKIDDSLE
FT                   KYKEIRYNYDFGDDWHFTVKLEEIVDDYYFGFPTLLDGVETAPPEDVGGIHGFYEFLKA
FT                   YRDPKHPEYEDIKTWAESLYFREYDPDWINERLKGINYKKTEWDNINHERYNIIEDKYR
FT                   KK"
FT   gene            274935..275222
FT                   /pseudo
FT                   /locus_tag="Amet_0233"
FT   gene            275426..276346
FT                   /locus_tag="Amet_0234"
FT   CDS_pept        275426..276346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0234"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mta:Moth_2297 daunorubicin resistance ABC transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46468"
FT                   /db_xref="GOA:A6TJV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV0"
FT                   /protein_id="ABR46468.1"
FT                   /translation="MNPIIEVKNFTKKYGDFIAVNDISFDVEEGTIFAFLGPNGAGKST
FT                   TINTLCTIFEKTSGSLVIDGKDVTTQKSEVRSTIGVVFQDSTLDSKMTIDENLKMHCVF
FT                   YNVPKKEVEERIQFVLNLVDLLGERNKLVGALSGGMKRRVEIARGLIHFPKVLFLDEPT
FT                   TGLDPQTRSHIWEYIMKLQKERNITIFLTTHYMEEAEICNKIAIIDGGIIVAHDTPYAL
FT                   KKEFTKDKAYITTEKGPELEQLLAQYELQYVKKEGYYKVDAEKTDLLLQVLSLQKEDIT
FT                   DIEIKKGTFNDVFLEITGKKIREDA"
FT   gene            276348..277184
FT                   /locus_tag="Amet_0235"
FT   CDS_pept        276348..277184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0235"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mbu:Mbur_0388
FT                   ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46469"
FT                   /db_xref="GOA:A6TJV1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV1"
FT                   /protein_id="ABR46469.1"
FT                   /translation="MNTVFALWKRGLKAFIRNRTGLIFSLIFPFFFVYVFGAIFKNEFI
FT                   QNPIAYMLSGVIIATVFESALNLASTTVDDMVSGFMKEVLVSPAKRISVAIGQLLSAAT
FT                   VSTIQGILILVIGLFVGIRFTTWTTPLFVLLAMICVGLVFSGVGLFLATIVRSGQTFQI
FT                   IKTAVTMPLTFLSGAYIPIAMLPTSLQYVARINPMTYATAFFRTIVLEKTNLSTAELVK
FT                   EGLAIDINGFIVTPIMSFAILVAVGLIFLVLSTNSFIRTDFSRLNRSATDANEIWG"
FT   sig_peptide     276348..276461
FT                   /locus_tag="Amet_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.920 at
FT                   residue 38"
FT   gene            complement(277259..277441)
FT                   /pseudo
FT                   /locus_tag="Amet_0236"
FT   gene            277746..278450
FT                   /locus_tag="Amet_0237"
FT   CDS_pept        277746..278450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0237"
FT                   /product="abortive infection protein, putative"
FT                   /note="KEGG: cth:Cthe_2132 abortive infection protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46470"
FT                   /db_xref="GOA:A6TJV2"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV2"
FT                   /protein_id="ABR46470.1"
FT                   /translation="MVLDFFKEELIVVSDFTLKKTNLTFSLEDSPKKDFLAWNKILDGF
FT                   VKNADLGPQGIAFKSNKSENKESSNMELVSIYKYNDENIVIPAELMESRGTLKLVDFAI
FT                   PFEKLFKLGGVFVLDEFDAAIHPELIKGILALFNDSDRNKAGAQLIFTTHNPIYLNNKI
FT                   FRRDQIRFVEKDTDLYESVIYSLADFGSEEVRNDHNFLINYFKGNYGALPFIDFSKLLN
FT                   SNSGEEDEDGNL"
FT   gene            278483..278806
FT                   /locus_tag="Amet_0238"
FT   CDS_pept        278483..278806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46471"
FT                   /db_xref="GOA:A6TJV3"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV3"
FT                   /protein_id="ABR46471.1"
FT                   /translation="MVSFSLLGMPTLLEGGSLSPGQTLLAGFIASSTMMIPRVSGSAVL
FT                   IILAKVLKTLFSKYQSQILFFFSGLILGSARMLFLSEFGVLSLITFMAGVGVVYKWGRL
FT                   KYK"
FT   gene            complement(279009..280457)
FT                   /locus_tag="Amet_0239"
FT   CDS_pept        complement(279009..280457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0239"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bcz:BCZK4937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46472"
FT                   /db_xref="GOA:A6TJV4"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV4"
FT                   /protein_id="ABR46472.1"
FT                   /translation="MKFCKECGEKLTDENKDCPKCGTVVLSDPTKPATTKGITNVNFLE
FT                   NLSKKHKVIIISVLAVFIFAFIGIRIGNSIATPERFVDSFQQALIDNDMDQLSKYIVSS
FT                   DPRLKVDEGSIEAFLAHINNNPSFLGELTNSLNQQTEALEGGHDSTKEVFGDAKDNEHI
FT                   LTLRKQGKNMLFFDRYVVEPMAYYITLYTNYPDTKLYINGEEIDITHRMDFAREYGPFM
FT                   PGVYTLKAVLEGEFVDLEVEEELIIFDIYHNHVSVNLHLYGSHVNPTSNYNDTRVFANG
FT                   IDTGLTVSDISEFGPVSTDGSVVLHGVKEFPWGTIESDEVKLTGQSSAHLAIPAVNDEL
FT                   NEQLMEAMNSYYLTSIAALMELDASLLKNTTPNNVATIESDIDHYTEYGHDYHMELKEI
FT                   LYDLSSVSLFQEDGQYKAHISARQYLQYTDYSYFDENGEHAITNPDYDSQHILVYDKDA
FT                   GEWQYKDSHGLWSINTHTIKSFEF"
FT   gene            complement(280495..282039)
FT                   /locus_tag="Amet_0240"
FT   CDS_pept        complement(280495..282039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btl:BALH_4741 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46473"
FT                   /db_xref="GOA:A6TJV5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV5"
FT                   /protein_id="ABR46473.1"
FT                   /translation="MYCKKCGYANPKEALYCLNDGFALQHLKGGYHYASASSRFCNSCG
FT                   AENEKHLIYCSTCGNSLLKVKKTSFDVEGLVAATSTVKNISTKNIASITNKLEMNHFKN
FT                   ALPGSLVTIGILCIIALIIGSVISEEINMLYAEPLLYELGLGNQINNFQLISGIDIILL
FT                   VNLIGTNLTLMTNYGREAFSGSLSLSYGFYSFLLLPFLVLVIGGYITGVKNPNTSIKER
FT                   AFLSLATGGIYAGFLLLVSLISRTSTEIPLFYEPDAFVRFTLSYSFLSSILNGIVFGAL
FT                   FSFIGLLIQAGSLKAISAMVTARLYGESIYQGIVTGLKGIIISTVIVFLFLLNNAGFSS
FT                   DSTGAALFGEMFLLFIIVPQMGAYLWNMLNLASFTFSIQRFNDVESYSASILSGTEELR
FT                   HLLSYIDNFDVYFYLALLIPIALFLWAGKQIKTSSSGNLIHEILVFSGVFSIFSSFLVF
FT                   ITNFKISGSGQLFSLDFIGRMSASIGFNSIAVLFSSFILSFAIAYLSTMIFSNRSN"
FT   gene            complement(282058..282546)
FT                   /locus_tag="Amet_0241"
FT   CDS_pept        complement(282058..282546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS5094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46474"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV6"
FT                   /protein_id="ABR46474.1"
FT                   /translation="MSNLQSKLGDGFSKLQGGLEQGKTRLQTVQEINKLKKMVEDTTEK
FT                   KSKLLLDLGQLTHLWIREGKLQDSSFTEISNALTEVDQVIFTTFKKINELSANQEEENL
FT                   CECGALITPNDKFCGECGLKLEEEATKEDIEMIHCSVCQEVIISSCNFCGCCGSKLTA"
FT   gene            282958..283149
FT                   /locus_tag="Amet_0242"
FT   CDS_pept        282958..283149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46475"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV7"
FT                   /protein_id="ABR46475.1"
FT                   /translation="MHKLRLNPMVTEDLIEIRDYITKELENPTAAVNVQTDFRYLVSGS
FT                   YIVFYQADNEFVSIYNSS"
FT   gene            283240..283728
FT                   /locus_tag="Amet_0243"
FT   CDS_pept        283240..283728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0243"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   tte:TTE0676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46476"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV8"
FT                   /protein_id="ABR46476.1"
FT                   /translation="MKSYIIRIELEESNPLIWRRVVMPAGATFNRLHDIIQNVTNFQSG
FT                   YPSSGYHLFEFDLTDENKIITNDEEIYLEHQHYKKNKAMYEERLQPMPPEMLQFEEPHQ
FT                   ERLKREVRKPTGLKVDDYLEKYKEIRYAYDFGDDWHFIVKLESIVDDYYFGFPRTNGA"
FT   gene            283721..283990
FT                   /locus_tag="Amet_0244"
FT   CDS_pept        283721..283990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46477"
FT                   /db_xref="GOA:A6TJV9"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJV9"
FT                   /protein_id="ABR46477.1"
FT                   /translation="MPDTNLSKTTKDDLMIVLGDAGVNYYENERDALLKEDLEVWPITF
FT                   FFVRGNHERDPANISTYVEQPFNEGKVLIEPDYPSLLFAKDGAV"
FT   gene            284184..284462
FT                   /locus_tag="Amet_0245"
FT   CDS_pept        284184..284462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46478"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW0"
FT                   /protein_id="ABR46478.1"
FT                   /translation="MDDKLFQLMEKMYSEMQEGFKKVNTKLDSVESRMSSVEFRMDKVE
FT                   KTVLNMEDSHGKKLDVLFDGYKQNSEKLDRIEEEVNKHEEVIIRKIK"
FT   gene            284745..286013
FT                   /locus_tag="Amet_0246"
FT   CDS_pept        284745..286013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46479"
FT                   /db_xref="GOA:A6TJW1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW1"
FT                   /protein_id="ABR46479.1"
FT                   /translation="MISISSNSMKQTLHQYLMQYRSVFKKRSFDIFYWLIMGILCTEEV
FT                   RSIQIEALTTITVSIALSLIPEKLRQNTLFITIDDTLQAKYGAKFDCYAKHFDHTKKNG
FT                   TKYLNGHCFVSVVLNIPLYYQDKAKYLSIPIGYRLYSKEQNKLEMASQIIKCIMPQLEM
FT                   FQVILLCDSWYSKGSILDTVKEFDNLKIIGAVRHDTAIYDLPPAPTGKRGRPRKRGRPK
FT                   KRGRKLNTREFSYTKIGKYYVAEKKVMANLFEKPIYVTVTTTDIKPFSSIRVFISSINP
FT                   DEIKTINTALNTKGALNDQNEDECTSKTLTTYRMRWNIEVMFYQHKFFWSFGNYMVRNK
FT                   AAIERYVNLLFVAYTFACLLPFMDKRYEKYQFKSPQLIKRTVGVQITKELIFDSFVLSF
FT                   ESAKIYSTIKESVQGFLNKDWVA"
FT   gene            complement(286228..286686)
FT                   /locus_tag="Amet_0247"
FT   CDS_pept        complement(286228..286686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0247"
FT                   /product="CheC domain protein"
FT                   /note="PFAM: CheC domain protein; KEGG: cac:CAC0586 CheX
FT                   protein (uncharacterized ORF in chemotaxis operon)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46480"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW2"
FT                   /protein_id="ABR46480.1"
FT                   /translation="MEVKYINPFVQSFINIMSQIGFEDPKKIGASVKTSNLNGSGIMVI
FT                   VGIMGAIKGNVIYGIDEDSAKKIVSTMMGGVEVTELDDMAQSAISELANMLTAHSGIVF
FT                   SQSEINIDISTPTLMHGSDFQVKASTEKVLCVRMSAGEIQMDINIALH"
FT   gene            complement(286677..287543)
FT                   /locus_tag="Amet_0248"
FT   CDS_pept        complement(286677..287543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0248"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: cac:CAC0585
FT                   N-terminal CheY reciever domain fused to C-terminal
FT                   uncharacterized CheX-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46481"
FT                   /db_xref="GOA:A6TJW3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW3"
FT                   /protein_id="ABR46481.1"
FT                   /translation="MKKNKVMIVDDSSFLRNIISDILQQSGFEIVGQAGSKEEALEVYD
FT                   KTNPDIVTMDIAMPGADGFECVKALFEKNQDLKIIMISSMQDEELLTKAEKMKISGFIQ
FT                   KPFEEEDLISVVKGIMEAEENYEFLKSISTEAFKDAFNNGITRLTKKIPTAFREEEELN
FT                   QYHSKGVTTLVGVIGVYSGRMIVDMSYDTADKIAAEMLRRQTKDKEEVLNTISEFANII
FT                   CGNVCSNINKTKGLFGLRVAPPIIFYGEDLHSSTPNIHSKSLWVTTDFGEVWLNIGFKR
FT                   SEGLIWK"
FT   gene            complement(287778..289841)
FT                   /locus_tag="Amet_0249"
FT   CDS_pept        complement(287778..289841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0249"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   cac:CAC2821 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46482"
FT                   /db_xref="GOA:A6TJW4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW4"
FT                   /protein_id="ABR46482.1"
FT                   /translation="MSTKMKKKSIAISIISYVIPVVLVILVSISSIGYIFSKNIIVTQL
FT                   DNIMETKLTETVRSIENTLFTQKAITKSMAKTIESNFDNMTMADYDDLLINYISMYDET
FT                   FGMGIWFEPYAFQDLEQYAPYGYRDGPHIVADDSYTSGDLNIWTTEWYEVGKTNRDGGW
FT                   TESYFDPATEVAMVTISYPIYDPSHNLLGVVTADIDISSIQNTISTLDIDYDGSAILIE
FT                   ESGIYLGGVQEHQLITDSLKNHDNPSLVEASEGMFVNQYGKGQYIENSDNHLFYYETIP
FT                   ETGWKIGIQVNESTLFEDLNSLLLIFVMTSIVSIILVIILIAIFANNIRKVTKRYSDVA
FT                   QNVSNGNLKNVFHEKELTRKDELGDIGRSLNEMQNKLKEVVESFKLNATNIDEHAQNLS
FT                   AFSEEMSTTSEGVSLAIEDVAEGASNQFQKLKDVGNVINRFGNDVDFMSQSIDDVEHSA
FT                   EDIKNMANTSNEEMNKMTASFEKLDSTFKDLINCVRSVQSNINQVNEVTSLINSISNQT
FT                   NLLSLNAAIEAARAGEAGRGFAVVADEIRKLAEQSTQSSEEIDKIISDIAIDTEKMVAS
FT                   TEEVNIEVSSQRNHIDTTINSFKNIIQLVENITPKVALTKEISERINQDKNLVLGEIEA
FT                   TGGISENVAASAEEIAASAEEMTASAQEVSASSTDLSGMTNEMRENIKFFKI"
FT   sig_peptide     complement(289728..289841)
FT                   /locus_tag="Amet_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.765) with cleavage site probability 0.356 at
FT                   residue 38"
FT   gene            290395..290745
FT                   /locus_tag="Amet_0250"
FT   CDS_pept        290395..290745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0250"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: ctc:CTC02181
FT                   ethanolamine utilization protein eutS"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46483"
FT                   /db_xref="GOA:A6TJW5"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW5"
FT                   /protein_id="ABR46483.1"
FT                   /translation="MATEEKQRMVQEYVPGKQVTLAHLIAHPQHSIYKKLGLIEDEYNA
FT                   IGILTITPGEAAIIAADVATKSASVEIGFLDRFSGSLVITGDVASVESALLGVIESLTN
FT                   TLQFTPAELTRS"
FT   gene            290757..291185
FT                   /locus_tag="Amet_0251"
FT   CDS_pept        290757..291185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0251"
FT                   /product="ethanolamine utilization protein, EutP"
FT                   /note="TIGRFAM: ethanolamine utilization protein, EutP;
FT                   KEGG: ctc:CTC02180 ethanolamine utilization protein eutP"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46484"
FT                   /db_xref="GOA:A6TJW6"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW6"
FT                   /protein_id="ABR46484.1"
FT                   /translation="MKKVILVGRTGSGKTSLSQRLNQQELIYKKTQAMEFSDRVLDTPG
FT                   EYIENRRFYYAIISASADCDVIGILQAIDEPNCIFPPGFGNFFNKPVIGIITKIDLEHD
FT                   SGNVESDLYAAGAQQIFRISAVTGEGLEELRVYMEEVD"
FT   gene            291290..291859
FT                   /locus_tag="Amet_0252"
FT   CDS_pept        291290..291859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0252"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; ANTAR domain
FT                   protein; KEGG: ctc:CTC02179 ethanolamine utilization
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46485"
FT                   /db_xref="GOA:A6TJW7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW7"
FT                   /protein_id="ABR46485.1"
FT                   /translation="MKGRVVIADDEPITRMDIVEMLLEEGYDIVGEASDGFDAIELCKK
FT                   HKPDLVLMDVKMPLLNGLKAAEVINQDELAACVVLVTAYSGREFVEEAKKAGAMGYVVK
FT                   PINEKNLLPTLEVAVSKSKEFNEMKSQVKKAQVQLEDRKQIERAKGILMKKEMLSEEEA
FT                   YNQIRKLSMSKRCSMGEIAKIITMNQ"
FT   gene            291882..293291
FT                   /locus_tag="Amet_0253"
FT   CDS_pept        291882..293291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0253"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, dimerisation/phosphoacceptor; KEGG:
FT                   cac:CAC2720 sensory protein containing histidine kinase,
FT                   PAS anf GAF domains"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46486"
FT                   /db_xref="GOA:A6TJW8"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW8"
FT                   /protein_id="ABR46486.1"
FT                   /translation="MLQELCKTYTQLSDSDILILENAKQMLPLISSAIRADVFIDCLTN
FT                   IPNTAIVVAEAKQSQKESMYQHSVVGKFALGENEPAALRTLETGLASRDLKALTQENKT
FT                   VRQSVEPIRNKEDQMIGVLIIEQDITKDIKRDKEMENLLQTAEKLTETVSTLKGAESTI
FT                   IHHVNEAIIMFNRNGIATYCNPEAHQLYKKLGYQDEIVGLSFNNLTLGGMTFSGVIHKD
FT                   LVNVVEVKVGKLSLRVKYVAMEDENEVIGFIMIINDVTEVKEKEMELVSKSVVISEIHH
FT                   RVKNNLQTIASLLRLQSRRIHEVKAKQAFNESISRILSIAITHELLAQRGVDDVDLRTI
FT                   LERIKESTMDYVISPDKMISISIEGDHIIVNSDKATSIALVVNELLQNALEHGFKGRQE
FT                   GKIRIHIRKSDIYTDVTVVDSGLGFDAEKVKTKSLGLSIVKSIVRERLYGNLQMNSSNQ
FT                   GTEIRFNFKNK"
FT   gene            293398..294831
FT                   /locus_tag="Amet_0254"
FT   CDS_pept        293398..294831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0254"
FT                   /product="Ethanolamine utilisation EutA"
FT                   /note="PFAM: Ethanolamine utilisation EutA; KEGG:
FT                   ctc:CTC02177 ethanolamine utilization protein eutA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46487"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJW9"
FT                   /protein_id="ABR46487.1"
FT                   /translation="MTEEVFSVGIDIGTSTTQLVFSKLTIENTASMMAIPKIQIIDKEV
FT                   VYRSDIHFTPLLSDTRIDGDAIRRIIELEYKKANISFEKIDTGAVIITGETARKENANE
FT                   ILSTLSGLAGDFVVATAGPDLESIIAGKGAGAGKFSKEKGCTVANLDVGGGTTNIAIFK
FT                   NGEVIDTACLDIGGRLIKFANDQLKVSYASGKIKVLAKEIGIDVEVGNKLSVEEVERIS
FT                   RRMGEVLAESIGLIPETTLLQKMLTGTSLKRQGEIDCISFSGGVADCIFNKEIAPPFKY
FT                   GDIGIVLGKSIASSPWLETAKVIQASETIGATVVGAGTHTTEISGSTITIEASILPMKN
FT                   IPILRLNQEDEELVYDQLSHRIAEKLDWFRLENGQQLVALAMRGLKNPSFKEIQGLAKA
FT                   IIKGMENKLGEKQPLIIVVEQDMGKILGQGIHAHLAGKRDVICIDSIKVDNGDYIDIGK
FT                   PLANGKVVPVIVKTLVFNY"
FT   gene            294851..296218
FT                   /locus_tag="Amet_0255"
FT   CDS_pept        294851..296218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0255"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: cpf:CPF_0891 ethanolamine ammonia-lyase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46488"
FT                   /db_xref="GOA:A6TJX0"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX0"
FT                   /protein_id="ABR46488.1"
FT                   /translation="MILKSKLFGTVYQFKSLNEVMAKANEERSGDKLAGLAAESVTEMV
FT                   AAKEVLSNITLKDIRNNPAVPYETDEVTRVIQDGVNEKIYKEIQNWTVSELREWILSNE
FT                   TTGSDIKRIGRGLTSEMVAAVTKLMSNLDLVYGAKKIIVTAHCNTTIGESGTLAYRLQP
FT                   NHTTDNIEGIKVSLYEGLSYGVGDAVLGLNPVNDTVNSVKNVLNLFEEVKQKWQIPTQT
FT                   CVLAHITTQMEAIRQGAPSDMIFQSIAGTEKGNEAFGLNDSLLSEARELVLKEGTSTGP
FT                   NVMYFETGQGSELSSDAHMGVDQVTLEARCYGLAKKHSPFLVNTVVGFIGPEYLYNSKQ
FT                   VMRAGLEDHFMGKLSGIPMGVDVCYTNHMKADQNDIENLSVLLASAGCNFLIGTPAGDD
FT                   IMLNYQSSSFHDAATLRELLNLTPIPEFQKWLEKMGISENGRLSKRAGDASIFFSK"
FT   gene            296244..297143
FT                   /locus_tag="Amet_0256"
FT   CDS_pept        296244..297143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0256"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   ctc:CTC02175 ethanolamine ammonia-lyase light chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46489"
FT                   /db_xref="GOA:A6TJX1"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX1"
FT                   /protein_id="ABR46489.1"
FT                   /translation="MISEQAVKEMVQQIVEQMTIGQKQTTEDKYTQETDGKEQPEICIE
FT                   DKNLKDLTEIKMQDYFAVPNPENKEVYLGLKEQTPARVGIWRTGSRNSTETLLRFRADH
FT                   AVAMDAVFTYVSEELLEEVGLFSVNTLCRNKDEYMTRPDLGRKFSQETIEMIKEKCVKS
FT                   PQVQIYVSDGLSSTAIEANIKDILPSIMQGLENEGLKVGTPFFVKHGRVPAMDVISETL
FT                   DAGATVVLIGERPGLATGESMSCYMTYGGTVGMPESRRTVISNIHRGGTPATEAGAHIA
FT                   QIVKEMINQKASGLDLKL"
FT   gene            297167..297820
FT                   /locus_tag="Amet_0257"
FT   CDS_pept        297167..297820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0257"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: fnu:FN0081
FT                   ethanolamine utilization protein eutL"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46490"
FT                   /db_xref="GOA:A6TJX2"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX2"
FT                   /protein_id="ABR46490.1"
FT                   /translation="MKNDALRASVLSAKIISNASPDMIKELKLEPGHRSIGILTADSDD
FT                   VLYTALDEATKKADIKVAYAKSFYGGAANANTKLAGEVIGIISGPNPAEVRSGLDAVID
FT                   FAENNACFYSANEDDSIAYYAHCISRTGSYLSEVAGIKEGEAIAYVIAPPMEAIYALDA
FT                   AMKAADVEMVCFYGPPSETNFGGGLLTGSQSACKAACDAFAEAVKFVADNPTKY"
FT   gene            297838..298458
FT                   /locus_tag="Amet_0258"
FT   CDS_pept        297838..298458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0258"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: lmo:lmo1178
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46491"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX3"
FT                   /protein_id="ABR46491.1"
FT                   /translation="MSNNALGLLETYGYTPSIVALDAALKTANVTLKDFQITGGGLVTM
FT                   MVEGDVAAVQAAIEAGNIAAETIGRVISQHVIPRPDIGLKSLLQSHEGKNKQPVEGPVS
FT                   ISLDEESQELEEKEATQELEEAPSQKLEEVEIQNKSENPGNHHNGKEIKIRSKKDLNRM
FT                   KVVELRKMARGLDGFSMEAKTIKFANKSELVAALLSHFRMEVE"
FT   gene            298459..299910
FT                   /locus_tag="Amet_0259"
FT   CDS_pept        298459..299910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0259"
FT                   /product="acetaldehyde dehydrogenase (acetylating)"
FT                   /note="TIGRFAM: acetaldehyde dehydrogenase (acetylating);
FT                   KEGG: dde:Dde_3279 aldehyde dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46492"
FT                   /db_xref="GOA:A6TJX4"
FT                   /db_xref="InterPro:IPR013357"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX4"
FT                   /protein_id="ABR46492.1"
FT                   /translation="MQLQDKDLLSIQEVRDMVSKANKAQTEFSKFSQEAIDEIVYGMKQ
FT                   AAYSQAEFLGKFASEETGFGKWQDKKTKNEIASEGVYNHIQNMKTIGVIHEDAEKKIVE
FT                   IGTPVGTIAALIPSTNPTSTVIYKALIALKSGNAIIFSPHPSGLKSILKTVEILNKAAV
FT                   EAGAPDGLLHCMTLPSMEGTSELMKHSGVDLILATGGSAMVKAAYSSGTPALGVGPGNV
FT                   PVFIERSADIKEAIGKIFSSKTFDNGTVCASEQAIVTERCISEKVKEEVKRQGGYFLVG
FT                   EQLEKVTAIMETVTGGMNPKIVGRSAQDIATIAGIEIPKETKILLCEEQNVGKNVPFSK
FT                   EKLTALLGFYTVEDWQKGCELCYALLENGGLGHTLAIHSQDESIIREFALKKPVSRILV
FT                   NTPSTQGAIGLSTNLAPSFTLGCGAIGGSATSDNVGPMNLINIRRMAYGIDDCRERETQ
FT                   DSKELSSIDIEVITQLVMESLKNKI"
FT   gene            299934..300218
FT                   /locus_tag="Amet_0260"
FT   CDS_pept        299934..300218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0260"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: lwe:lwe1138
FT                   propanediol/ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46493"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX5"
FT                   /protein_id="ABR46493.1"
FT                   /translation="MAISNALGMIETKGLVGAIEAADAMVKAANVTLLGKEHVGGGLVT
FT                   VMVRGDVGAVKAATDAGAAAAERVGELMSVHVIPRPHGEVETILPQIKE"
FT   gene            300284..301057
FT                   /locus_tag="Amet_0261"
FT   CDS_pept        300284..301057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0261"
FT                   /product="cobalamin adenosyltransferase"
FT                   /note="PFAM: cobalamin adenosyltransferase; KEGG:
FT                   ctc:CTC02171 ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46494"
FT                   /db_xref="GOA:A6TJX6"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX6"
FT                   /protein_id="ABR46494.1"
FT                   /translation="MKVLTETSLRMEFKNKFPKTYSINSGILVTPSAKQYLKEKRIELI
FT                   VEEEQDLEKQEVVSTDPKEVNQKQKQQVLPKYKCYFSGGFFESKPEHMTQLHGNFLVNK
FT                   DHPRIVLRGKLDSFQAQILEVQVILNNRKEKKLLADLSEVLTFVRSILRAEVLEEPFNQ
FT                   CEILGLGEAELRKMSHNPEQFFDVNHFLPDYSMGTVLIKLNSLRSAAREVEIVGVKAFT
FT                   GANGDIKRVDMIQALNRLSSCLYIMMCRWQGGYYK"
FT   gene            301076..301714
FT                   /locus_tag="Amet_0262"
FT   CDS_pept        301076..301714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0262"
FT                   /product="Propanediol utilization protein"
FT                   /note="PFAM: Propanediol utilization protein; KEGG:
FT                   ssa:SSA_0527 propanediol utilization protein PduL"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46495"
FT                   /db_xref="GOA:A6TJX7"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TJX7"
FT                   /protein_id="ABR46495.1"
FT                   /translation="MKEEQIKQIVEQVIKTFEEAQSVPMEVPVEVSARHIHLSKEHISL
FT                   LFGSEDQLSIIKELSQPGQFQYDKRVTLIGPKGSIGNVAILGPSRDETQVEISYTDARA
FT                   LGIKPPLRESGDLQDTAGIIIATGHKAINLEGGVMIAKRHIHMTPKDAEVFHVKDGEHV
FT                   KVRIESKRPIVLEDVLVRVNEKYGLSMHIDHDEGNAAAYQPGTTGKMIK"
FT   gene            301730..302551
FT                   /locus_tag="Amet_0263"
FT   CDS_pept        301730..302551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0263"
FT                   /product="ethanolamine utilization protein EutJ family
FT                   protein"
FT                   /note="TIGRFAM: ethanolamine utilization protein EutJ
FT                   family protein; KEGG: ctc:CTC02168 ethanolamine utilization
FT                   protein EutJ"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46496"
FT                   /db_xref="GOA:A6TJX8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX8"
FT                   /protein_id="ABR46496.1"
FT                   /translation="MDFTQVNDLVSQVEKSIHETFPFDRSKELLVGVDLGTAYVVIVVL
FT                   DQQNNPIACEMEFAQVVRDGLVVDYIGATQIVRKLKEKLEKRLGQSLLKAAIALPPGTG
FT                   SKDSRTHNYVVEGAGLEVVSVVDEPTAANNVLQVKNGVIVDIGGGTTGLSIIKNDEVIH
FT                   TVDEATGGTHLSLVLAGNYRVKFEEAEKIKKDPTRKKEVLAIVRPVIQKMASIIQNNIV
FT                   DYDVETIYLVGGTCCLDGFEDVVEKETGISTQKPHNPFLVTPLGIAMNCRE"
FT   gene            302563..303300
FT                   /locus_tag="Amet_0264"
FT   CDS_pept        302563..303300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC02167 putative ethanolamine utilization
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46497"
FT                   /db_xref="InterPro:IPR013372"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJX9"
FT                   /protein_id="ABR46497.1"
FT                   /translation="MEIEVLVQKITEEVMKQLKGRQKNEKPQFSKKALILSDKNPINKQ
FT                   EIRQLETMGVECVSLGECPEDEIRNMDYIILLTLPLSSLSYIARGVEGDEISKGAIGGL
FT                   LYGKEIFVLCEGIEHRKFEQTSQHHFYQMYMDYEKKLQGFGVKIGTLKKILSLLNQKPQ
FT                   QEQSSTEAIKQAEEIRKTEESVKTEQVDEKESPLISNKLITENTLKEMGCREKSRISIT
FT                   AKAIVTPMANDYIRMMKIQVIRV"
FT   gene            303319..303603
FT                   /locus_tag="Amet_0265"
FT   CDS_pept        303319..303603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0265"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   dde:Dde_3273 ethanolamine utilization protein EutN"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46498"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY0"
FT                   /protein_id="ABR46498.1"
FT                   /translation="MIIGKVIGNVWATRKDETLNGLKLLVIESIDYGRNQRGESFVAVD
FT                   GVGAGIGERVLVVKGNAARKALQKEGAAVDATIVGIIDEVEVTLQNNSE"
FT   gene            303615..304961
FT                   /locus_tag="Amet_0266"
FT   CDS_pept        303615..304961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0266"
FT                   /product="Respiratory-chain NADH dehydrogenase domain, 51
FT                   kDa subunit"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Respiratory-chain NADH dehydrogenase domain, 51
FT                   kDa subunit; KEGG: lmf:LMOf2365_1149 PduS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46499"
FT                   /db_xref="GOA:A6TJY1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017054"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY1"
FT                   /protein_id="ABR46499.1"
FT                   /translation="MDILEKIFEAGVVGAGGAGFPTHIKLDGVAEYLLVNAVECEPLLE
FT                   TDKFITRHKSEEIIKAMEIMGNHIQAKEMVIGLKKKNTKEIQALREAIQCLKSKVTLHL
FT                   VENFYPAGDEQMLVYEITKRQVPPGGIPKDVGVVVCNVGTVVNIYEALNEKPVTHKLVT
FT                   ILGEVKNPSMVYAPIGTPIEKCIEMVGGPTIQAYRIVLGGPMMGRVIEKSQLNQEVVTK
FT                   TTGGIIVLPEEHFMLRDKQQDLTQMINRSRSTCIQCSLCTDLCPRNLIGHPLRPHRIMR
FT                   TLSGDKEQYGVLKEALLCCECGVCEVYACPMGQTPKNINVEIKNLLRQEGIRYSDTSVK
FT                   NEVNGMREYRKVPAERLLARLELSGYADQVKDGYCSIEPHRVKIPLKQHIGKPATPIVE
FT                   VGSLVEKGQLIARVNAGDLGANIHASMQGVVSEINEFIWIEAGEKAVIQ"
FT   gene            304958..305506
FT                   /locus_tag="Amet_0267"
FT   CDS_pept        304958..305506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0267"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: maq:Maqu_1244
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46500"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY2"
FT                   /protein_id="ABR46500.1"
FT                   /translation="MIKTIGLIELNSIAKGIETGDAMVKTANVELLKAHSVCPGKYILL
FT                   ICGDVGAVETAIETGIKIGGGYVVDHLILPSIHPQLIDAIHGTNSVQEVSAIGVLEFFN
FT                   IATSIVAADAAAKAAAVTLMEIRLGLSIGGKSFVTLCGDVSSVQEAVEAGATIGKEKGM
FT                   LVEKCVIPSPRKELFEKLL"
FT   gene            305531..306634
FT                   /locus_tag="Amet_0268"
FT   CDS_pept        305531..306634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0268"
FT                   /product="Ethanolamine utilisation protein, EutH"
FT                   /note="PFAM: Ethanolamine utilisation protein, EutH; KEGG:
FT                   lin:lin1150 similar to ethanolamine utilization protein
FT                   EutH - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46501"
FT                   /db_xref="GOA:A6TJY3"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY3"
FT                   /protein_id="ABR46501.1"
FT                   /translation="MNINEIIVYIMVGFMVLGALDKIIGNKYGLGEKFDEGMIAMGSLA
FT                   VAMVGVVSLAPVLATILEPMVVPVYTFLGADPAMFATTLLANDMGGYPLAMQLAQTQEA
FT                   GLFAGLILGAMMGPTIVFTIPVALGIIKKEDHKYLATGVLAGMVTIPIGAFVGGVVAGF
FT                   DISMILSNLVPIILVSLLLSLGLWKMPEKMIKGFTVFGKGVVVVITIGLAAIIVETLTG
FT                   FVVIPGMAPISDGIEIVGEIAIMLAGAFPMVYVVTKVFNKPLMKMGKLLGMGDVAAAGM
FT                   VATLANNIPMFGLMKDMDNRGKIINVAFAVSASFVLGDHLGFTAGVNQDMIFPMVVGKM
FT                   VGGVTAVMVAIFIANKSMSKEDAVKQH"
FT   gene            306753..307928
FT                   /locus_tag="Amet_0269"
FT   CDS_pept        306753..307928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0269"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   ctc:CTC02182 alcetaldehyde dehydrogenase or NADPH-dependent
FT                   butanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46502"
FT                   /db_xref="GOA:A6TJY4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY4"
FT                   /protein_id="ABR46502.1"
FT                   /translation="MKNFKEMTEIVHGIDAIQYLERFKNKRACIVTDPTMVQLKVVDRV
FT                   TEIFDRNKIDYDVFSEVEPDPSFGVVYKGLNHIIKNKPELLIAVGGGSAIDAAKAIMYF
FT                   CIKIKESLLDTQEIPKPFFIAIPTTSGTGSEVTAYSVITDKEKNIKIPIIDSLMVPDVA
FT                   ILDPIFTKTIPSHVTADTGIDVLTHCVEAYVSKDASDFTDALVEKATVQVFRYLPVAYK
FT                   DGSNMEAREKLHNASCMAGIAFTNAGLGINHSMAHSLGSHFKMSHGRSNAILMPYIIAF
FT                   NSKGQDKTGYNPAAVKYAELAKYIGLPNSTVETGVLGLIEAIKVMKIAMGIPATIKEAG
FT                   VDRESFMNSLDEISAMALEDICTSSNPKKVSKEDIKNIYLEAYDRNSGLSF"
FT   gene            308423..308977
FT                   /locus_tag="Amet_0270"
FT   CDS_pept        308423..308977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0270"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: ctc:CTC01854 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46503"
FT                   /db_xref="GOA:A6TJY5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY5"
FT                   /protein_id="ABR46503.1"
FT                   /translation="MTQTTKKAMAASLKERLEKTTLQNITVKDIVKDCEINRQTFYYHF
FT                   QDSFALMEWIFETEGTKAISNNKTYDTWERGFLQAFQYVEQNKMLVLNAYHSMGREHVE
FT                   RYLYSVVYRLLINVINEQAKGMNVPEDDKGFIAHFYKYVFVGLMLEWIHQGMKECPKDI
FT                   VDRLSKLITGDIHKALLKYEQ"
FT   gene            309097..310761
FT                   /locus_tag="Amet_0271"
FT   CDS_pept        309097..310761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0271"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /note="PFAM: 67 kDa myosin-cross-reactive antigen family
FT                   protein; KEGG: ctc:CTC01855 67 kDa myosin-crossreactive
FT                   streptococcal antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46504"
FT                   /db_xref="GOA:A6TJY6"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY6"
FT                   /protein_id="ABR46504.1"
FT                   /translation="MCLNRIVYNGVTRKNLVNNILLEGITMKKDYGNKQVYFVGGGIAS
FT                   LAGAAYLIRDCHFKGENIHILEGMHILGGSNDGMGTPEDGFVCRGGRMLNEETYENFWE
FT                   LFSSIPSIEHEGMSVTDEILAFDHAHPTHANARLINKDGEVLDVMSMGFDKEDQMAMGK
FT                   LLLTPEEKLDHLKISDWFGPHFFETNFWYMWQTTFAFQKWSSLFEFQRYMFRMIFEFSR
FT                   IQTLEGVTRTPYNQYESIILPMKAYLDDHGVDFTIKCTVTDLDFKEGEGITVTTIHYQD
FT                   QDGDGIIRLQEDDICIVTNGCMTDGATLGDLYTPAPLKPEHPISGDLWANIAAKKSGLG
FT                   DPKPFFGNAEETNWESFTVTMKGNKLLKMIEKYSRNVPGSGALMTFKDSSWLMSMVVAA
FT                   QPHFKAQTADETIFWGYALHTNKVGDYVKKPMRDCTGEEMLIELLHHLHFDEEMDEIMK
FT                   DVVNVIPCMMPYIISQFQPRAMTDRPQVVPEGSTNLAMISQFVEIPEDMVFTEEFSVRA
FT                   ARIAVYTLMGLDKKICPVTPHRYDVRTLLKALNTCYR"
FT   gene            310773..311063
FT                   /locus_tag="Amet_0272"
FT   CDS_pept        310773..311063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46505"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY7"
FT                   /protein_id="ABR46505.1"
FT                   /translation="MMNGSYNITMITPLGPEKGTILLNADEEKLSGILKIMGNEKEFTG
FT                   TAKGNSFEFSSELKKLITKIPFSAKGTVNGDTMEANIDSKFGQMKIIGKKA"
FT   gene            311419..312342
FT                   /locus_tag="Amet_0273"
FT   CDS_pept        311419..312342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46506"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY8"
FT                   /protein_id="ABR46506.1"
FT                   /translation="MRKKLGLMAIILMVSLALLGCGPKVGQGKDYGTYDEDTRVFILNE
FT                   KAFEDAEKVKMDKIQEKTPWQLYVAKFGFSEVVYLQVIRSKGKYSEIQFLDMEYQGYMI
FT                   SDHEGEVVLDKVPRIMLDRDYEESLFAEMLQEGSTEGFEAFFQRAMYQWEKSSATYDNS
FT                   RFTLFHQQLEEDPQYGKVIAFYSEEGHRIAIDKTEDHQMGFLIGPYREEELALAKAITS
FT                   ETEKEVQEMAVKDADVDKEYIVAKVDPADYADVIKKLTKSRKGQLEDYGVGDVNGDGEV
FT                   DYIILNSIPPIQWYWTKVNGRTVCIM"
FT   sig_peptide     311419..311481
FT                   /locus_tag="Amet_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.942 at
FT                   residue 21"
FT   gene            312330..312653
FT                   /locus_tag="Amet_0274"
FT   CDS_pept        312330..312653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46507"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJY9"
FT                   /protein_id="ABR46507.1"
FT                   /translation="MYYVARGGNPKDLAYYKDAISVDTKNRLLVERQLIVSPIGGMGLG
FT                   NIQERYQWKTNKWQLVDVKVTPYNFKLETSKGVRDQTLKETLKNHKVVVNEKNVDKLLM
FT                   LSK"
FT   gene            312825..312986
FT                   /locus_tag="Amet_0275"
FT   CDS_pept        312825..312986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46508"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ0"
FT                   /protein_id="ABR46508.1"
FT                   /translation="MSIEEVEKVLGKPQEGSIDTTGETEDYILYNIKGRQVLFIIEEGR
FT                   VVVSIIKA"
FT   gene            313020..313223
FT                   /locus_tag="Amet_0276"
FT   CDS_pept        313020..313223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46509"
FT                   /db_xref="GOA:A6TJZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ1"
FT                   /protein_id="ABR46509.1"
FT                   /translation="MNGQSKEGIVLRLAIVTYLIGTMMFLNGDSEAQDAYTKEVLPSVM
FT                   AVQGDNDGGLEISEGKYETLPN"
FT   gene            313292..315139
FT                   /locus_tag="Amet_0277"
FT   CDS_pept        313292..315139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0277"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; CoA-binding domain
FT                   protein; polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: cth:Cthe_2334 polysaccharide biosynthesis
FT                   protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46510"
FT                   /db_xref="GOA:A6TJZ2"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ2"
FT                   /protein_id="ABR46510.1"
FT                   /translation="MKKRVLSGLLMMMDAAMINIAVVIAFYIRFDGAFSGRFAGQYIPI
FT                   YTDNLLTFTLIKIALFYAFGMYQNLWKYASIEAVFQIMIAAFVANTGVVSYMVLTQQGH
FT                   LPRSIYLLMFILDMLLVGGIRFSYRATRGLREHGFIRRKNCKRVMIVGAGTAGAVVIKE
FT                   LKIHDNLNYKPVAVIDDDESKLGSKINGVPVLGDRYHIKKVAEMKQVDEIIIAIPSGFR
FT                   QELKEIVEECSKTKCKLKILPGIGELIDGKVSMKKARDVEIEDLLGRDAINIDLEEISE
FT                   YLHNQVVLITGGGGSIGSELCRQIATFNPKKLLILDNYENNAYDIQNELRRKYPELNLE
FT                   VLIASVRERDRIEEIFGQYLPEVIFHAAAHKHVPLMEANPQEAIKNNIFGTKNVAECAD
FT                   QFGAKRFVLISTDKAVNPTNIMGATKRVAEMLIQSIDLTSKTEFVAVRFGNVLGSNGSV
FT                   IPLFKRQIAEGGPVTVTHPEVTRYFMTIPEAVQLVIQAGSMASGGEIFVLDMGEPVKII
FT                   DLARNLIRLSGMEPDVDMDIKVVGLRPGEKLYEELLMDEEGLESTKHDKIFVGKPFFTD
FT                   LKFLERELDILSDLLLLRDQEEVKEYMVKIVPTYHRETS"
FT   gene            315467..315841
FT                   /locus_tag="Amet_0278"
FT   CDS_pept        315467..315841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0278"
FT                   /product="putative small multi-drug export"
FT                   /note="PFAM: putative small multi-drug export; KEGG:
FT                   ctc:CTC02518 putative small multi-drug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46511"
FT                   /db_xref="GOA:A6TJZ3"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ3"
FT                   /protein_id="ABR46511.1"
FT                   /translation="MSPLHATMVSFAGSMLPVPFLICAIRPVFDILKKTRLFGGMIHRL
FT                   SARTLRNSEKVKKYGFWGLILFVSIPLPGTGVWSGTLAAVLLDMRFKIAFPAILIGNTI
FT                   AAIVIMTLSYGALGAINLLP"
FT   gene            316112..316532
FT                   /pseudo
FT                   /locus_tag="Amet_0279"
FT   gene            316547..316711
FT                   /locus_tag="Amet_0280"
FT   CDS_pept        316547..316711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46512"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ4"
FT                   /protein_id="ABR46512.1"
FT                   /translation="MNGNYNITILTPLGAEKGTIFLDADGEKLNGILKIMGKSIIIRNA
FT                   MQVQCIFIQ"
FT   gene            317101..317580
FT                   /locus_tag="Amet_0281"
FT   CDS_pept        317101..317580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46513"
FT                   /db_xref="GOA:A6TJZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ5"
FT                   /protein_id="ABR46513.1"
FT                   /translation="MRKPMYIIVLQFVLILMILILTLTSLNIVEVENIYGMQPLNRDSI
FT                   HNVVVAYEGGLDVSNVISRIGERRESLRERIERSRDTYENLKSNNSREIIIKKRSKVME
FT                   RVDAEGDRVCVEDTEYNHMEGKNKKYLAYNPRYLIIKNQIIRGHAIGLRSPPVYV"
FT   gene            317649..318815
FT                   /locus_tag="Amet_0282"
FT   CDS_pept        317649..318815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0282"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dsy:DSY3360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46514"
FT                   /db_xref="GOA:A6TJZ6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ6"
FT                   /protein_id="ABR46514.1"
FT                   /translation="MKSYKKAILTIFLISTTFLYGCSQTAANEIEEVLKPVKVKVVETQ
FT                   EYSKDMEISGNVKPAQLIRSGFKVAGVIDHIHVEEGDIVKEGQTLMQLDPYDYQLGVNA
FT                   ARSQYQALQKQAESSINSGVNQAVAHLEFVNTQYDRMLKLYEEGAIPKKTLEEVETQIV
FT                   VAQNKYQESLDASPIAEAQLDQARTGLEAAESKIGDTILKSPITGTVIKRTFEVGETVA
FT                   PGHPTIILGRLDKLEVEIGVPDGLVDNIRIGKNVDVFIYGLDKEIKGTIASIDTTADLE
FT                   TRTFGVKVEIDNKENRIRPGMIAKVMMNTDKLTTIMIPTNAVMNDPDGAKIFVYQEEGY
FT                   VVERRVILGEIFGDEIQVIEGLENGEKIVIEGHYRLIDGDNVKVEVVE"
FT   sig_peptide     317649..317732
FT                   /locus_tag="Amet_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.625 at
FT                   residue 28"
FT   gene            318815..321895
FT                   /locus_tag="Amet_0283"
FT   CDS_pept        318815..321895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0283"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   swo:Swol_1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46515"
FT                   /db_xref="GOA:A6TJZ7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ7"
FT                   /protein_id="ABR46515.1"
FT                   /translation="MTKWCLEHRSIVAVLSIFIFLSGIFVYTTMERQENPDVVAPGATV
FT                   KTIYPGATPEDIEKFIVKPLESKIGEIPDVKMMLSYSLDNVGVIIIRLEDLSDEDINET
FT                   WNLLRQKVDEAELPEQAWDPEIDTDLIDTYGMLFTISGDRFEYKELKSIADELQEELEK
FT                   MDGIAQVDINGYIDEEIHINLDLLRMKHFNIPVETIGMALKATNINIPGGSLKLRGTNV
FT                   PISTTGEYKNIHDIENTIVGMSEAGNVIYLKDVADIEQVEGDRDVFVGSNGEKALLMNL
FT                   KYSDGENIVNIGEEVMTFLEEYKNTIAEDMNITVITDQAEYVEDAINLFEKNLLSAISL
FT                   VVVVVLISMGYRSALVVSSAIPITVMATFAFMRFTGIVLHQVSISSLIVCLGLLVANAI
FT                   VANDSMDLYLSKGMSRKEAIVYGINEVKIPILTSTLTTVASFLPLLLMEGVAGKFVKSL
FT                   PIMVTVALFSSFILSLTVVPAMGYTFLKGSQGEKKKSLFSDVSDFFLKQYKFILKATLK
FT                   MPIITILVAMGLLVFSTTMISSLGLQLFPFVERDQYVIDVTLIEGTSAEKTKEVITEIE
FT                   EMLKEDPSVDSFLSKVGDGIPKFYPSFVPNQIASNQAQFVVNGKVSEMVALQDRIDQTV
FT                   VGARVEVKQLENAVPVGLPIQVRVSGNDIDTLIRTSNEIKEILYTVEEGQHVQDDYGHE
FT                   VLKMVIDVNQDKASMVGITNYDIASTVRMAINGHEVIKMRPDDTDDDIPVVLRIPTDEK
FT                   NTVQVLDNIFVTSQFTGRNVPIQQIADIHSEFSLSRILRRDRDRTITVGLYPKPGYSAA
FT                   EVLNVVEERMEGFEVPQGYMMEFGGESEDRTEAFESLIGPFFLAAMLIYVILMFQFMDL
FT                   RQPLIIMGTIPLSFIGVIWGLKITGYPLGFMALMGTVSLMGIVVNNGIVLLDYINILAK
FT                   SGIEAKEAVIEACATRLRPIMIGMITTVIGLVPMALIGGSLWAPLAYAIIFGLMVSSIL
FT                   TMLVIPSAFMLFRRRDKKGNGIIDEALTDKEIKETVS"
FT   gene            322249..322836
FT                   /locus_tag="Amet_0284"
FT   CDS_pept        322249..322836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpf:CPF_0240 putative co-chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46516"
FT                   /db_xref="GOA:A6TJZ8"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ8"
FT                   /protein_id="ABR46516.1"
FT                   /translation="MIDVRKEIEKYEPIDLAQEEELQQDEFIEVLQHLQKSLNRFGKDQ
FT                   YKTLGQVEEVLELLEASEEKDKVYGDLRKEAKKKDEEIDALLLAIIMVTDALEDLYYYT
FT                   VKNNEGSWAEQLSLLWEKLGQKLSYYGIVRIGEEGTTFSSHHGIAEGISKDANRSHGEI
FT                   VEVIQLGYVYRGRVLRKARVIVNENEERVKYE"
FT   gene            322833..324542
FT                   /locus_tag="Amet_0285"
FT   CDS_pept        322833..324542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0285"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: Heat shock protein 70; KEGG: cno:NT01CX_1453
FT                   DNAk protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46517"
FT                   /db_xref="GOA:A6TJZ9"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:A6TJZ9"
FT                   /protein_id="ABR46517.1"
FT                   /translation="MSKIIGIDLGTSTSEVGIFETGKPIVIGNHLNEKITPSVVGLGEE
FT                   GQLIIGRDAKDQMLFKPEDTVMEVKRLMGSREKVKMGGKEYRPQEMSSFILKYLKECAE
FT                   AYLEEEVLRAVITVPAYFTDEQRRATVEAGGLAGLKVERIINEPTAAALAYGIDHMDEN
FT                   QHILVYDLGGGTLDVTVLEMFEGVLEVKASSGNNQLGGKDFDQKLIDYLCDRFFEQYHI
FT                   DLRSDLRAMAKLKKSAEECKITLSGHEAYHVLIPFIAEKEGNPVSLEETITRQVFESLI
FT                   EEIVQSTLKPITIALKDAKLTSKDLDLILMVGGSTRVPLVKSVVDHHLGQGSQSLVDPD
FT                   LAVVTGAAIQAGMINEDLSPETDIVITDVCPYTLGVETMDFIMGMPLEDVYDVIIPRNT
FT                   TIPVMREKIYTTVSDDQEMVEIIVYQGDYEKASLNNLLGKFELSGIPPAKASTEKIKIR
FT                   FTYDVNGILQVEGMIVSTGKQAQITIDTTGVEMEQEVDLEGWKKASMAKKYRALIRKGE
FT                   KFLEEEEVVFVAELEGILKKFKRALILEEGKERLEELEEELLELLYDMEEEE"
FT   gene            324542..325096
FT                   /locus_tag="Amet_0286"
FT   CDS_pept        324542..325096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0286"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cno:NT01CX_1454
FT                   conserved protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46518"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK00"
FT                   /protein_id="ABR46518.1"
FT                   /translation="MLQDLANYYFHQGLRLAKENHITKALEQLKKATALQGENWQALNL
FT                   QGLCFYELGDFSKAKGAWKRSLTCKNQENIASHYLGEMEQGDFEDLCKEYNQALMLAKL
FT                   KKYKKAIKILNSKEFASIKITSFQNLLGLCYLAQGKKVKALHVWHQALKIDIDNPYTLR
FT                   YIQESLGNLEEKSWFAKWFAG"
FT   gene            325122..326498
FT                   /locus_tag="Amet_0287"
FT   CDS_pept        325122..326498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0287"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: TPR repeat-containing protein; heat shock
FT                   protein DnaJ domain protein; SEC-C motif domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cno:NT01CX_1455 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46519"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK01"
FT                   /protein_id="ABR46519.1"
FT                   /translation="MKNYYETLNVDLKASPIEIKRGYFSLVRKYPSDRFPQEFMDIREA
FT                   YEALSNEKTREEYDHMMEMSAWDREFFEKSRQLVQAGETKKAIKILEFILERQFDSSLV
FT                   QGLLAEAYLCNGNSGKAIKILEKLVEEHPGNAGFKGHLAHAYIERGWHKKAIKAYEDAL
FT                   EIDEDNLSLWLGLSKAYAAGQWMSKAKSVLLRALEKGKDKDWDYITLYLTLIHIELAMG
FT                   DLDEMKKSVKKLSKASLEKEESREHIGWILSQLSQLLLGNGFMEEAMVLLEEAEVLLPN
FT                   NEEIQMVRKEVQSFFDLEKEFEKLMLDGLIEEDIRNLMELEVLPREMLGLEEDHRKDLV
FT                   FMIEYRILEEIHLFRKSINRLKEKYPRIYEKKANFFEGAMDPKRRGKMARSYEKQGKRM
FT                   HRIIQEMAMNFEQNYEDDDDEFLGYSEYQEPHVREEPKIGRNEPCPCGSGKKYKKCCGI
FT                   "
FT   gene            326809..327459
FT                   /locus_tag="Amet_0288"
FT   CDS_pept        326809..327459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0288"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cac:CAC1506 response
FT                   regulator (CheY-like receiver domain and a HTH)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46520"
FT                   /db_xref="GOA:A6TK02"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK02"
FT                   /protein_id="ABR46520.1"
FT                   /translation="MSVILIIEDEDPIRELIKLNLVMAGYETLEACDGEEGLQYLNNEK
FT                   IDLVLLDVMLPQQDGYTLLPKILKKNIPTIMLTAKDRLKDKVKGLEMGADDYVTKPFEA
FT                   MELLARVKCVLRRSDKEKTKIVMDDIEICLDQWKVLKDGKEVDLTYKEFDLLRLLIENK
FT                   GNVMSRDRLLELVWGYEFEGNTRTVDMHIQRLRNKIGADKIKTIYKVGYRMEG"
FT   gene            327463..328890
FT                   /locus_tag="Amet_0289"
FT   CDS_pept        327463..328890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0289"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: cac:CAC1507 sensory
FT                   transduction histidine kinase (with HAMP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46521"
FT                   /db_xref="GOA:A6TK03"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK03"
FT                   /protein_id="ABR46521.1"
FT                   /translation="MKLGWKIFLLCVGIYVVSLTITGFVVSENTYTSLLKNEVEGTVEE
FT                   ESNLHSTLAVYLLNNQRIAQEEIELKNYSKSMVDMINSDRNYLEIFDENLNLLATNAPK
FT                   AWFFSRKELDVALEGQKNFVLRRDEDELYLFVSNVLEIGEEKIVLSLIKDITHVDHYRR
FT                   EQYLLFMRTGLMGLIFVALITWALSILLLKPFRELSSTAENIASGNYHVRAEVNRTDEV
FT                   GLLAEQFNIMAGEIEQKMGELKEEGQQQQRFIDNLTHELRTPLTSIIGYAEYLLKAEYD
FT                   SKTFNKGLSYIHSEGNRMLKLAKTLMDMILVRERSLQLEEEHVMSLLVMIQNIMKVKAE
FT                   KKGVILKVQGENLKISIDKELFKVAIINLVDNAINASQEGQTVTMGVEKTPQKISLYIK
FT                   DEGKGMAEWELNRVIQPFYRVDKSRSRKDGGIGLGLAICYQIVKEHGAIFEIESEIGKG
FT                   TKIKVDFPQRVYKNFTS"
FT   sig_peptide     327463..327546
FT                   /locus_tag="Amet_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.760 at
FT                   residue 28"
FT   gene            328965..329195
FT                   /locus_tag="Amet_0290"
FT   CDS_pept        328965..329195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ptr:461291 splicing factor YT521-B"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46522"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK04"
FT                   /protein_id="ABR46522.1"
FT                   /translation="MKKILALSLVLLLSLTVMVACNAEEETITEQEGTEIELEIEEEVD
FT                   VDAEVDVDVEEDVDAEEDADAEEEEEEEEKS"
FT   sig_peptide     328965..329036
FT                   /locus_tag="Amet_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 24"
FT   gene            329302..331092
FT                   /locus_tag="Amet_0291"
FT   CDS_pept        329302..331092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46523"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK05"
FT                   /protein_id="ABR46523.1"
FT                   /translation="MKRIVFSLCFIVILMGCSQQEIKEGQVYVVQDENYDEEQTGDILN
FT                   IEGRIPFQKYVNQNIVDLQDSNRILLTIAPSGEEIYLMERMETTELSPVIKGDVREKVR
FT                   IIREDMVTKDQVIVAKDIPFVSKVRWNTEGNIVSFGGGDRLTIYDAKDGSIIMEGKLAQ
FT                   DPITGFFWAPTDENKIYTEQPNLANGSIYYLASQRKVEAYETREETYYKGKLNSDYYYG
FT                   TKWDLANGNIKTVILDKQGKTIKVIIPGIFRDSYEKSLVVVGEEGFGLSYVEDINNPED
FT                   AMDLTKEYVYDVKFIADGKIAYTTKAEDIDDNLFYLHIVSNNGSELKRAKVYGANIALL
FT                   PDGNSGYISGPVWQKVDFLENKLFEVDLEHDVELDESKEIYSTIRGAMMTLYDFQMKGE
FT                   EDRNRIEKYFKNTRSPEQWAYFDVTNMLQENDNRSSRRDYAMRIDLKSYVMDYADGSAS
FT                   VVIDVNIKNSYGRDITTDYALELSKSEERWYVTGFSTFPHAVEREEIEKILQETIEKIR
FT                   IGKLFPGKLEDKEITLGQVQFWLSRMPRLAPNIESANAVKVFLQVNQEGREEVYKLVLE
FT                   KVEQNLWQPTKLTQEDLSSL"
FT   sig_peptide     329302..329364
FT                   /locus_tag="Amet_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.597 at
FT                   residue 21"
FT   gene            331125..331505
FT                   /locus_tag="Amet_0292"
FT   CDS_pept        331125..331505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46524"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK06"
FT                   /protein_id="ABR46524.1"
FT                   /translation="MNNFPSIDEVHDILDEIAQEIPDVFFKELNQGILLLPEHKLHFES
FT                   RTRDKLYIMGEYRKSITGRQIIMYYGSFERLYKGMSKERLYEKLKDTLLHEFTHHLESL
FT                   AGEVGLEVKDSKDLRKYRNRLT"
FT   gene            331742..333619
FT                   /locus_tag="Amet_0293"
FT   CDS_pept        331742..333619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0293"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: swo:Swol_0317
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46525"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK07"
FT                   /protein_id="ABR46525.1"
FT                   /translation="MKLVNHKKRSLAMLLVMAMVFTVLPAMAPMVAEATVNGSAPYITV
FT                   TGDVYDGDEYQTVTEGVYRTGSDLQVMSGLTFTVSESVYLRATEGPSSVVASVYKNDIS
FT                   VTEAVYVQSTDEISIKGNANSKVTVELSRTLDFSSPVATFTFTVDLADVDDVDNGDDVD
FT                   NGDDVDNGDDVDNGDDVDNGDDVDNGDDVDNGDDVDNGEVIEAPELTFVSKDRNSVRLQ
FT                   VYSKVEGARFEFFTGETKRTATFVTEESGKYQYTITGLSANTSYTFTARVIVDGVKSAH
FT                   SNEVTVTTDRTSSSGGGGGGGGGSTSTSTSTTSVRASQSATLRGQGVVINFPANAMDND
FT                   FEVKIAKISNVSRLPMPSNMKFAGDVFEITKNRSGDFKDDVTLTLPFDKAKVDFDKYDV
FT                   SLFWLNERTDKWIELDNIKVNKSIGNVSGEVDHFTKFAVLAIDQDAAEEEKEKPVRVFA
FT                   DVTGHWAETHINNLVKTGAIGGYPDGTFKPDNNITRAEFATVLVKALDLEVKSGKVFID
FT                   TADHWAKDYIATAYANGIISGYDANTFGANDFITREQKAVMIVKAAALENATMSKSYVD
FT                   AESVSDWAKTAVETANAKGIINGYPDGTFRPKNNATRAEAATVIAKIIH"
FT   sig_peptide     331742..331846
FT                   /locus_tag="Amet_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.482 at
FT                   residue 35"
FT   gene            334166..334720
FT                   /locus_tag="Amet_0294"
FT   CDS_pept        334166..334720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0294"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: ctc:CTC01854 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46526"
FT                   /db_xref="GOA:A6TK08"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK08"
FT                   /protein_id="ABR46526.1"
FT                   /translation="MTQKTKEAMAASLKERLRKTTLQNITVKDIVKDCEVNRQTFYYHF
FT                   QDSFALLEWIFETEGTKAISTNKTYDTWEQGFLRVFQYVEQNKMLVHNAYHSMGREHVE
FT                   RYLYSVVYRLLINVINEQAKGMNVPEDDKGFIADFYKYAFVGIMLEWIHQGMKERPEDI
FT                   VDRLSKLITGAIHRALLKYEQ"
FT   gene            334816..335745
FT                   /locus_tag="Amet_0295"
FT   CDS_pept        334816..335745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0295"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   cno:NT01CX_1540 UTP-glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46527"
FT                   /db_xref="GOA:A6TK09"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK09"
FT                   /protein_id="ABR46527.1"
FT                   /translation="MMKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEA
FT                   VASGIEEILIITGRNKKSIEDHFDKSVELELELESKGKTELLEEVRKISDMVNIHYIRQ
FT                   KEPKGLGHAIHCAKSFIGNEPFAVLLGDDIVDAPKPCLKQMIDAYNEYKTSILGVQEVP
FT                   WEDVNKYGIVKGMHIEDRIYKVKDLIEKPAVNEAPSNVAILGRYIITPNIFEILENTPP
FT                   GKGGEIQLTDALRVLAQKEAMYAYHFEGRRYDVGDKQGFLEATVEFALKREDLREDFLA
FT                   YLQKITRREVEREQTQVQVQEVAMTDKE"
FT   sig_peptide     334816..334890
FT                   /locus_tag="Amet_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.422 at
FT                   residue 25"
FT   gene            335950..336792
FT                   /locus_tag="Amet_0296"
FT   CDS_pept        335950..336792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0296"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bld:BLi03124 similar to flagellar motor apparatus;
FT                   RBL03008"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46528"
FT                   /db_xref="GOA:A6TK10"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK10"
FT                   /protein_id="ABR46528.1"
FT                   /translation="MKWDMEKKFDFKGRNMKIVVIAVLMIVVAQALIGTMSLSIVFNVT
FT                   ALQIIFAGILISVFMSFPLEILTNTVKLVKESFTNDINYDETIHKIYELTVKIKKKGVL
FT                   SIQAEIDQEENTFLRDAMILLNDYKRSDAIEDILDNDIESRQMNLYKCHNVLNMIAHIA
FT                   PAFGLIGTLVGMIGLLANISIPDQIMNNMAAALVSTLYGSLIANIIAVPLMARLKEHIE
FT                   QRVLQYRIIKEGILLIAQEDTARNVFDKMNVMLKEENRLIYPRRAQEERKHESYEFKV"
FT   sig_peptide     335950..336045
FT                   /locus_tag="Amet_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.661 at
FT                   residue 32"
FT   gene            336767..337480
FT                   /locus_tag="Amet_0297"
FT   CDS_pept        336767..337480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0297"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bsu:BG10366
FT                   similar to motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46529"
FT                   /db_xref="GOA:A6TK11"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK11"
FT                   /protein_id="ABR46529.1"
FT                   /translation="MKAMSSKYDGKKYETEYSNSWLITYSDMITIVLCFFIIFFTFTAE
FT                   EASVLYHVKEALTSEVADLSDENQRLLEEKESLAALLFGLEDIELDLVQSQETFIRFLR
FT                   ENHLLDRVDVIEEERGLVIRFRDSVLFGSGQARISQEGYMLLDHVTAKLRTIDNAIVIE
FT                   GFTDNIPIQTNEFPSNWELSVARAIGVARYMIDEEYIEESRISVSGFGEQQPIDSNETN
FT                   EGRANNRRIEITILH"
FT   gene            337706..338617
FT                   /locus_tag="Amet_0298"
FT   CDS_pept        337706..338617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0298"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: cth:Cthe_2809
FT                   glycoside hydrolase, family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46530"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK12"
FT                   /protein_id="ABR46530.1"
FT                   /translation="MKSNNVKRKAIGAVVAGSLVVSSLSGVFAQNLTDIDGHWAKERIQ
FT                   DWVAAELLSGYPDGSFKPDQSISRAEFMSLVNKSFDYTVEKEGSFSDVSKDEWFASVVA
FT                   VANGAGYISGYDDETMKPNQPISRQEVATIITKIMKLEENVEQAAEFTDHEGIAQWSKG
FT                   FIGAVSAARYMNGYPDGSFQAKKEMTRAEAVAALDKVISELSDGEGEVTDQEAVEAAAE
FT                   LMTDEVTYNAEANALTINFSEAPDAGVEFATRVGNGIGEFQTTTGQTVTLKVYGDTKVG
FT                   DIDIFIRKGEATSVVESVYSRD"
FT   sig_peptide     337706..337795
FT                   /locus_tag="Amet_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 30"
FT   gene            338697..339359
FT                   /locus_tag="Amet_0299"
FT   CDS_pept        338697..339359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0299"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ter:Tery_4945 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46531"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK13"
FT                   /protein_id="ABR46531.1"
FT                   /translation="MNWKIKTAMILTLAMVLMLSGCSLGEKEDPSVAKANANYKNALQL
FT                   IKADQLAEAKGILEESIELNATEGIYHIALGNIYLREDEKETALSNFVRSIEKTPKYRE
FT                   AYNNAVGLYMLNNQYEQALTTVQEGLAIAPEDLELTFKKAQIYFIQDKNEEAIEGFQFL
FT                   IEADSETYFEAYRFLGLSQLNLDLKEEAKMNLEKYIEVAPEAVPVRESIENILSTLK"
FT   sig_peptide     338697..338774
FT                   /locus_tag="Amet_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 26"
FT   gene            339512..339778
FT                   /locus_tag="Amet_0300"
FT   CDS_pept        339512..339778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46532"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK14"
FT                   /protein_id="ABR46532.1"
FT                   /translation="MPTICMFYGIIIRMFCAPGEHNPPHFHAYYGEYKATVDIRTCELI
FT                   EGNLPKKQLKLVLAWAELRQEDLLANWTLAMNSELPFKVEPLK"
FT   gene            339792..340037
FT                   /locus_tag="Amet_0301"
FT   CDS_pept        339792..340037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46533"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK15"
FT                   /protein_id="ABR46533.1"
FT                   /translation="MYLAIMNVKPLIDYQLLLTFENGEKRIFDMKPYLDKGIFKELKDE
FT                   KKFKSVRVSFDSIEWCNQADIDPEVLYEKSVKYSLQ"
FT   gene            340273..341262
FT                   /locus_tag="Amet_0302"
FT   CDS_pept        340273..341262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0302"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain; KEGG: tte:TTE1927 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46534"
FT                   /db_xref="GOA:A6TK16"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK16"
FT                   /protein_id="ABR46534.1"
FT                   /translation="MAVLVCGGAGYIGSHTVLALLKEKVEVIVLDNLSKGHREALPSEV
FT                   KLYQGDLRDEKLLAGIFIDNEIDGVIHFAADSLVGESVEAPLKYYENNVYGSLSLLKAM
FT                   AKHGVKKIVFSSTAAVYGEPREVPIVEESLTLPTNPYGETKLAVERMLKWAQEAHGIEF
FT                   VVLRYFNAAGAEEEGTIGEDHSPESHLIPLVLEVALGKREKIYIFGEDYPTEDGTCVRD
FT                   YIHVMDLADAHLLALKRLQRGEGSGTYNLGNGKGFSVQEVIETARRITGKPIPAEMAPR
FT                   RAGDPAVLIASSDKARKELGWTSQYDSLEKIIGTAWKWHHSNPYGFKS"
FT   gene            341368..342798
FT                   /locus_tag="Amet_0303"
FT   CDS_pept        341368..342798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46535"
FT                   /db_xref="GOA:A6TK17"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK17"
FT                   /protein_id="ABR46535.1"
FT                   /translation="MAQKRIQRTVAGCYVVFLILTVIYGMFIRGPYLFKRPTVYLLTYA
FT                   LLGAALMIGVFYLLDRVPFLKDPRVFIPILGVITFVPRYIWVRLITTVPVYDFARFHQY
FT                   TQALIRGEYDSYLEIRNVFPHLSGYPLILSYVYRIFGDSVAVGKAFNLFCAVMTAVIIY
FT                   LIGKEIFGERGGRIAGLLFALWPTLIMYTPVLASEHIFLLLFLLALYLFLIYTKKPLKG
FT                   WELLRLLLIGVVMAFSHIVRPVASLLFPPMLVYLLFYQGVGNSLGAFVKDKLKIMVLII
FT                   LAFTLTMGALNWMYIDQIKVPLGKTAGGFNLYVGTDPERNGMWNPTAWEIIEEYDHDFD
FT                   RVHGEAQRRAIERIKEDPRAFVGLAERKFAIQWGTDDYGLYWSMLERYPETDFGLWVDE
FT                   NKNEVNIFAQSYYMAIILLALLGCWRLLTKVPSHAVGFFAMIVLIFAAAHVLIEVQSRY
FT                   HHPISPFFIVTAVVGIEH"
FT   gene            complement(342808..344016)
FT                   /locus_tag="Amet_0304"
FT   CDS_pept        complement(342808..344016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0304"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sak:SAK_2050 IS10R, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46536"
FT                   /db_xref="GOA:A6TK18"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK18"
FT                   /protein_id="ABR46536.1"
FT                   /translation="MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELG
FT                   RNLPTKARTKHNIKRIDRLLGNRHLHKERLAVYRWHASFICSGNTMPIVLVDWSDIREQ
FT                   KRLMVLRASVALHGRSVTLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAG
FT                   FKVPWYKSVEKLGWYWLSRVRGKVQYADLGAENWKPISNLHDMSSSHSKTLGYKRLTKS
FT                   NPISCQILLYKSRSKGRKNQRSTRTHCHHPSPKIYSASAKEPWVLATNLPVEIRTPKQL
FT                   VNIYSKRMQIEETFRDLKSPAYGLGLRHSRTSSSERFDIMLLIALMLQLTCWLAGVHAQ
FT                   KQGWDKHFQANTVRNRNVLSTVRLGMEVLRHSGYTITREDLLVAATLLAQNLFTHGYAL
FT                   GKL"
FT   gene            complement(344019..344126)
FT                   /pseudo
FT                   /locus_tag="Amet_0305"
FT   gene            344236..345126
FT                   /locus_tag="Amet_0306"
FT   CDS_pept        344236..345126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0306"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   baa:BA_0542 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46537"
FT                   /db_xref="GOA:A6TK19"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK19"
FT                   /protein_id="ABR46537.1"
FT                   /translation="MKEKLISLVVPMYCENEVAKECYKRLKEVMKKHEIPYEMVFINDG
FT                   STDETLSILEVIAAQDKKVKVISFARNFGHQIAVTAGIKRAQGDAVIVIDADLQDPPEL
FT                   IPEMIKLWEEGYHVVYGKRKKRQGETWFKLTTAKYFYRFLNSITEVDIPLDTGDFRLMD
FT                   RKVVDIFNNMPEKNRFIRGMVSWIGFKQTAIEYERQERFAGETKYPLKQMLKLAADGIL
FT                   SFSFKPVKWIEGTGIVIFLLGMLLLFFSGIYGLLVVIGGIQLFAIGIIGEYVVRIYDEA
FT                   RARPIYTVEKEINFK"
FT   gene            345154..345573
FT                   /locus_tag="Amet_0307"
FT   CDS_pept        345154..345573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0307"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: lmf:LMOf2365_2522
FT                   cell wall teichoic acid glycosylation protein GtcA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46538"
FT                   /db_xref="GOA:A6TK20"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK20"
FT                   /protein_id="ABR46538.1"
FT                   /translation="MLGNLKHYMNYLIFGVLTTAVNLVIYTILIRFGLHYLISTTIAFI
FT                   LAVSVAFYTNRKWVFDSDVKEQKGLMKEMSTFFVVRIGTYFFDLFGLILLIQLADMDEL
FT                   ISKLIVNGGVIVLNYALSKWVVFKKPRPMTVGKNG"
FT   gene            345761..346507
FT                   /locus_tag="Amet_0308"
FT   CDS_pept        345761..346507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46539"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK21"
FT                   /protein_id="ABR46539.1"
FT                   /translation="MIQEVFNRYEFKYVINMNQYKQVLKALKGRIEVDGNGDPDGFYKI
FT                   LSLYYDSDADTFFHETIDGTTFRQKLRLRAYNHVTMEDDVFLEVKQKHNGVVNKRRTQM
FT                   RVKDAYDFLKLGVDQKALQQYASSNKQILNEIHFLKEFHLLTPKILVSYDRQAFQGIEE
FT                   KDLRVTFDTNLRKQEFDLRIDGANLGTQFMGSDVSVLEVKVNDRIPLWLSRTLNECGCY
FT                   RQSVSKYCIGYQQSLTAANSQKKQVG"
FT   gene            346519..347214
FT                   /locus_tag="Amet_0309"
FT   CDS_pept        346519..347214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46540"
FT                   /db_xref="GOA:A6TK22"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK22"
FT                   /protein_id="ABR46540.1"
FT                   /translation="MEQLFEEAIQLNGVTPMQMVINVIVTMIVSLCVGLIITYTYRKTH
FT                   KGANYSQSFVHTLLIMNIVISVVIMVIGSNIARAFSLAGALSIVRFRSAIRDPKDVAFI
FT                   FFAMAVGLATGTGNYLVAIVFAIVVSFVIYGLYTFNYGDRGQVNKILKITVPENLNYEG
FT                   LFDDLFQEHLIDYSLASVKTTNLGTMFELTYFIRSKEEQQDKELIDGIRCRNANLRVAI
FT                   LLNAQDYYE"
FT   gene            347310..349040
FT                   /locus_tag="Amet_0310"
FT   CDS_pept        347310..349040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0310"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG: bsu:BG11791
FT                   spore coat protein (inner)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46541"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK23"
FT                   /protein_id="ABR46541.1"
FT                   /translation="MIWPLIPTILLLLLVAVLYEDEGAIHTGQAPRDPIKVEKVYLYID
FT                   QMDLNYLYERDDYSDEEIPGVVKYDPEGEEVALRGLRFRGNSSRQEPKKSFRITFEESQ
FT                   EVIFGSRRMNLNAMYTDPSMMREGLSMDLFSRLGHPAPRTQYVELYINDVYEGLYMHVE
FT                   RIDEDFLTAMGLSDKGTLVRDGFRGEVQRADMEDLSFFGFDLEGIDDPEAFVRDNFDYR
FT                   GNPDWEALLELGKWVEETQPGAEYARGFMERIDIESFVDWLAVHLLVGDIDAFYDDYWL
FT                   YLDHRVADAKWQWIPWDKDLTFGSVWRPVYNVSNDYFYYQFQMRMPWVKNDLIVKFMET
FT                   PQLMALVYERTEVLLDEVFTLEKLSIEIDRIAEKIRPSVEVSPGVGAFRLNPRNHFGQL
FT                   GNFEDHVEAIKDYVALRGQYLRKYIGHKGRLPAEGRFESTVRWNEQQLDQPLYFVDEGG
FT                   WVIGKWQGKALAEEGKLSIEVKEVPSVVGINRIWTLVYEGAPIQGELTLYYLNDTENRN
FT                   NWYETYEAVGGQRELQMIESNGIRWRELPSRVNPYSNKVVATMELSGVHQLSLTKGSQQ
FT                   "
FT   gene            349102..350175
FT                   /locus_tag="Amet_0311"
FT   CDS_pept        349102..350175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0311"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mma:MM2212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46542"
FT                   /db_xref="GOA:A6TK24"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK24"
FT                   /protein_id="ABR46542.1"
FT                   /translation="MERVVMEKTGTDELNIIRTLTCLAVIFVHLTAIPVDTLLPDSVHM
FT                   MIFSFLNRGTKFTTPTFIFLSGFTLFYAYRSRELKYGTFIKKRFKSALIPYFVWTLIYY
FT                   RFFVNEGTYIPSTSFFLEHLFWAKMSYHLYFIFIIVQFYISFKLFLRGFQKWNPHMLLV
FT                   GLLITNLLFLRYADFEYMDRTFLRYIFFFGLGCYGARFVDVFREKLTQWKWMLLLGYVA
FT                   VAGYYAYQFRSYHARYLPVNVFAVEVTWLAFSTMAILTLYAFGFWLSKRSEKTSPVFKL
FT                   ISQSSFYIYLSHPLGIFLAERTWDELGIYSITGRFGLNVIFVYGFSVGGCTLYTYLKMR
FT                   WQHHQKEKAVAASEMIK"
FT   gene            350536..351690
FT                   /locus_tag="Amet_0312"
FT   CDS_pept        350536..351690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0312"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dsy:DSY3360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46543"
FT                   /db_xref="GOA:A6TK25"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK25"
FT                   /protein_id="ABR46543.1"
FT                   /translation="MTRWFLLIMITTVILAGCSSTTSVEGDEAEPTDDYVAVEVSQVEM
FT                   RGLANEATLNGRVFSENEVMVLPRTPGIVDCVNVKLGDSVQKDQVLFVLEQDSSVLLGI
FT                   EQAEEAVKSATKGTEQAAQGIALAENQYKMAKDQYDDAQANLERIKSLYDAGAVPKTQL
FT                   DQAEMAAADGSLVAARSQITQAEISYQQTLGQLRQAEISVDQARTNLNHLEVKAPASGI
FT                   ISTLDLRVGQMVTNAQPVATIVDVNALYIQFELPENMINQFKRGQEVVVSIPAANVRDA
FT                   KATVGLVSAATDQRTQLYPVRIDLTKSGDLVRPGSTGEVQVATNQTGNALIIESRAILN
FT                   QDNETLVYVVENDHAVERKVTLGLDTAEYVEIIEGVSEGQQVII"
FT   sig_peptide     350536..350616
FT                   /locus_tag="Amet_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.403 at
FT                   residue 27"
FT   gene            351746..353120
FT                   /pseudo
FT                   /locus_tag="Amet_0313"
FT   gene            353145..353717
FT                   /locus_tag="Amet_0314"
FT   CDS_pept        353145..353717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0314"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: dsy:DSY3361
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46544"
FT                   /db_xref="GOA:A6TK26"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK26"
FT                   /protein_id="ABR46544.1"
FT                   /translation="MKDKREIGKEEIIQAAMTVFDKHGFHETKMKDIATEAGIGKGTLY
FT                   EYFESKKELFRQMIIYKLNSYIEGIEKVIAHEGTTREKLMGFAAYHGGFMHEHHSKAEM
FT                   IFLKSDSLPEEFKQWMVAGRNQIFRLMLSLIEEGMNRGELRKDLNKEIATAVIFGGIKE
FT                   YYLDKIYCVGTKPGLAHDIENRLQSDY"
FT   gene            complement(353786..355141)
FT                   /locus_tag="Amet_0315"
FT   CDS_pept        complement(353786..355141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0315"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   cvi:CV1670 probable sodium/chloride ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46545"
FT                   /db_xref="GOA:A6TK27"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK27"
FT                   /protein_id="ABR46545.1"
FT                   /translation="MANLNNNTERDQWGSKVGFILAAAGSAVGLGNLWRFPVTAGQNGG
FT                   GAFVLVYFAILILVGFTLMMAELVLGRHTQLNALGAYKKIRNNWAWVGGLGVLAGFLIL
FT                   SFYSVIGGWVINYMFKAITGAFTTSDPEFLGGMFGAFISNPVEPLFYHAIFMILTLGIV
FT                   IGGVKGGIEKYAKILMPALFVMMVLTMLRSVTLPGAMEGIKFLLVPDFSMITGAVLLSA
FT                   LGQVFFSLSLGMGAMITYGSYLSKDANIPQSSFIIPLVDTGIALLAGLAILPAVFSFGF
FT                   DPAEGPGLLFVTLPAVFSQMPLGGLFGFVFFLLVLFAALTSSISLLEVCVAYVVDEWNM
FT                   TRKKATIGLAAVIFLLGIPSSLGIGVWSHISPFRGLDILDSVDFIASNVLMPVGGFLLC
FT                   IFIGWVWGLENAIKEATNEGTIPFKLAGFWSFMIKWVAPIAIAVVFVQGILS"
FT   gene            355486..355848
FT                   /locus_tag="Amet_0316"
FT   CDS_pept        355486..355848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0316"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: dsy:DSY4941
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46546"
FT                   /db_xref="GOA:A6TK28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK28"
FT                   /protein_id="ABR46546.1"
FT                   /translation="MPHKILIIDDQPRICSLLEEVFKKDYEVYLATEANKALEIIETAQ
FT                   PDLAIVDMNLGQESGVDLIEKMLEIKNDLLLVMLTGNYTPRHKERGAELGVKAFLEKPF
FT                   DIIEMRSCIASILSNG"
FT   gene            355968..356357
FT                   /locus_tag="Amet_0317"
FT   CDS_pept        355968..356357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0317"
FT                   /product="acyl-CoA hydrolase"
FT                   /note="KEGG: tte:TTE0718 acyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46547"
FT                   /db_xref="GOA:A6TK29"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK29"
FT                   /protein_id="ABR46547.1"
FT                   /translation="MKAMIRMRMSMHDAHYGGNLVDGAKMLQLFGDVATELLIRHDGDE
FT                   GLFVGYDQVEFTAPVYAGDYIEAVGEIVKVGNTSRKMVFEARKVIVPRYDINESACDVL
FT                   EEPIVVCKASGTCVVTRDKKRLKRE"
FT   gene            356371..357183
FT                   /locus_tag="Amet_0318"
FT   CDS_pept        356371..357183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0318"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   rfr:Rfer_3885 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46548"
FT                   /db_xref="GOA:A6TK30"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK30"
FT                   /protein_id="ABR46548.1"
FT                   /translation="MEKLIITAALTGAEVTREQQPNLPLTPDEIAQAAYECYEAGASIV
FT                   HVHARDEEGKPTQSYEVYEEIKQKIQAKCDIIFQPSTGGAVWHTPEERLQPVELKPEMA
FT                   TLSCGTCNFGPDVFMNSQEYIEKFAKRMMELGVKPEIEIFERGMIENAKGLVKKGLAKT
FT                   PLHFDFVLGVPGAAPGTVEDLLYMVRCIPEGSTWTVAGIGRAELPLATMAMIMGGHVRV
FT                   GFEDNVYYGKGELAESNAQLVARILRIAKELGREIATPEEARHILGLK"
FT   gene            357195..357839
FT                   /locus_tag="Amet_0319"
FT   CDS_pept        357195..357839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0319"
FT                   /product="putative transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: putative transaldolase; PFAM:
FT                   Transaldolase; KEGG: bce:BC0665 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46549"
FT                   /db_xref="GOA:A6TK31"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK31"
FT                   /protein_id="ABR46549.1"
FT                   /translation="MKLFIDTANIEEIKEVAQWGILSGVTTNPSLIAKEGRDFKQVIAE
FT                   ITAIVEGPISAEVVSLQAEEMLKEAQDLVAIHPNVVIKVPMTAEGLKAVKGFSEQGIKT
FT                   NVTLVFSANQALLAARAGASFVSPFVGRLDDIGQEGSELVRQIIEIYDIHGIETEIIAA
FT                   SIRHTQHLTDAALAGAHIATVPYKVLKQSLLHPLTDQGIEKFLKDWEGLVK"
FT   gene            357933..358751
FT                   /locus_tag="Amet_0320"
FT   CDS_pept        357933..358751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0320"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: tte:TTE0552
FT                   predicted hydrolase or acyltransferase (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46550"
FT                   /db_xref="GOA:A6TK32"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK32"
FT                   /protein_id="ABR46550.1"
FT                   /translation="MPKVKINDVDIHYRVSGKGDQVLMILNGIMMSVASWMEMVPTYTR
FT                   AGYKVINVDFRDQGESGSSPGGYSNEQHVEDLKGLLTHLEIKSCTVLGISYGGQVAMML
FT                   ALAYPEMVRGLILANTMSRFTPYLRAIGAAWDEGAKLQDGETFFKLAMPLIYSDVFYER
FT                   KEQWLQDRAREFGKAATAQWFQRYLRLSSSLEGYDISGKIHSIEVPTLVIASDKDVVTP
FT                   YEELLMIHRKIKNSLFVMLPEAGHASCYEKMREFNVQVLGFLVMNQGMDG"
FT   gene            359244..360242
FT                   /locus_tag="Amet_0321"
FT   CDS_pept        359244..360242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0321"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphatase, class II;
FT                   PFAM: GlpX family protein; KEGG: sth:STH67
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46551"
FT                   /db_xref="GOA:A6TK33"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK33"
FT                   /protein_id="ABR46551.1"
FT                   /translation="MDRNLALELVRVTETAALASASYMGRGDKIGADQAAVDGMRRAFN
FT                   SISIRGTVVIGEGDLDEAPMLYIGETVGCGDETEIEVDIAVDPLEGTTLIAKGLPNAIA
FT                   VLAIAPKGTLLHAPDMYMRKIAVGPRAKGVINIAAPTSENLHAIAKALDKKIEDLTVTV
FT                   QDRPRHEKLIEEIREAGARIKLFGDGDVATAIATGFEETGVDVLMGIGGAPEGVIAAVA
FT                   LKCLGGDMQAILNPMSPEEETRCREMGLSQDDVKKVLTLDDLVSSEDCFFAATGITQGD
FT                   LLQGVVYKGNNRASTHSVVMRGKTGTVRFVEALHRLDKNETLTDVLKKHQR"
FT   gene            360274..361242
FT                   /locus_tag="Amet_0322"
FT   CDS_pept        360274..361242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0322"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphatase, class II;
FT                   PFAM: GlpX family protein; KEGG: chy:CHY_0787
FT                   fructose-1,6-bisphosphatase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46552"
FT                   /db_xref="GOA:A6TK34"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK34"
FT                   /protein_id="ABR46552.1"
FT                   /translation="MDRNLAINLVRVTEAAAIGAAKHMGRGDKEAADQAGVDGMRKMFD
FT                   TINIEGTVVIGEGEMDEAPMLYIGEVVGERGHNAPQVDIAVDPVEGTTAVAKGLPNAIA
FT                   VVAMAPKGCLLHAPDMYMDKIAVGPAAAGKIHIDWPVHKNLKATAEALNKSISDLTVTI
FT                   LDRPRHADIIQQCRDAGARIKLFSDGDVATAIATCFDDTGIDILLGIGGAPEGVIAAAA
FT                   LKSLGGEFQGKLIEFEEGEAERCIKMGVCVNKVYYMDDLVKGNEVYFAATGISDGDLLK
FT                   GVVYGGNGIVKTHSVVMRSETGTIRFIEAIHRLNQKPTYSY"
FT   gene            361368..362801
FT                   /locus_tag="Amet_0323"
FT   CDS_pept        361368..362801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0323"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain; SMART: AAA ATPase; Cold shock protein;
FT                   KEGG: cth:Cthe_2174 transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46553"
FT                   /db_xref="GOA:A6TK35"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK35"
FT                   /protein_id="ABR46553.1"
FT                   /translation="MDKTELATKKLEDLRQIARALGIKNIGKYKKSELMERIIGQEPTE
FT                   DKGTTIEEIEQPIEPSQATQEPEKTSKPGVQEIPPEKKDSLVVQQAKEQGLPSHLTDEI
FT                   SEDESVNIAQGILEIHSDGYGFLRRYNYLSSDGDIYISPSQIRRFNMRTGDKITGITRP
FT                   PKSGEKFKALLYVKQINDLNPETATRRPNFEDLTPIYPNKRINLELNTKELSTRLIDLI
FT                   APIGKGQRGMIAAPPKAGKTILLQQVANSVALNYPETEIIVLLIDERPEEVTDMQRSIK
FT                   GEVVYSTFDELPSHHVKVAEMVLSRAQRLVEHGKDVVILLDSITRLARAYNLTIPTTGR
FT                   TLSGGLDPGALHKPKRFFGAARNLEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNME
FT                   LHLDRKLSEKRIFPAVDINKSGTRREELLLSQRELETIWKIRRAMGNSSPQDVTEKIIA
FT                   SLLETKSNHEFVEMLAKRL"
FT   gene            362910..363107
FT                   /locus_tag="Amet_0324"
FT   CDS_pept        362910..363107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0324"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: gka:GK3381 50S
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46554"
FT                   /db_xref="GOA:A6TK36"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK36"
FT                   /protein_id="ABR46554.1"
FT                   /translation="MKKDIHPAYQQIDVHCVCGNKFKTGSTNKEIRVEVCSDCHPFYTG
FT                   KQKSVEKGGRVEKFKKKFGM"
FT   gene            363205..363792
FT                   /locus_tag="Amet_0325"
FT   CDS_pept        363205..363792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0325"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase; KEGG: tte:TTE0140 Thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46555"
FT                   /db_xref="GOA:A6TK37"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK37"
FT                   /protein_id="ABR46555.1"
FT                   /translation="MVDIMEYSKDGSIEVIVGPMYAGKSEELIRRINRAEIAELKVLAF
FT                   KPSIDNRYSAQHITSHNGKQLKCIPVKDAKEVMEYIEKQDFDILAIDEVQFLGDEVLKV
FT                   CQDVANRGKRVICSGLDMDFRGEPFQVVPNLMAIAEHVTKLTAVCMTCKMPATRTQRLV
FT                   DGRPAKYDDPIIMVGAKESYEARCRKCHVVIR"
FT   gene            364403..365224
FT                   /locus_tag="Amet_0326"
FT   CDS_pept        364403..365224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0326"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: pca:Pcar_2183
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46556"
FT                   /db_xref="GOA:A6TK38"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK38"
FT                   /protein_id="ABR46556.1"
FT                   /translation="MNGMKHSVGNVANILGLSPGILRHYEKLGIINPERDNSGYRSYST
FT                   RDVNILMGVRKLIGMGFSLEEVKHLIYGASLEKVKQSLDTLEENMKKEIRWRQLVLEFI
FT                   QKQRQEYEVISEESHKFEITKSPAVYRIRSQYENFLSAEEAANTYVYRWISKMPIVRIS
FT                   PEFSVEAIYNQTEEYQFGFVVEEELAEELELMETPDMIFIPSQLCLTTIISSQGEDHIK
FT                   ASMLKRAVNYIAKHNMKISDNAWGMTIGSYVEKDMHKRFHKIFIPIENENK"
FT   gene            365325..367259
FT                   /locus_tag="Amet_0327"
FT   CDS_pept        365325..367259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0327"
FT                   /product="flavocytochrome c"
FT                   /note="TIGRFAM: flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; FMN-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ser:SERP2381 NADH:flavin
FT                   oxidoreductase/fumarate reductase, flavoprotein subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46557"
FT                   /db_xref="GOA:A6TK39"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK39"
FT                   /protein_id="ABR46557.1"
FT                   /translation="MKGFKRNIAIVLLIAMSLMSFIGCSQQATTQGQFIAGTYEASARG
FT                   MIGDIKIAVTFTEDRIEKIEILEHQETEGIADPALERIPQSIVANQSLGVDSITGATIT
FT                   SLAILNAVEDAATQAGADIEILKNKAVASTKGEKIEKTTDVIVIGGGGAGIAAAASSVE
FT                   NGAEVILIEKAAALGGNTLASGFAWNATNPEIQGKIGTMPGQIEMLKGVLELDEEGFGE
FT                   FTDILKTLKEQITTYLDGDASTVFDSVEFHIIQAYQGGRRQDRDGNWIENDYDLLTTFA
FT                   ENSLPTLNWVQSLGGAFSEELTSPVGAMWLRGHNPVGKKQIFDALADYIVENGSEIMLE
FT                   TKADELIVKDGRIVGIKGTKADGTEVELYANKGVIMATGGYGANPSLAAEYNNYWPSIP
FT                   EDMKTTNVSTVTGDGIIMGREIDANLVGMEFIQLMPTANEKSGSLTDGLLVAPQNYVFV
FT                   NKEGKRFINEYAARDELAFAALEQTDEMFYTIADQPMALSAQNRPTQEMIDKMVEDGLI
FT                   YRADTLEKLAEIIGCDPQTFVDEIEKYNSYVEAGKDPEYGKAVFEMQVKEGPFYACPAK
FT                   PAIHHTMGGLEINVRGEVLDTASNVIPGFYAAGEVTGGIHGGNRLGGNAIADVFVFGRI
FT                   AGENAATNK"
FT   sig_peptide     365325..365408
FT                   /locus_tag="Amet_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.414 at
FT                   residue 28"
FT   gene            367824..368051
FT                   /locus_tag="Amet_0328"
FT   CDS_pept        367824..368051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46558"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK40"
FT                   /protein_id="ABR46558.1"
FT                   /translation="MKDLEEAIIKAGLEEKVELLHFIDAFSDELDQYPQIVMKIENMEI
FT                   GIPAVCFGEEVIVEDKIDIEKIVQALKELS"
FT   gene            368239..369639
FT                   /locus_tag="Amet_0329"
FT   CDS_pept        368239..369639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46559"
FT                   /db_xref="GOA:A6TK41"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK41"
FT                   /protein_id="ABR46559.1"
FT                   /translation="MNNSYRDRFQVVEIIKNNSVQKIMIATDIKKIHEIVLINILNNEK
FT                   GLLDNNEALWRSTLDGLILFEATDDEITLITTVQSRETVESYLKKKSLSEKERFVLIHQ
FT                   YLKGILRYEPLPNHVKNMMIGLGQVVIDGEHIAFTELLILEETDFSEQGYKVITRNIGE
FT                   VLNYLMTEGQIAESKEVNNLGEIQNFIENLQQDEHHYRDIRDIFNSFRGLYTYHIWMPP
FT                   TIQLQDEKIVTQLRRKRVEAAKRAHNKTRNTSLVVGVIGILMVGIAGVYSNWGGFLFDL
FT                   YTDDTIAEPTEILGEEATTEVLNEYGDEVQEKIVREGKEQQEENNEKNTEHPRERLEDV
FT                   ALTYGKEENIARDYGNLRSGKYSLRLDGEVQERGSVQIKDVILEVESFVSFWVQSDAAA
FT                   PLKITLEGYGNDHLLDQQTINYQPSVIKFWERIDFQPKNGEIDELHIIFSEVKSVLWID
FT                   DIKIDVFK"
FT   gene            369672..370553
FT                   /locus_tag="Amet_0330"
FT   CDS_pept        369672..370553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0330"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: cth:Cthe_2428 modification
FT                   methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46560"
FT                   /db_xref="GOA:A6TK42"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK42"
FT                   /protein_id="ABR46560.1"
FT                   /translation="MKTVVDLLKEATAVLKEIDVDTPQLDAEVILCHLLKTERIQLHIY
FT                   PERKVDEEVQEQFWEGIQKRKKRMPVQYIVGTQEFMGLDFRVESGVLIPRADTEILVES
FT                   VLGLYEVHYNNEAVALMDIGTGSGAIAISLARFIERSKIYAIDLSEKALEIAENNGRTN
FT                   EVQHKISFFYGSLFEPLKGYDLEGTFQFVISNPPYIPPDVVEELSPQVKDYEPRMALEG
FT                   GADGLDFYREIVEKAPQYLQMKGWLCFEIGYDQGEQVKGLMETRGFSRVEVIRDLAGLD
FT                   RVVIGQWTVENR"
FT   gene            370654..371727
FT                   /locus_tag="Amet_0331"
FT   CDS_pept        370654..371727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0331"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   cac:CAC2884 peptide chain release factor RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46561"
FT                   /db_xref="GOA:A6TK43"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK43"
FT                   /protein_id="ABR46561.1"
FT                   /translation="MLDKLAFLQEKYEDLGEKISDPEIINDQVQWQKLIKEHSEIEPIV
FT                   MKYREYKTTQQALGETKEIMHDKATDAELKEMAKMEVEELEESIVEMEEQLKVMLLPTD
FT                   PNDDKNVIVEIRGGAGGDEAGLFAAVLFRMYTRYAERSGWKVEMMSLNESGVGGYKEVI
FT                   FMIKGKGAYSQLKYESGAHRVQRIPTTESGGRIHTSTATVVIMPEAEDVGEVNIDTNEL
FT                   RIDVFRSSGNGGQSVNTTDSAVRITHLPTGLVVSCQDGKSQLKNKEKAMKVLKSRLLDQ
FT                   MIQEQDAEISQDRRSKVGTGDRSERIRTYNFPQGRVTDHRINVTVYKLDAFLDGEINEM
FT                   IDSLITSAQAEKMQEVQ"
FT   gene            371953..372618
FT                   /locus_tag="Amet_0332"
FT   CDS_pept        371953..372618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0332"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: tte:TTE0144
FT                   predicted divalent heavy-metal cations transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46562"
FT                   /db_xref="GOA:A6TK44"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK44"
FT                   /protein_id="ABR46562.1"
FT                   /translation="MAFLLNNPTKRFLSAIMGLSSGLMVAIVTFELLPEAFMIAGVPWT
FT                   VVGLIGGVLIATILDGFIARLSSRKHGGKHGYVKTAALLGIGIALHNFPEGMAIGSGFV
FT                   AQNRLGIGLAIVIALHNMPEGVAMVTPLRVGGYSRSKAFFLTLLAGTPMGIGAYFGALL
FT                   GRVADGFIGICLAFAGGTMLYITFGELIPRGKELDQGRISTICATFGFVLGMLISKRF"
FT   sig_peptide     371953..372030
FT                   /locus_tag="Amet_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.744 at
FT                   residue 26"
FT   gene            372719..373171
FT                   /locus_tag="Amet_0333"
FT   CDS_pept        372719..373171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0333"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   cth:Cthe_3045 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46563"
FT                   /db_xref="GOA:A6TK45"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK45"
FT                   /protein_id="ABR46563.1"
FT                   /translation="MYQILSWIVRYLLIALVYYFIYSIIRLIYLDIKAINEKEARGPRT
FT                   PYLKLVNRKERLDFEIDELYDLHEETTIGRGKENEIQIVDQFISTRHVRIALDEGQYFL
FT                   EDLGSVNGTYLNGEKLQDVAKLKDGDRIGLGQVEFLFVKEEEEEED"
FT   gene            373176..374390
FT                   /locus_tag="Amet_0334"
FT   CDS_pept        373176..374390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0334"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: cth:Cthe_3046 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46564"
FT                   /db_xref="GOA:A6TK46"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK46"
FT                   /protein_id="ABR46564.1"
FT                   /translation="MARPIHIVVLINLLLFPLLFFYGEAQDPLILAIGGGIILLTILSQ
FT                   FAIVKGKMGDPYIFLILSLLCSISIAMLYRLDPFYGIRQTIWYGVGLILFFLTYVFFRW
FT                   VKKWDEYFYLYVIAGVGLFAATYFLGTTIKGANNWIRIGGFTFQPAEAIKLIFVFMIAS
FT                   YFKHTQKVKNVYVFLGIVYLHMLFLMLQRDMGMVLLFYAVFISLFYVHIEDYRLILYNT
FT                   VPFGLMAVISYLTMNHVRVRFEAWLNPWQDIAGRGYQITQSLFAIAGGGFFGTGIGLGN
FT                   PGVIPEVHTDFIFSAIAEELGVFGAIAMILLYFILIYRGFKIVLTINEPFRKTVALGIT
FT                   LLYGYQTFIIVGGVIKLIPLTGITLPFVSYGGSAFVSGFVAFGILQALSTKWKPGRGRL
FT                   EIERK"
FT   sig_peptide     373176..373253
FT                   /locus_tag="Amet_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.676 at
FT                   residue 26"
FT   gene            374377..375777
FT                   /locus_tag="Amet_0335"
FT   CDS_pept        374377..375777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0335"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: cth:Cthe_3047 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46565"
FT                   /db_xref="GOA:A6TK47"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK47"
FT                   /protein_id="ABR46565.1"
FT                   /translation="MNGNKRIVHLIVLTSVLFLSLISYLTYFQVFRATTIAENSFNPRH
FT                   WAREDTTLRGRIYDRNGLILADSDVEEGRPIRSYPHGRLYSHVIGYHNRQYGRTGIEFY
FT                   YNEHLMDLLMERPVARIRDRITGEMIQGNDLVLTIDHELQQLAHQLLGNKNGSIVALDP
FT                   RNGEVLAMVSKPDYNPNTLVGDWNDLIIREDSPLLNRSIAGLYTPGSVYKILMAAKGVE
FT                   EGLETNVYESTSSIVVDGYTLSNYGETAHGEITLGEALAVSANTSFARLALELGEGSVT
FT                   EISRRFLMGERIPSDMPVNRSLYPYEGGLQDTELVAVSIGQGRLLVTPLHMAAMTSVFA
FT                   NGGVMMAPHIVQEVQSPTGRVVLRPGGEVVTVVSAEVAETVKEMMISVVEQGTGRNAGV
FT                   QGVSVAGKTGTAENVTGKSHAWFVGFAPAEAPQIVVAVILESEGQTGGAAAAPIARDLI
FT                   GRGIQGGN"
FT   gene            375780..376850
FT                   /locus_tag="Amet_0336"
FT   CDS_pept        375780..376850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0336"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain;
FT                   KEGG: tte:TTE0145 putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46566"
FT                   /db_xref="GOA:A6TK48"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK48"
FT                   /protein_id="ABR46566.1"
FT                   /translation="MKRTKIIKLEEMNEKQIDEILTACGEMIREGKTVAFPTETVYGLG
FT                   ANALDSKAINKIFVAKGRPSDNPLIVHVAHRVEVDALVRVIPEKAKKLMAHFWPGPLTL
FT                   VMEKSHGIPGEISAGLSTVAIRMPVHPIARTLIEKAGVPVAAPSANTSGKPSPTRAAHV
FT                   IQDLRGKVDAIIAGGPCDVGVESTVLDVTEETPMILRPGGVTKEMLEAVIGEVALDPGL
FT                   YHRGEMKDVPRSPGMKYTHYAPKAKVIIIEGVEAAVVRKIREMVAYYKEKGLSVGVIVT
FT                   DESLAYYDQVEECCVKSMGSRQNPETIANNLFRVLREFDETNVAIILSEAVEEVGIGQA
FT                   VMNRLMKAAGNEKINA"
FT   gene            376869..377348
FT                   /locus_tag="Amet_0337"
FT   CDS_pept        376869..377348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0337"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: chy:CHY_2559 low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46567"
FT                   /db_xref="GOA:A6TK49"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK49"
FT                   /protein_id="ABR46567.1"
FT                   /translation="MKTILFICTGNTCRSIMGEALMKELLSKQPHTLGEVTVLSAGVSA
FT                   ASGEPASGQAVEVMNEKGISLGQHRATPISKSLIDEADLVLTMTANHKKVVLEIHPKAK
FT                   DKVYTLKEYTGTVDSLDISDPFGQPVVIYRRSAEEIEGQLKQLLEKLEDEKNEKK"
FT   gene            377459..377908
FT                   /locus_tag="Amet_0338"
FT   CDS_pept        377459..377908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0338"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /EC_number="5.3.1.26"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: cpr:CPR_2173 ribose
FT                   5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46568"
FT                   /db_xref="GOA:A6TK50"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK50"
FT                   /protein_id="ABR46568.1"
FT                   /translation="MKIAIGSDHGGYELKNLIKEHLLNKKLEVVDFGTESTDSCDYADY
FT                   AQGVAEAVAKGDYARGILICGTGIGISIAANKVPGIRCALVGDCFSAKATTEHNDSNVL
FT                   ALGGRVVGPGLALEIVDIWLSATFQGGRHQKRIDKITDIESKYYK"
FT   gene            377924..378553
FT                   /locus_tag="Amet_0339"
FT   CDS_pept        377924..378553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0339"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: cth:Cthe_2598 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46569"
FT                   /db_xref="GOA:A6TK51"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK51"
FT                   /protein_id="ABR46569.1"
FT                   /translation="MSKVFVIDHPLIQHKLTLIRDKNTGSKDFRDLVKEISLLMGYEVT
FT                   RNLSLQEIEIETPVGVTKSKVISGRKLGIVPILRAGLGMVDGILQLIPAAKVGHVGLYR
FT                   DPETLEPVEYYCKLPVDVQEREIIVLDPMLATGGSANATLKAIKDRGVANMKLVCIVSC
FT                   PEGIAAVQKAHPDVDIYVAAIDEKLNDHAYIVPGLGDAGDRLFGTK"
FT   gene            378757..379197
FT                   /locus_tag="Amet_0340"
FT   CDS_pept        378757..379197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0340"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   cth:Cthe_2599 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46570"
FT                   /db_xref="GOA:A6TK52"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK52"
FT                   /protein_id="ABR46570.1"
FT                   /translation="MRPSWDQYFMEMAEVVKTRSTCMRRQVGAVVVKDKRVLSSGYNGA
FT                   PSGIEHCEKTGCLREQLGVPSGERHELCRGLHAEQNAIIQAAYHGVEIQGTTLYVTLQP
FT                   CVLCAKMLINAGVKRLVFKGQYPDDLSEKMLTEAGIEMEKFE"
FT   gene            379281..380321
FT                   /locus_tag="Amet_0341"
FT   CDS_pept        379281..380321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0341"
FT                   /product="glycosyl transferase, family 4"
FT                   /note="PFAM: glycosyl transferase, family 4; KEGG:
FT                   tte:TTE0154 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N- acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46571"
FT                   /db_xref="GOA:A6TK53"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK53"
FT                   /protein_id="ABR46571.1"
FT                   /translation="MEKYMITFFVALAISYILTPYAKKLAYRIGAIDVPKDNRRIHKKP
FT                   IPRLGGVAIYTAFMITALISLPIDRQLMAILIGATVIVLTGIIDDVKPISAKYKMVAQI
FT                   IAALIIVSSGLRIVYVSNPLVPGAGMNLGILSIPVTIFWIVGVTNAVNLIDGLDGLAAG
FT                   VSVIASISLAAVAYLNGQPEVAVLLVILAGASLGFLPYNFNPAQIFMGDTGSLFIGFIL
FT                   ASVSIEGVIKSATTIAVAIPVLALGVPIFDTAFAIVRRLVNKRPIMEADKGHLHHCLLD
FT                   RGLSQKQTVLVLYSISIILGGSAIIIADATRGTAYLLIVFIATSVLLGAIRIGLFKKSA
FT                   EEKANS"
FT   gene            complement(380538..381953)
FT                   /locus_tag="Amet_0342"
FT   CDS_pept        complement(380538..381953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0342"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   vfi:VF1605 putative neurotransmitter:Na+ symporter, NSS
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46572"
FT                   /db_xref="GOA:A6TK54"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK54"
FT                   /protein_id="ABR46572.1"
FT                   /translation="MEKSIPKRENWGSRIGFIMAAAGSAVGLGNIWRFPYLLGENGGAA
FT                   FLLIYLVFVVFIGISIMIAEFAVGRNSGSAAVGAYKSKSGKWTFAGVIGVLSAFFIMGF
FT                   YPVVGGWSLAYIAQTFTGLLSNPEAIGGTFGAFIGSTTAPLIWMIVFLALNVFIVARGI
FT                   AGGIEKAGKILMPVLFGLLVLIAIRSLTLPGAAAGLSYMFKPDFSAVTGQTYLAALGQA
FT                   FFSLSLGMGCMITYGSYLNKKEDLATNAVLVTGMDVGVALLAGLAMFPAIFALGMAPDA
FT                   GPGLVFVVIPSVFAAMGGIGPILSVIFFVALTVAALTSSVSLMEVAVAYFIDEKGIERK
FT                   KAVYSVASAMGVLSILSSLSLGSMSGVTLFGVGFFDFFDILTDKIFLSIGGLLLSVFVG
FT                   WFLDKEMLRKELTNGGTVKFALFEAWHFLIKYVIPVAISIVAFYGIKSIEQTSLMIFGL
FT                   LMIVVLAVFSKKL"
FT   gene            382412..383545
FT                   /locus_tag="Amet_0343"
FT   CDS_pept        382412..383545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0343"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   ctc:CTC00311 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46573"
FT                   /db_xref="GOA:A6TK55"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK55"
FT                   /protein_id="ABR46573.1"
FT                   /translation="MKQLKVMTIFGTRPEAIKMAPLVKALEAEPRIQSTLCVTAQHREM
FT                   LDMVLELFDITPDYDLNVMAHGQTISDITVKVLKGLEAVLEKEKPDIVLVHGDTSTTFV
FT                   GALAAFYQKIKVGHVEAGLRSGNIYSPYPEEMNRKLTGTLANLHFAPTQGNFDNLIKDG
FT                   INPDKIVITGNTVIDALLQVVKEDYVFQGKTLNQIDYAHKKVIVVTCHRRENWGEPMEN
FT                   IFQAIREVAQGNEMVEVVFPVHLNPKIQQLAQEFLGDVSNVHLIEPLDYEPFANLLNRA
FT                   YLILTDSGGIQEEAPALGKPILVMRTETERPEAVAAGTVKVIGVKKERIIAEVKALLSS
FT                   EKAYETIANAVNPYGDGKACGRIVEGLLNAYSKASEI"
FT   gene            383912..384139
FT                   /locus_tag="Amet_0344"
FT   CDS_pept        383912..384139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46574"
FT                   /db_xref="GOA:A6TK56"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK56"
FT                   /protein_id="ABR46574.1"
FT                   /translation="MGKKRHVMENLSLLSFIGISMIVPIIGGLYIGRWIDARFNTQPIF
FT                   LFVFIIMGVIVSFMNLFKVAAKDIEQKKRK"
FT   gene            384144..384590
FT                   /locus_tag="Amet_0345"
FT   CDS_pept        384144..384590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46575"
FT                   /db_xref="GOA:A6TK57"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK57"
FT                   /protein_id="ABR46575.1"
FT                   /translation="MSDPLWKTQLRVVKGVLVLNVIIAILFFFAVKEPIPYIMGLLFGT
FT                   IIVILNFRLLYLTLEKAVHMVPHKAQAYTASRYMVRYLVTGIVVYISIQAEHIHVLGTI
FT                   AGLLSIKLVILKTELFNDKEYFKNIFKKGRRRSDGGRIRTKDNI"
FT   gene            384556..385254
FT                   /locus_tag="Amet_0346"
FT   CDS_pept        384556..385254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0346"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   cpf:CPF_2458 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46576"
FT                   /db_xref="GOA:A6TK58"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK58"
FT                   /protein_id="ABR46576.1"
FT                   /translation="MEVGFGPRIIFNIGNIPISETVVMTWFVMAVLFAFAFVATRRFER
FT                   VPSGLQNVTEAIVDEMNGLTAQTMGADKKGFAPYMGTLFLFLLVSNILGIFGLRPPTAD
FT                   VNVTFALALTTFAMIHFFGAKTKGLGTYLKGFLEPFAFMLPLNILSELSLPISLAFRLF
FT                   GNIVGGFIIMALLYGGLASVSGMIGLESFPIFAAGIPVALHLYFDLFAGVLQTFIFVML
FT                   SMVFIAMAMD"
FT   gene            385338..385892
FT                   /locus_tag="Amet_0347"
FT   CDS_pept        385338..385892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0347"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   fnu:FN0363 ATP synthase C chain, sodium ion specific"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46577"
FT                   /db_xref="GOA:A6TK59"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK59"
FT                   /protein_id="ABR46577.1"
FT                   /translation="MGTTDFITMFFEWLATFEPRALILASTAIAAGLAMIAGIGPGIGQ
FT                   GFAAGKGAEAASLNPKSAKSASMVMLLGAAVAETSGILSLVVALIMLYANPLVNTDGAA
FT                   IILSASVIGAGLAMIAGIGPGIGQGYAAGKGTEMVGKRPQYQPMIVRTMFLGQAVAQTT
FT                   GIYALIIALVLMFANPLVGLL"
FT   gene            385990..386256
FT                   /locus_tag="Amet_0348"
FT   CDS_pept        385990..386256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0348"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   fnu:FN0363 ATP synthase C chain, sodium ion specific"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46578"
FT                   /db_xref="GOA:A6TK60"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK60"
FT                   /protein_id="ABR46578.1"
FT                   /translation="MEPITGKALILAASAIGAGLAMIAGIGPGIGQGYAAGKGAEGVGR
FT                   QPEAQGDIVRTMLLGAAVAETTGIYGLIIALILLFANPLVGLL"
FT   sig_peptide     385990..386097
FT                   /locus_tag="Amet_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.711 at
FT                   residue 36"
FT   gene            386324..386830
FT                   /locus_tag="Amet_0349"
FT   CDS_pept        386324..386830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0349"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   tte:TTE0633 F0F1-type ATP synthase b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46579"
FT                   /db_xref="GOA:A6TK61"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK61"
FT                   /protein_id="ABR46579.1"
FT                   /translation="MQGLVEFVLSNFIFTLINLWIMYWVLKKFLFKPTTEYMEGRKKSI
FT                   ADSIQEAEMKNKEADESKAQYDMKLQDIKKERSQIIDEATKRAEKRGDEIIKAAEDEAE
FT                   KVIERAMTEIQREKQKSLNEMKNEISQLAIAAATKVIEKDLDEGTHHKMIQQFIDEVGE
FT                   TKWQN"
FT   gene            386818..387360
FT                   /locus_tag="Amet_0350"
FT   CDS_pept        386818..387360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0350"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: dsy:DSY4915 ATP synthase F1 delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46580"
FT                   /db_xref="GOA:A6TK62"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK62"
FT                   /protein_id="ABR46580.1"
FT                   /translation="MAELVAKRYAKALFQVAFEMNRYEDVTEELAFVAENLKQHSDLNE
FT                   LLKSPVITLGEKKEILSTIFKEQISPEVFNFLRILLDKSRQGDFQEIYEEYKILADAGK
FT                   NKIEAVAITALPMDNNDLLKLQVNLSMSSGKNVKLKNEIDPTVIGGVLVKMGDKIIDGT
FT                   VKARLNQMQDQLLQIIV"
FT   gene            387378..388895
FT                   /locus_tag="Amet_0351"
FT   CDS_pept        387378..388895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0351"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; KEGG: chy:CHY_2547 ATP
FT                   synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46581"
FT                   /db_xref="GOA:A6TK63"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK63"
FT                   /protein_id="ABR46581.1"
FT                   /translation="MNLRPEEISSIIQEQIKRYENKLEVKDVGTVIQVGDAIARIHGLE
FT                   KCMAGELLEFPGGVYGMALNLEEDNVGCVLLGSDDKIKEGDTVKRTGRIVEVPVGEALL
FT                   GRVVNSLGQPIDGKGPIQTDKYRDIERVAPGIIARKSVHEPLQTGIKAIDSMIPIGRGQ
FT                   RELIIGDRQTGKTAIAIDTIINQKHSDVICIYVAIGQKKSTVSQIQDTLEKNGAMEYTI
FT                   IVASTASELAPLQYIAPYAGCAMGEEFMENGKHVLIIYDDLSKHAVAYRAMSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAAKLSDERGGGSLTALPLIETQAGDVSAYIPTNVISITDG
FT                   QIFLESELFYSGVRPAVNPGISVSRVGGNAQIKAMKKVAGTLRLELAQYRELAAFAQFG
FT                   SELDKETQARLAQGERIIEMLKQPQFKPMPVEEQVMMIYAITNKYLTDIEVVEIGPFES
FT                   QFISYMVGHHAEVGQAIRDNGVLDQASETTLKEAIEAFKKQFKAERE"
FT   gene            388933..389802
FT                   /locus_tag="Amet_0352"
FT   CDS_pept        388933..389802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0352"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit; KEGG:
FT                   chy:CHY_2546 ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46582"
FT                   /db_xref="GOA:A6TK64"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK64"
FT                   /protein_id="ABR46582.1"
FT                   /translation="MGVGMQDIKRRIKSVNSTKQITKAMELVSSAKLRKARLKLEKTRP
FT                   YFKVVEETINDIVSSTQGIRHDLITPREVKKTAYIVITADRGLSGGYNANVIKAAVNHL
FT                   QEKERVSIIAIGKKGRGFFRKRGYDLDGEFTKISENPSFSDAQGIGKLGMELYKQELVD
FT                   ELYLVYTEFVSTITHKPRVVKLLPLEPQTGGEGAEKPKERDEFMSYEPSPEEVLDYLIP
FT                   KYIESMLYGALVESSTSQQGATRVAMESATDNATDMIDGLQLQYNRARQASITQEIAEI
FT                   VSGAEALK"
FT   gene            389821..391215
FT                   /locus_tag="Amet_0353"
FT   CDS_pept        389821..391215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0353"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase; KEGG:
FT                   mta:Moth_2378 ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46583"
FT                   /db_xref="GOA:A6TK65"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK65"
FT                   /protein_id="ABR46583.1"
FT                   /translation="MATGNVGKLVQIIGAVVDIRFSSEEIPALLSAITIQGPDGLVTVE
FT                   VAQHIGDDTARCVAMRSTDGLVRGMEAIDTGAPITVPVGRETLGRIFNVLGEVVDEGKP
FT                   VEAKMHLPIHREAPSFEEQEAATEIFETGIKVVDLIAPYARGGKVGLFGGAGVGKTVLI
FT                   MELINNIAKEHGGLSVFAGVGERTREGNDLYHEMIESGVIDKTSLVYGQMNEPPGARMR
FT                   VGLTGLTMAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMG
FT                   ALQERITSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQISELGIYPAVD
FT                   PLDSNSRILDPATVGQEHYEVARGVQEVLQRYKELQDIIAILGMDELSDEDKLTVARAR
FT                   RVQRFLSQPFFVAEQFTGMAGKYVPLKETIRGFKEILDGKHDDLPESAFLFVGSIDEAV
FT                   EKANKG"
FT   gene            391225..391629
FT                   /locus_tag="Amet_0354"
FT   CDS_pept        391225..391629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0354"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: tte:TTE0638 F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46584"
FT                   /db_xref="GOA:A6TK66"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK66"
FT                   /protein_id="ABR46584.1"
FT                   /translation="MASKFRLQIVTPDRTFLDEEVEMAVVRTVSGDEGILSDHMLMVTP
FT                   LKIGKMKIQIGDELKEATIAGGFIQVDQDKTIIITDAAEWPEEIDVSRAEEAKQRAEER
FT                   LQKEREEVDTFRAEIALKKATNRLGLTKNK"
FT   gene            complement(391786..392205)
FT                   /locus_tag="Amet_0355"
FT   CDS_pept        complement(391786..392205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY0901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46585"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK67"
FT                   /protein_id="ABR46585.1"
FT                   /translation="MFKMMTKGDKILIFAILALSVASIFAIPRLLTTVEEGKMVVVNLD
FT                   GTVIHRFPLEESPEAEFLEFPFEVRGQSYTGKIEMKDGRVMLHRLSDDISPLSIHTDMG
FT                   WISESYQMIVSLPIRLIITIEEEDPPEYDFDIISY"
FT   sig_peptide     complement(392125..392205)
FT                   /locus_tag="Amet_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.731 at
FT                   residue 27"
FT   gene            392531..393082
FT                   /locus_tag="Amet_0356"
FT   CDS_pept        392531..393082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0356"
FT                   /product="protein of unknown function DUF1694"
FT                   /note="PFAM: protein of unknown function DUF1694; KEGG:
FT                   dsy:DSY3042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46586"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK68"
FT                   /protein_id="ABR46586.1"
FT                   /translation="MSKKSELDKTIEVGLHGTPEIKREEKKKWLGEFRERVVLGLTKEQ
FT                   AGMMEAERYVEEALRDPMGEMLILNYSLPMKVTSKYMRVAKDLNKEYRSVSTDYPEAMG
FT                   IVVASRNAIDRQAVMPEIQGFPEKFKHLRHKELCGECYGELEQIAPDYVSQFKQINFFN
FT                   KMIGIKCSACEKKEDGGPLM"
FT   gene            393304..394143
FT                   /locus_tag="Amet_0357"
FT   CDS_pept        393304..394143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46587"
FT                   /db_xref="InterPro:IPR014794"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK69"
FT                   /protein_id="ABR46587.1"
FT                   /translation="MKKIATMAIIFSLFFGLVYYASAYFIKDQENIGDVEIHGIIQAFE
FT                   ISESRLLEYNTNTTLSIPDTFWSIEEMRIIKKDLIKAFELNGQRKDIINYEHHDPYFIE
FT                   DYEEIEGDVIYSNEIQEEGYRQITLTAIENSGKISVIILQATEFDGEKEAHIIVDIVQN
FT                   KEYKGIVETCNQSEGILSKYGMDMETTIIIVGTYDEEIETKAQLAKLEEVLHAVMGQKV
FT                   EQVQDEHYTMLTGYTSLIPQAIQYDGKTVNLQLAMRYNSYENRTYLWIATPLITTTY"
FT   sig_peptide     393304..393369
FT                   /locus_tag="Amet_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.762 at
FT                   residue 22"
FT   gene            394175..395428
FT                   /locus_tag="Amet_0358"
FT   CDS_pept        394175..395428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0358"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   tte:TTE0158 UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46588"
FT                   /db_xref="GOA:A6TK70"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK70"
FT                   /protein_id="ABR46588.1"
FT                   /translation="MGKIIVEKSGPLQGTIRVSGAKNSVLPILAASLLATEQCTLEDVP
FT                   ALKDVEVICEVLTSLGADVRRISRDKIEVSAADIDNFEAPYELVRKMRASFLVMGPLLA
FT                   RLGKARISMPGGCAIGTRPIDLHLKGFKALGAKITMGHGFVEAKADQLIGSRIYLDFPS
FT                   VGATENIMMAAVLAKGQTVIENAAEEPELIDLANFLNKMGADVRGAGTDTIKINGVDKL
FT                   GGAVHPVIPDRVEAGTYMIAAAITGGNLFIDNVMVDHLKPIMAKLRECNIEVSEEGNGV
FT                   RVIAENRPKAVDIKTMPYPGFPTDMQAQFMALMCVAEGTSVITETVFENRFMHVSELKR
FT                   MGADIKIEGRSTVIEGRTDLQGAPVKATDLRAGAALILTGLVSEGKTEISDIYHIDRGY
FT                   VDIEEKLRNVGAIIYREE"
FT   gene            395535..396539
FT                   /locus_tag="Amet_0359"
FT   CDS_pept        395535..396539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0359"
FT                   /product="Sporulation stage II, protein D firmicutes"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; Sporulation
FT                   stage II, protein D firmicutes; PFAM: Stage II sporulation
FT                   D domain protein; KEGG: cth:Cthe_2616 SpoIID/LytB domain
FT                   protein containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46589"
FT                   /db_xref="GOA:A6TK71"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK71"
FT                   /protein_id="ABR46589.1"
FT                   /translation="MRRIFFTVIAFAVATLLIPMLIIRSCDLSTPEEDKSRDPAVVESD
FT                   LKVNVYNHDTGEIMELSLEDYVTNVVAAEVPAAFEVEAIKAQAVAARTFTIWRRYLYGE
FT                   EGHPNYPGAILSTSHRDSQEWLSEEQLLERHGSRWMNDYWPKIQEAVEETQGVIMTYNM
FT                   QPIEPLYHSTSGGMTENSEDVFASAVPYLRSVSSPYEERSPVLIDEKIVSIKEFIDTIK
FT                   DRYPRIELNQSNLDRQIDILERSSGGRITRIKVGSEELTGREIREFFELRSADFEMNFS
FT                   QNNVTFITKGYGHGVGMSQWGANGMAEQGYSFEKILEHYYQGVTLSRLVTYRE"
FT   sig_peptide     395535..395612
FT                   /locus_tag="Amet_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.709 at
FT                   residue 26"
FT   gene            396661..397545
FT                   /locus_tag="Amet_0360"
FT   CDS_pept        396661..397545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0360"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: cth:Cthe_2617 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46590"
FT                   /db_xref="GOA:A6TK72"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK72"
FT                   /protein_id="ABR46590.1"
FT                   /translation="MSNENNNKNNNDKKKDKKTLYQFLDKEGFYIILFLCVCIVAVTAI
FT                   WVSNQSGDDFISEAPEDRGPDVTLVEGDGEEQEQEEDSRETAIVGESEEEGEPSEETSQ
FT                   NTEKLEEQEQIQEQESEKPIVEATPKQEEKPKTQEIIEDKDAKEEVAPTASSAQDMALP
FT                   VVGKLGMSFADDRLVYHRTLEQWATHHGIDLHAEEGAPVKTVLTGEVVEVLNDSIIGIT
FT                   VTIDHGDGLMTRYSNLSTDAMVNVGDHVEKGKTISGVGKTSVNKREEGALLHFQVLKDN
FT                   KPVDPQAYLPKLN"
FT   gene            397788..398372
FT                   /locus_tag="Amet_0361"
FT   CDS_pept        397788..398372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0361"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO3684
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46591"
FT                   /db_xref="GOA:A6TK73"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK73"
FT                   /protein_id="ABR46591.1"
FT                   /translation="MARITEPEKMENIKKAVMGAIIEHGYTGMSIASISERAGVSPGYL
FT                   YRHYSSKEELVQELVDSQMSKIFNSFIADIDTSSTIYEAAYKTIGKLFMKANEEPILAK
FT                   FMASVVMDVRIPAKNKADNFKNILELASKCIELGKKTGEINQRVTATEVLTVSFTIPFR
FT                   YLLISFELDKDKKFTQEEIKRITTICVNAMR"
FT   gene            398445..399605
FT                   /locus_tag="Amet_0362"
FT   CDS_pept        398445..399605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0362"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dsy:DSY3360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46592"
FT                   /db_xref="GOA:A6TK74"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK74"
FT                   /protein_id="ABR46592.1"
FT                   /translation="MKRITSILLISLLILTGCTAEHIEEEKEVVKKVYTKTIEASAYSN
FT                   DLTLSGNVVPTQMVKLSFKIPGVVSNVLVNEGDVVKEGQPIATMEQGDYLIRVKASQAE
FT                   LEAARLQIETEIPAKTNQAKAQYELTKIKYDRVKALFEQGAVSQSQLDEISTKLIVDEN
FT                   TYNQAVDAKEVAETKLQMAEASLDLANANISDTTIYSPIDGVILQKIVASGETTSGGHP
FT                   IVVIGEVNKVWAEIGVSDEYINALRIGQKSDVYIYGIDKTVEGIIDEIAFLADTKTRTF
FT                   PVKILLNNPNGELKPGMITKVNLNLSNKEKMLIPLSSVLQLSTGSAVYVYSEETQTVSM
FT                   RMIETGEIVKDKIEVIEGLELDEKIVIEGQFLLREGEQVVVEELIV"
FT   sig_peptide     398445..398507
FT                   /locus_tag="Amet_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.776 at
FT                   residue 21"
FT   gene            399602..402673
FT                   /locus_tag="Amet_0363"
FT   CDS_pept        399602..402673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0363"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   swo:Swol_1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46593"
FT                   /db_xref="GOA:A6TK75"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK75"
FT                   /protein_id="ABR46593.1"
FT                   /translation="MIKWSVNHKSIIMLFVVLTLIVGGFLYGAMERQENPTVAAPVAVI
FT                   KIIYPGATPEDIEKLIIKPVEDEMNRISDIKTIESFALDSIGIVKVTLKDLSDGKIDEA
FT                   WNEVKSGLDTVKPLLPPDAHEPTMETDLASSYGIIIGLTSQDYTYQNLSEVANKLRDEL
FT                   ITDPGVKAIDIDGEINDQIHINLDMIKLEQYTVSPTDIATAIKARNINIPGGNLVMDQV
FT                   KIPVQVSGEYKDIEEIKNTIVAVSTETGAPIYLKNVADVVRIQEKKEIFASVNNEKALL
FT                   IGVEYMDGQNIVAIGERLNTILDEFSMNQLYENMELITLTDQANFTKDAINLFEKNLLS
FT                   AILLVVMVVVVTMGLRSAIVVSLPIPIVIVMVFIFMYLSGIPLHQVSIASLIISLSLLV
FT                   ANGIVVNDNINVYLEKGHDRLTACTKGIQEVKIPILTSTLTTVASFIPLAMMQGVSGKF
FT                   VKSLPVLVSVALIGSYITALTVIPALGYKLLKVKEKDTEGKGIKTKIAKVLKVDGFSAY
FT                   ILNLYGRLLKGALKIPVLVILFFVGTLIASLWVIPSLGVQLFPPVERDQYVIDVTTQDG
FT                   SDVEKTEKAAIMIGDLLKEDVTINDFAYKVGDGMLQYYVTFIPNDPASNKVQFLINGDR
FT                   DEVSRIEKELSTKVPGVSINIRQLENAAPVTYPVQVRVSGQEISELRRIAEEIKDITHD
FT                   VPGIKSIEDNYGYDSYKLNIRVNEEKANLVGVTNYDIASTVRMAVNGLTVSELKEEDIE
FT                   KDAIPIILKIPDEKKQDRDVLNNIFITSQITDKNIPINQIAEIETETSLNKIVRRNGGR
FT                   TITVGIFVESRYNSNEISKSVEELLKDYKLPDGYTIEFGGESEERSDAFDSMKVPAILA
FT                   IVIIYLILVIQFGNLKEPLIIMGTIPLSFIGIIWGLKWMGYPIGFMALLGAISLMGVVV
FT                   NNGIVLLDFIKLLVKEKDDVKEAIIEACKTRMRPIMIGMITTVISLIPLALSGGALWAP
FT                   MATSIIFGMLVSSVLTLLVIPCAYFVIQGKEGLN"
FT   sig_peptide     399602..399688
FT                   /locus_tag="Amet_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.755 at
FT                   residue 29"
FT   gene            402814..403077
FT                   /locus_tag="Amet_0364"
FT   CDS_pept        402814..403077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0364"
FT                   /product="Sporulation stage III, transcriptional regulator
FT                   SpoIIID"
FT                   /note="TIGRFAM: Sporulation stage III, transcriptional
FT                   regulator SpoIIID; KEGG: cno:NT01CX_0524 stage III
FT                   sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46594"
FT                   /db_xref="GOA:A6TK76"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK76"
FT                   /protein_id="ABR46594.1"
FT                   /translation="MKDYIEKRAVEIANYIINQGATVRQTARVFGVSKSTVHKDVTERL
FT                   PKINPLVANQVKDILDTNKAERHIRGGKATRMKYKSKDRRVQ"
FT   gene            403426..404451
FT                   /locus_tag="Amet_0365"
FT   CDS_pept        403426..404451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0365"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: cth:Cthe_2619 cell
FT                   shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46595"
FT                   /db_xref="GOA:A6TK77"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK77"
FT                   /protein_id="ABR46595.1"
FT                   /translation="MFGFGSDIGIDLGTASVLVFVKGKGIVLQEPSVVAIDKNTNNILA
FT                   VGEEARRMLGRTPGNIVAIRPLKDGVISDYEVTEKMLRYFIQKTTGKRIFFKPKIIVCV
FT                   PSGVTEVEKRAVVDATTEAGARTAYLIEEPIAAAIGAGLDISIPNGHMIVDIGGGTCDV
FT                   AVISLGGIVVSTSIKVAGDKFDEAIIRHMRKRHNIMIGERTAENMKIEIGCAYPRAKEV
FT                   TMDVRGRNLVSGLPVNIKISSEEILDALEESVSSIADAVHSVLEKTPPELAADISDQGI
FT                   VMTGGGALLWGLDKLISKRTGIPVYIAEDAISCVAKGTGQALDSIHLLESGANAKRGGR
FT                   R"
FT   gene            404654..405361
FT                   /locus_tag="Amet_0366"
FT   CDS_pept        404654..405361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0366"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: swo:Swol_0941 ATP binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46596"
FT                   /db_xref="GOA:A6TK78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK78"
FT                   /protein_id="ABR46596.1"
FT                   /translation="MIKKAIELKNVRKVYRVGEEKVIALNDISFSVDYGEVCCLLGTSG
FT                   SGKSTLLNMMAGLEKPTRGQVIVNGRHVEKMDENRLVQFRQKNIGFVFQSYNLLPTLTA
FT                   IENVSLPLTFRGVNKKIRERLAVEMLEAVGLKTHIKHKPTQMSGGQQQRVGIARAFVTK
FT                   APIIFADEPTGNLDSKTTDEVLKLMLRLVKENNQALVLVTHDKGISKFAHKVYYMLDGN
FT                   IEKVEVNSSKMGG"
FT   gene            405365..407389
FT                   /locus_tag="Amet_0367"
FT   CDS_pept        405365..407389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0367"
FT                   /product="S-layer domain-like protein"
FT                   /note="KEGG: cth:Cthe_3171 S-layer domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46597"
FT                   /db_xref="GOA:A6TK79"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK79"
FT                   /protein_id="ABR46597.1"
FT                   /translation="MKKRINKISIILLLILILQPFSGYAQDRIQDANLVIGRNYKVPVL
FT                   QAGNEERLSIPIENTTSGEAYSIYVSPIIDDPAEFPFVIDQMIPSRRIAAIAGKTRENV
FT                   HFNFQVRSNIEPKTYPIQFNIEYTLPSGNIAKTSETIYIQIENDQEVPNLRLNLMKMAQ
FT                   DKLVAGQNQPVTLTIENTGDLVAKNIEVQLTGVEANGISLITPIDTHKIDQMEGKEKKE
FT                   VFYTIVADDNLEDGTYVLDLIMKYKDEYNKAYEGESKVRIPVVASSSVETSFSLEKLNY
FT                   PETAIEPHTDFTISFDLKNTGAEDAQKVKVSIDGGEGILPKSMPIKNIGNLVAGKQQPV
FT                   EFTLFAKEGIEDKNYPIQITVEYETDSGRTKEMKSFEQYVGVFVKDKKTSAGAPKIIVD
FT                   QYDYDGEYVKAGEPFDLTVSFLNTNHEKTVKNIRVSISSTGDVFAPVTGSNSFFISEIT
FT                   SQGSTMKNISLRPKVDAEYDTHNLFIDIEYEDDQGEAYSVKEMVGIPVVQNVTLMIDEV
FT                   MTSPENYSGNPTALSVEFYNTGRALIRNLVIRTEGDIDITEGSLYIGNLEPGKNNYYDV
FT                   TVTPREPGTTTGRMIFEYDDEIDQHYVVEKEFSIEVMDQMEMYPPDDFGEFEEFNEQSN
FT                   SPMIRIVVGGGMLLLVIGGFVWRRRKKRRAEAEEVEAYE"
FT   sig_peptide     405365..405442
FT                   /locus_tag="Amet_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            407382..408731
FT                   /locus_tag="Amet_0368"
FT   CDS_pept        407382..408731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0368"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   swo:Swol_0943 ABC transporter component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46598"
FT                   /db_xref="GOA:A6TK80"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK80"
FT                   /protein_id="ABR46598.1"
FT                   /translation="MNSLDLFKMALDNLLRRKTRTVLTVLGVVIGTSSIVVMLSLGIAM
FT                   NEGFKDQLSNMGDLTMIDVHNYGGYDGDGRSSQSKQVHLNDDAVRRFKQIPKVQGVMAT
FT                   KSAYMKMAAGNMVGYVPIIGIDPLVMEAFGFKVAEGRILMPTDKESIVFGKNIAMNMYN
FT                   PRLRNAQRGGWGNEQPQVNLISNRLELTTNMEYGEVRNVGQETDQSYTPPKPHNVQGVG
FT                   ILEESFSEKDYNAYMNITALEKILEEDRRANRQDRSMGNMRQNENDYERVSIKVNEIDD
FT                   VLGVQEIVKDMGFQAFSLTDMLNSMQETAQTIQMVLGGIGAVSLFVAAIGITNTMIMSI
FT                   YERTREIGIIKVLGANLSDIRKLFLIEAAMIGLLGGIMGLVLSYTISFGLNKINVGFMG
FT                   PGGGDTAISIIPIQLSLAAVAFATVIGIVSGYSPARRAMKLSALEAIKSE"
FT   gene            408878..409969
FT                   /locus_tag="Amet_0369"
FT   CDS_pept        408878..409969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0369"
FT                   /product="flagellar basal body rod protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; KEGG: tte:TTE0172
FT                   Flagellar basal body and hook proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46599"
FT                   /db_xref="GOA:A6TK81"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK81"
FT                   /protein_id="ABR46599.1"
FT                   /translation="MFRGLYTATSGMQTAQRKLDVTSNNIANINTTGFKKDVVAAESFP
FT                   EVLIRKINHDIRPRPFNLNSGVEVTREGEALGLSTDAGFFRVETDQGISHNREASFAPD
FT                   EDGFLRTYRRDLNGEIDASRGNYLLDATGQRVQVDNGNLEVNNQGQLTFGGGATNLLYR
FT                   PLGHVLGTMNSGVRIQKIETNFAQGAVAETANPLDVALNGQGFFRILTPNGEMYTRNGN
FT                   FTMSNEGQLVTTEGHEVEGNAGAITFNEAQLMAAENIQITDKGEILLDGVVVDQIQIVN
FT                   INNVKDLRKHGQSYYYGEEGFELELAPFEGEVLQGYLEESNINSIQEMVEMISTFRDYE
FT                   ANQKVVQAYDEILQKAVGEIGKL"
FT   gene            410019..410813
FT                   /locus_tag="Amet_0370"
FT   CDS_pept        410019..410813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0370"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; KEGG: tte:TTE0173
FT                   Flagellar basal body and hook proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46600"
FT                   /db_xref="GOA:A6TK82"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK82"
FT                   /protein_id="ABR46600.1"
FT                   /translation="MRALWTAASGMKAQQLNIDTVANNMANVNTTAYKAQRTEFKDLLY
FT                   ANMKRTNLNNGQGSPVNLQVGHGVMPVATSRMFTTGNLEQTANPLDVAIDGEGFLAIEG
FT                   PNGEIYYTRDGSLKFSVEMDEMRLVTSEGYTVLSDFDFEIIFDEGMKNIAISEGGVITA
FT                   ENEFGDIEELDTIKLVKFLNPQGLESVGRNLYKETVASGEEIPMEGEGRTSSILQGFLE
FT                   TSNVQIVDEMVKMITAQRAYETSSKTIQTADEMLGMANNLRR"
FT   gene            410844..411215
FT                   /locus_tag="Amet_0371"
FT   CDS_pept        410844..411215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0371"
FT                   /product="Rod binding protein-like protein"
FT                   /note="KEGG: dps:DP2685 similar to flagellar muramidase
FT                   protein (FlgJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46601"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK83"
FT                   /protein_id="ABR46601.1"
FT                   /translation="MNPMNAIHRYVPTKSAPELKGNEDAQGLKEVTQDFEAVFINMMLK
FT                   QMRATVSEGGLTEKSYGRGIFEEMQDENMAEVMSKGRGIGIAQELYRQLSHHVQPRATV
FT                   SQEASNQETEAIDEVVTED"
FT   gene            411234..411677
FT                   /locus_tag="Amet_0372"
FT   CDS_pept        411234..411677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0372"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ; KEGG: cth:Cthe_2625
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46602"
FT                   /db_xref="GOA:A6TK84"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TK84"
FT                   /protein_id="ABR46602.1"
FT                   /translation="MELNNIEIQKIIPHRYPFLLVDKMVEVELGKRGVGIKNVTANEPF
FT                   FQGHFPGNPIMPGVLMTEALAQVAALICMGLEENKGKLGVFTGIDKCKFRRQVVPGDVL
FT                   RLEIEMTALRRGIGKAEGKAYVGEELACSASLTFALINPNTDK"
FT   gene            411885..412724
FT                   /locus_tag="Amet_0373"
FT   CDS_pept        411885..412724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0373"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   swo:Swol_0164 transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46603"
FT                   /db_xref="GOA:A6TK85"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK85"
FT                   /protein_id="ABR46603.1"
FT                   /translation="MGRKPRVEYKGAIYHVIKRGNNREYIFQNREDKESLLACLEDANK
FT                   EEVFNLLGYVIMDNHYHLMIETKEKPLHKIMQKVNNTYSKNYNKRHKRSDHVFGGRYKG
FT                   ILVKDDKYLFSLLRYIHYNPVRAKMCENIAQYNWSSDQFYRNNIKKQVHIDKILNMFSP
FT                   NRRMALEAYERFMDQKEPIIKAKDFYEEGHEIGELEKENNSSPTESRNNNKNLDEILRD
FT                   VVDNEDDFQLIKSGSRKRYLRNYKISYVKAAVEQGYTFKEIGNHVEVSAVAANKMVQ"
FT   gene            412896..413783
FT                   /locus_tag="Amet_0374"
FT   CDS_pept        412896..413783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0374"
FT                   /product="protein of unknown function DUF368"
FT                   /note="PFAM: protein of unknown function DUF368; KEGG:
FT                   oih:OB0592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46604"
FT                   /db_xref="GOA:A6TK86"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK86"
FT                   /protein_id="ABR46604.1"
FT                   /translation="MEKAMEDVIGVSKNQTLLLMKGIILGMGVIIPGISGGTIMIAFGM
FT                   YEKMLDDLLKFHIKPYITMGFGALLGVFTGSFAFSYLFEFYRNPTSAFILGCLLMSIPF
FT                   ILKRSKGYTRKDVALFVIGGILAYGLMEMPTLLQAGGLTAFHIFIAGFISSSTMMIPGV
FT                   SGSAVLIILGIYEEMLLVINGFQLINLSIFVMGAALGVFILAKLLKTLFSIHGSQILFF
FT                   FSGLILGSSRILFPSELEFLSLITFILGVGVVYKWGNFKYKKNSPFLGRTYKSIKSNIE
FT                   TLSYKIGQVIRRKQ"
FT   gene            413899..414822
FT                   /locus_tag="Amet_0375"
FT   CDS_pept        413899..414822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0375"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   cpr:CPR_0469 UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46605"
FT                   /db_xref="GOA:A6TK87"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK87"
FT                   /protein_id="ABR46605.1"
FT                   /translation="MKVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTLQYIIEEAV
FT                   DSGIEEILIITGRNKSSIENHFDKSIELELELEKKGKDELLKQVRAISDMVNIHYIRQK
FT                   EPKGLGHAIHCAKSFIGNEPFAVMLGDDIVENDKPCLEQMMEMYDEYKTTILGVQEVPK
FT                   ESVNKYGIVDGMHIEGGIYKVKDLVEKPSPQEAPSNIAILGRYIINPEIFDILENTKPG
FT                   KGGEIQLTDALKELAHREAMYAYVFEGRRHDVGDKQGFLEATVEFALKREDLREGFLNY
FT                   LEDVVKKERESKALEEVAVTTEQKSS"
FT   gene            414963..415133
FT                   /pseudo
FT                   /locus_tag="Amet_0376"
FT   gene            415537..415785
FT                   /locus_tag="Amet_0377"
FT   CDS_pept        415537..415785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0377"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   chy:CHY_2512 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46606"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK88"
FT                   /protein_id="ABR46606.1"
FT                   /translation="MPNIKPVSDLRNYNEVLKDIAIGSPVFLTKNGRGKFAIVDIEEYE
FT                   KNQATIKLLSKLMEAENRIKTDDDWMTEDQVKEKLGI"
FT   gene            415790..416116
FT                   /locus_tag="Amet_0378"
FT   CDS_pept        415790..416116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0378"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: dsy:DSY2129
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46607"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK89"
FT                   /protein_id="ABR46607.1"
FT                   /translation="MHKLRINPMATEDLIEIRDYIMKELENPTAAVNVVRKIIESYEQL
FT                   KEFPMLGVDLSTKVNVQTDFRYLVSGSYIVFYQADNESVSIYRILYARRDYLKILFPNE
FT                   VDID"
FT   gene            416849..417502
FT                   /locus_tag="Amet_0379"
FT   CDS_pept        416849..417502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46608"
FT                   /db_xref="GOA:A6TK90"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK90"
FT                   /protein_id="ABR46608.1"
FT                   /translation="MKKRTLIITVSIIILLLATGMVGYRYFLGPNEKLRAEISQEFEIG
FT                   FFDFSDLNLDEKLVNEAQAVGGETDASQTDKEKDVVENSKENEDSYVDMIEKKVVTITE
FT                   ENIANKYTPRFQRLQDQVVDRIDGLMEIGYKEYQEKRGTKDFSRTSFARKYMQAATMLE
FT                   DSVDSSFNELLIEMERELKANELPLGLLKEAKTTYDNAKKAKRSELYKMYEKFL"
FT   sig_peptide     416849..416911
FT                   /locus_tag="Amet_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.668 at
FT                   residue 21"
FT   gene            417588..417758
FT                   /locus_tag="Amet_0380"
FT   CDS_pept        417588..417758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46609"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK91"
FT                   /protein_id="ABR46609.1"
FT                   /translation="MKPGGAFYWEENIANKYTPRFQRLQDQVVDRIDELMEIELKANEL
FT                   PLASLKEAKTT"
FT   gene            417816..418511
FT                   /locus_tag="Amet_0381"
FT   CDS_pept        417816..418511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0381"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: cac:CAC2546 transcriptional regulator, FadR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46610"
FT                   /db_xref="GOA:A6TK92"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK92"
FT                   /protein_id="ABR46610.1"
FT                   /translation="MSMEQKTDKVYQQVIDYISCLIKEGILKKGDKIPTERDLSVRFGV
FT                   SRNSIREALKILEVIGLVVRRQGDGTFIKEQFDDCLTEPLSMVFMLEEIGIDDIFQFRN
FT                   MIEVQTVVLAASRITDAEIQQLEMTYQNMIRETDDVNKAKYDIEFHHIIAKASRNVLIL
FT                   NSYNVMSSLMGAFINNIRIKVLEGGGTEEVVSAIHKKILEALKSRDPQLAEVAIKEHME
FT                   VINSMFKQV"
FT   gene            418827..418943
FT                   /pseudo
FT                   /locus_tag="Amet_0382"
FT   gene            complement(419542..420306)
FT                   /locus_tag="Amet_0383"
FT   CDS_pept        complement(419542..420306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0383"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /note="PFAM: helix-turn-helix domain protein; bacteriophage
FT                   CI repressor; KEGG: ecv:APECO1_376 putative repressor
FT                   protein encoded within prophage CP-933O"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46611"
FT                   /db_xref="GOA:A6TK93"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK93"
FT                   /protein_id="ABR46611.1"
FT                   /translation="MIENFSTVGKRIEKSLEVLGIKAVDVCRSSGISKNAMSNYINGNR
FT                   VPNAEILVKLSDVLKVSIDWLLTGKGKGPEKAANFIFQEPVIEQDLVAESEASYFHQVE
FT                   DIVRYNIEIGKNITHVREDAKMDVEQLAAAINIKPQALKDYESGKKVIPSYVIHRICKE
FT                   LSVLPLFLLDPEEVIDKEYKSENADFGHSLTQFEQDTLHFFRELSRSDQEEIAHMITFK
FT                   HEKGNKKGRSSRSTNGDNRNDEQAAASEKKMA"
FT   gene            420608..420793
FT                   /locus_tag="Amet_0384"
FT   CDS_pept        420608..420793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46612"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK94"
FT                   /protein_id="ABR46612.1"
FT                   /translation="MKMMVEKDVVINKIIKLIVDEMEEEGKGNLTALYTIGVLKEAIGR
FT                   VEGTALMTPARKSIRD"
FT   gene            421139..421345
FT                   /locus_tag="Amet_0385"
FT   CDS_pept        421139..421345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46613"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK95"
FT                   /protein_id="ABR46613.1"
FT                   /translation="MKLTLQHIRNLNEQQWDRLKEITLLHTRLAKEHIDIFNTPGVELR
FT                   KQELKRQIVALRSERDEILATAS"
FT   gene            421320..421790
FT                   /locus_tag="Amet_0386"
FT   CDS_pept        421320..421790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46614"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK96"
FT                   /protein_id="ABR46614.1"
FT                   /translation="MKYWLLLAKEGGVYVIEKRKVGKGGSIRYKNKNYTSNVLKKYVGR
FT                   TFEIEPLLEVNVLWVFDDEKSRICEARQEGVSFEETFGIAKKEEVKGDDDVFFGLGKKL
FT                   KDYKEKELAKELANRHGAKMIKVSPGQFYQVKGNGSRIKEEGPATIFVIRNN"
FT   gene            421815..422039
FT                   /locus_tag="Amet_0387"
FT   CDS_pept        421815..422039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE2173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46615"
FT                   /db_xref="GOA:A6TK97"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK97"
FT                   /protein_id="ABR46615.1"
FT                   /translation="MRKNKMTEFGLWIKQSLLELDMTQRELSESIGIDERFLSMILYGL
FT                   RPGYDYRDKIRSVIEGEQAKKIAVKSKTA"
FT   gene            422198..424255
FT                   /locus_tag="Amet_0388"
FT   CDS_pept        422198..424255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0388"
FT                   /product="Transposase-like, Mu-like protein"
FT                   /note="PFAM: Transposase-like, Mu-like; KEGG:
FT                   bcz:pE33L466_0072 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46616"
FT                   /db_xref="GOA:A6TK98"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR004189"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK98"
FT                   /protein_id="ABR46616.1"
FT                   /translation="MEAYISIEEAAKLEGVAYYTLYRKIQRNKEDFETTIEPSESGGKD
FT                   RVMVALDSLTKKARRTYKAKHEVPDNKEEAPWYTQVDISWYRKNYSKYFYEAVEISKQI
FT                   EIYLNYEGKNKTKFATEIAKKLEVSSRTLLSRVKDYIEAKAWADTMEEASKKNYDYFMV
FT                   LALCRKPREKNQFPSLTEPVKTKIENIFYSKVFQENNQPLTNLYEDLEDWTIEKGLPLP
FT                   SYDTVWRYIGHIEKEDGEGATALVARGKRQWKNDFMMKRKRDVESLQVLEVLQGDVHSF
FT                   DCWVSVRRSNGKLQAIRPALVGWLDMRSRTLVGWAVAENPDALIIKKSLINAFYPKVNS
FT                   LLPYGVCKYLLIDNGKEYTAESLTGRSRKIRVQLDADVKGFYRSIGIEDDMRSLPFQPW
FT                   SKAQVERFFGTVCEKFTKRTISYTGTLTGSKTDAKVKKDIAKMLENGELMTMEEFAQKF
FT                   EKWVVEKYHTRVHGGLKDQGEESPVPVDVFHHAERYYKAAPPLEYALSLLLESEERSVT
FT                   NMGIKITRDGKAIYYQNQDLSKYIGQRVDIRYHPEDITRIYVYNKEGKKVCEAVSYELL
FT                   RIAPKLSQKAFEEHNKDQKRHLRNETDKVKYRQMTYEERQQHEKDIIENADKKIVTPEM
FT                   ANKNDKVVAIPQDEQYKDELKHKKTKQKSDENEYFERQSAKALAALKKLG"
FT   gene            424271..425194
FT                   /locus_tag="Amet_0389"
FT   CDS_pept        424271..425194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0389"
FT                   /product="Uncharacterized ATPase putative transposase"
FT                   /note="KEGG: cjr:CJE0269 bacteriophage DNA transposition
FT                   protein B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46617"
FT                   /db_xref="GOA:A6TK99"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TK99"
FT                   /protein_id="ABR46617.1"
FT                   /translation="MAVQLYRNAPELAQEMEELLKRTGMSKEKASKEIGYSRTALSRYL
FT                   SGDYESIELELAIRRFLDEKQAGKEKVVRQLRDELFITRDVEDIMGVCQGCQEDQGLGV
FT                   IVGKSGFGKTETLKEYAKLDRVCYVECDDSMGSRDLVEAIEEAIGLPQGYGSIWKRVKG
FT                   IKEFFEVNRGYLLIVDEADKLVTKYTQKKMEILRTIFDQDTVGLVIAGEPKLESMVKGF
FT                   IARFANRVDFCITLKGLSREEVIEYLQFCKISDRAREELIIRGTNSNTGCFRLLDRTLR
FT                   NVLRLVEDEREIDLKTIEKVSKMMML"
FT   gene            425194..425448
FT                   /locus_tag="Amet_0390"
FT   CDS_pept        425194..425448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46618"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA0"
FT                   /protein_id="ABR46618.1"
FT                   /translation="MASGCILDTCWVCDDLVWEDDWILYNEQFIHPACAENKTQLMKDK
FT                   ASRLHYEDEMTEDLQMLKRMLGSCQKEIERLENLIKRRA"
FT   gene            425450..425677
FT                   /locus_tag="Amet_0391"
FT   CDS_pept        425450..425677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46619"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA1"
FT                   /protein_id="ABR46619.1"
FT                   /translation="MEDVLIKMEGAAQRKRLEENLKVNINSLVEGLETKERTIEEIKNY
FT                   IEKEYIGKGALKLFINRVEAKGNVGISKGR"
FT   gene            425655..426410
FT                   /locus_tag="Amet_0392"
FT   CDS_pept        425655..426410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46620"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA2"
FT                   /protein_id="ABR46620.1"
FT                   /translation="MEFQKGDRIKVTCNSKKPKSSKSFEGIVVGEYDGFITIHQGSYIV
FT                   TTSKLEVINGNTTIEVLEKGETETVPRKKSIDKETLLKECIAYGWNNTAIETISEKYGL
FT                   SKLTIKTYYGKWGIADLIAEKRDKSEVDELFENIRKEEDEIDSKKETDLDWKANDRLTK
FT                   VINEAGLSKVRTKAQEAIGEAPHSEKGTLRKVMTIYKGDIMEYEIDKATIKIRNEENYD
FT                   NYIIVAKEEILKFVNELHELTKNIIEEAK"
FT   gene            426394..426651
FT                   /locus_tag="Amet_0393"
FT   CDS_pept        426394..426651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0393"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: swo:Swol_0047
FT                   transcription regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46621"
FT                   /db_xref="GOA:A6TKA3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA3"
FT                   /protein_id="ABR46621.1"
FT                   /translation="MRRQNNMKTKKINKSGGFTIPSDIRREIDMDKGQAVDIEVEAGKL
FT                   IISKHTPRCMFCRTIDGVVRYQNNHVCSKCIKEMGDKVDG"
FT   gene            426644..427297
FT                   /locus_tag="Amet_0394"
FT   CDS_pept        426644..427297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46622"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA4"
FT                   /protein_id="ABR46622.1"
FT                   /translation="MDNIKKVVNELAKWDALMADGRKEMNKHKLSIQNEAASALENSKV
FT                   KQVKFYGDDSNCAIVTTAEKVELVSIEYLRGVIPENILKDFAKEEIQYKLTAPFKNVVG
FT                   PLVSGNYTERKVLDIIEEMNLSEGKAKVAKKKLKGNFEKDVEFLKTIGHSQEEAEHWAY
FT                   FITEAAAWERIVNFMEVSGYEEGTPGFQDAIKKLKHAVIVDETLKIGVEYEKDE"
FT   gene            427347..427775
FT                   /locus_tag="Amet_0395"
FT   CDS_pept        427347..427775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46623"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA5"
FT                   /protein_id="ABR46623.1"
FT                   /translation="MEVITGLQIKKIWATAREIGLEKEDLYTIIYRESKKESMKQLTKA
FT                   QANKVIDAMVRPKKKKKQKRTDDGGRSSTKAQRQTIYRMTEELGWNNDNDRINGFVKKM
FT                   FEVERLEWLDGYGCSRLIEILKKMIKRIEVEKVVEKDG"
FT   gene            427768..427992
FT                   /locus_tag="Amet_0396"
FT   CDS_pept        427768..427992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46624"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA6"
FT                   /protein_id="ABR46624.1"
FT                   /translation="MAKQMISIKIDIEFDIEDMKKSLKERGILPNKANTDRMVKMIRSG
FT                   RFLMNKGFLAGQPMDKETLLMYGFTFENE"
FT   gene            428063..428224
FT                   /locus_tag="Amet_0397"
FT   CDS_pept        428063..428224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46625"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA7"
FT                   /protein_id="ABR46625.1"
FT                   /translation="MLPSKEEFVEKVIELRTKQREQKQRDYMAYVKGATVRMASRKCNW
FT                   KLRGSRSS"
FT   gene            428229..428885
FT                   /locus_tag="Amet_0398"
FT   CDS_pept        428229..428885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0398"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; KEGG: cpr:CPR_1733 RNA polymerase
FT                   sigma-E factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46626"
FT                   /db_xref="GOA:A6TKA8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA8"
FT                   /protein_id="ABR46626.1"
FT                   /translation="MEKLLHKVNFKEPMTEEESKRLINQFRELNNEEIRKHLIERNLRL
FT                   VAYEAYKYKNQDSEDIFSVGCIGLIKAIDSYDPSKQTRFDTYANRCIQNEILLYIKRLK
FT                   KGSRWTFVRLDAKNLSFDDGSSIYNFETLASDENLEESFIGREEKLIARSIIKDNLIEE
FT                   SIEEQSTKRQMAIRLRYQGLTQIDVSQRLGISQSYVARIEKRYQDKLYQKLRKMF"
FT   gene            428892..429293
FT                   /locus_tag="Amet_0399"
FT   CDS_pept        428892..429293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46627"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKA9"
FT                   /protein_id="ABR46627.1"
FT                   /translation="MLLMKSEEWKKVEVKLESFYTSVKLDCDGYEVTLKLERMGQFKNV
FT                   IAVYVNGSIKGKWYLEDCEERRRFFKPTTRSMFSQKDKKEAYKKLSKKLLKEMEERFKY
FT                   TTYQPYWTSFKSLKSHLIKNNNVIELIAS"
FT   gene            429587..429898
FT                   /locus_tag="Amet_0400"
FT   CDS_pept        429587..429898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46628"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB0"
FT                   /protein_id="ABR46628.1"
FT                   /translation="MKRKSKEVMKLELLVKVKNLKVGEKITIQLQSWIGSVSDEKVTYM
FT                   GEIRHHGYYKRKQGGSWALSPCEIYNIPCYKIQVKPYKKRTIFELALNGDIKEIELGW"
FT   gene            429942..430280
FT                   /locus_tag="Amet_0401"
FT   CDS_pept        429942..430280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46629"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB1"
FT                   /protein_id="ABR46629.1"
FT                   /translation="MYELKCNKCNNEWKTHTISETTRFLCVCSKCGSTDVEPFIKMKCI
FT                   KGFSLEMSDDNGFTIENEYTAIEEGTIWNIQKDSFRVVGGEIRLTNDELGWLELSQETL
FT                   EENFETVS"
FT   gene            430311..430532
FT                   /locus_tag="Amet_0402"
FT   CDS_pept        430311..430532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46630"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB2"
FT                   /protein_id="ABR46630.1"
FT                   /translation="MSVIVVKNNIFNVNKIVNVQRLHITGSNPFYELAVSCIDKKIYRV
FT                   RYEMHEEELLEVDFEDFRYKLDQLTLFR"
FT   gene            430558..430683
FT                   /locus_tag="Amet_0403"
FT   CDS_pept        430558..430683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46631"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB3"
FT                   /protein_id="ABR46631.1"
FT                   /translation="MKSMTKIKDECLFCSKRICNTRIVRTEEPQYDEVACYQHIE"
FT   gene            430684..430920
FT                   /locus_tag="Amet_0404"
FT   CDS_pept        430684..430920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46632"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB4"
FT                   /protein_id="ABR46632.1"
FT                   /translation="MEGGESMFLKKIRPLKAIPINREDNQLDPDNLGLLMSLAHWRDYE
FT                   YKYGSFKKAKNIQKSIRNIMATKNAYRKSKSGH"
FT   gene            430939..431118
FT                   /locus_tag="Amet_0405"
FT   CDS_pept        430939..431118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46633"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB5"
FT                   /protein_id="ABR46633.1"
FT                   /translation="MKLKVLEEIVDLTKSIIRDISEPDKVCICAKRIQFLAEKEALAKE
FT                   DYKRYLGSVLDPRD"
FT   gene            431161..431637
FT                   /locus_tag="Amet_0406"
FT   CDS_pept        431161..431637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0406"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; KEGG: bsu:BG13521 similar
FT                   to cell wall-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46634"
FT                   /db_xref="GOA:A6TKB6"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB6"
FT                   /protein_id="ABR46634.1"
FT                   /translation="MVIMASTNTTVKEHQKQNEELWMQIDKLNLEKDLLNKNIINEKEL
FT                   IKELQEQIERLEVIRAKVTAYSPSDDRNGINADANPSITSTGKTPGKIYAAADPKRLPY
FT                   GTKIYIPNFGEVEIQDTGGALRNDKKNVRIDIFKETYEGAIAWGIQDLDIRLVY"
FT   gene            431667..432377
FT                   /locus_tag="Amet_0407"
FT   CDS_pept        431667..432377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0407"
FT                   /product="Exopolysaccharide biosynthesis protein"
FT                   /note="KEGG: ssa:SSA_0424 exopolysaccharide biosynthesis
FT                   protein, putative; related to
FT                   N-acetylglucosamine-1-phosphodiester
FT                   alpha-N-acetylglucosaminidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46635"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB7"
FT                   /protein_id="ABR46635.1"
FT                   /translation="MKYTMRRYDTTIHVLEVPKQGVVIMPCLGDRTKRQPVQQIRHSYF
FT                   EANGYKRIGAVNGGFFDGNRTLPYGMFYVDSGFLLSESWAGDAFLELVHENGKLHIDDI
FT                   TANQLKTKYKKANWAISLSYSLVVGGKMNIMKGDKFPFTNQSHPRTLIGDNQENYIFVV
FT                   TEGRMTKEKGLTAVESARVMLELGCNTAINADGGGSSAMDVEGKIQNKYYDNRAVADGI
FT                   LIYTKEPYEITGKK"
FT   gene            432497..433174
FT                   /locus_tag="Amet_0408"
FT   CDS_pept        432497..433174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0408"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   bld:BLi01974 N-acetylmuramoyl-L-alanine amidase cwlL
FT                   precursor (Cell wall hydrolase) (Autolysin); RBL04154"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46636"
FT                   /db_xref="GOA:A6TKB8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB8"
FT                   /protein_id="ABR46636.1"
FT                   /translation="MAKELAEHNGFKVVLVQPLNGKEVPLSHRVETANAEKVDLYLSTH
FT                   ADASGNAGVRGHWSFYWGTSANSKKFAEIWKKNAKELLENPSRGIIGSQLNHWTNFYVL
FT                   RATNMPANLSENGFMTNPLDKELLLSSAFRKNAARAQIKTACEFFGLPFKDLHQEKKEE
FT                   QTLEDRHEVITESLNVRNDVMGTIIGKFKAGYKVDKLFDFDGTWWVVRRGELIGFVNSN
FT                   FLK"
FT   gene            433228..433542
FT                   /locus_tag="Amet_0409"
FT   CDS_pept        433228..433542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46637"
FT                   /db_xref="GOA:A6TKB9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKB9"
FT                   /protein_id="ABR46637.1"
FT                   /translation="MENWLEKITIDDLDEPYYTIATKIGFEATLELAKMVQGSQIYFPT
FT                   IVKSCDPKRKELIKEEFNGYNYRELAAKYGFTERWVREICSELVKKERNKPHHSQLSLF
FT                   "
FT   gene            433653..434192
FT                   /locus_tag="Amet_0410"
FT   CDS_pept        433653..434192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46638"
FT                   /db_xref="GOA:A6TKC0"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC0"
FT                   /protein_id="ABR46638.1"
FT                   /translation="MSAIQTALREILVSVAIGLIGLAGAYVTYFLNKASKKMQLETEKI
FT                   QEESKREVLQMALWRLEDVAEKTVTKIEEKTAKVLRAAVKSGKKDKTELSDLAMQAYSE
FT                   ILTTLEPEYKQAIEASLGDAQTYIMNTIEEKVKKVKATKTNTIFPEVKLKANDIENITA
FT                   KIQKALSNTERLGTRT"
FT   gene            434194..434487
FT                   /locus_tag="Amet_0411"
FT   CDS_pept        434194..434487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46639"
FT                   /db_xref="GOA:A6TKC1"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC1"
FT                   /protein_id="ABR46639.1"
FT                   /translation="MELNLSWVIQTIIMLGLGTIAYFLKEFKKSIDKNISETNWKTNKN
FT                   QEDIKELKEEFNEHKVRIAKEYVHKDDFIRAMSNVDKKLDKIHDVLVVKRSV"
FT   gene            434489..434782
FT                   /locus_tag="Amet_0412"
FT   CDS_pept        434489..434782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46640"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC2"
FT                   /protein_id="ABR46640.1"
FT                   /translation="MEAQVMKNKMLRGQVLRTLALFYPDSVSVNGIRSALISRGVTFSA
FT                   DMTKILHYLEDKEYITVTAIKLSEIKDDDQVELTAKGVDLIEETIDDPGVEL"
FT   gene            434782..435348
FT                   /locus_tag="Amet_0413"
FT   CDS_pept        434782..435348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_2702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46641"
FT                   /db_xref="InterPro:IPR021874"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC3"
FT                   /protein_id="ABR46641.1"
FT                   /translation="MTKERQRNRIKSRVDELPEEIRQLLDDRLADVNFTYHEIADEITE
FT                   LGYEISKSSVGRYALRQNAVVQRMKEVAEQTRIIVDAAKKNNNFDAIGATTSMLTIGLA
FT                   QKIATAQEEIENMPIEKAARIVVALERSAVYKEKFKLQYSKGIKDAITAIKMELRIELE
FT                   NDPELLMKLSEKVDSISKKMEAKNN"
FT   gene            435362..435850
FT                   /locus_tag="Amet_0414"
FT   CDS_pept        435362..435850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0414"
FT                   /product="NusG antitermination factor"
FT                   /note="PFAM: transcription antitermination protein NusG;
FT                   SMART: NGN domain protein; KEGG: tte:TTE0730 Transcription
FT                   antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46642"
FT                   /db_xref="GOA:A6TKC4"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC4"
FT                   /protein_id="ABR46642.1"
FT                   /translation="MHVKSNEEMKAKKLVEKEIEDIKVIVPQRIIPEKRQGETRHVKKI
FT                   LFTGYLFLNVELDVDTYYKLKRIPSIHRFLGLEKPEAIPLEEMQRVLRLCNQGELIGLS
FT                   KVIVKEGNKVQVVSGPLLGMEGHIIKVDKRKGRAKVCLSVLGDAKTVDLGIEIIKVSE"
FT   gene            436107..437564
FT                   /locus_tag="Amet_0415"
FT   CDS_pept        436107..437564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0415"
FT                   /product="phage uncharacterized protein"
FT                   /note="TIGRFAM: phage uncharacterized protein; KEGG:
FT                   bha:BH3533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46643"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC5"
FT                   /protein_id="ABR46643.1"
FT                   /translation="MNIIHELVQGKQNSERSKIIAVGRRDFREYCNRMNPEFFRESRTF
FT                   QDKVCKTIQAIYEKKLINPKTNKPYSILVINLPPGHGKSYTAGMFSTWAFGDSVSNQII
FT                   SVSYNQTLSIRFAKMVREHIQDQEIEGDDNYYVVNSFFPSVKIKDGDGAMNLWSLEGAY
FT                   MSYLATSFDGSITGMRGNIGIIDDPIKNKSEAVNERVKEAHWDWYKNTFLSRMVEGAIQ
FT                   IIIQTRWATDDLAGRVIANFPEKTYVLEMPVLNEKDEPLCDEILSYDAIMDKKGGIDED
FT                   IFEANYLQRPIDKKGSLYKEFKTYDVVDDEAFEDIIAYIDTADEGRDYLCMPIGGVIGR
FT                   LGYVKDIYYTDEAMEVTEEEVARRLHIYGVKNAIFESNNGGRGFARKVEDILRKKYKNK
FT                   KCNIKWFFQSKNKKTRILVNSSNVIEQVIMPEDWAKKYNEYYLAMAKYQRKGKNEHDDG
FT                   PDAITGFVEVINGEVKVKANSIADGYR"
FT   gene            437582..438931
FT                   /locus_tag="Amet_0416"
FT   CDS_pept        437582..438931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0416"
FT                   /product="phage-associated protein, HI1409 family"
FT                   /note="TIGRFAM: phage-associated protein, HI1409 family;
FT                   KEGG: efa:EF1456 conserved hypothetical protein TIGR01555"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46644"
FT                   /db_xref="InterPro:IPR006445"
FT                   /db_xref="InterPro:IPR024459"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC6"
FT                   /protein_id="ABR46644.1"
FT                   /translation="MGKRQETKQKKSNSVSSGYKKDFFESSTSSKGTAKDPLSRQKGIT
FT                   RHRMSQWMISDIYAVNGIFQNIVNIPAEDATREWISIAGVEDALAQQIMNKLSNLGAQY
FT                   NFQEALKFERLRGDGLISIGAKQTGLFKISDPIEISKLTDIDYIHAFSGVKLIDYIENE
FT                   DVFSPEYGSTELFEIQGAGDTKLVHNDRIIHFATRKIEDEKRGIPLIEILYDLLLIFDN
FT                   ATWSTGQLMYSMVHKRLKTDGVDMSDKELRQNIQNELDFEFNTLSLAVIGKEDDLDYIS
FT                   PSVSLPLKDMYDFLWEMLSAVSRMPKSHIMGQPQGTVTGGQFDSLNYYMRIAGMQEAHV
FT                   REPLEYLIDLSLLASKSGVGTKSIEPDNVKYKMKFNPLWKLDAETDAKIRKMNAEIDNI
FT                   YLTHNVRSPDETRKERFNETSMIEKLDMSEEELLKIAREVKKAKEAMDHG"
FT   gene            438924..439706
FT                   /locus_tag="Amet_0417"
FT   CDS_pept        438924..439706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0417"
FT                   /product="phage putative head morphogenesis protein, SPP1
FT                   gp7 family"
FT                   /note="TIGRFAM: phage putative head morphogenesis protein,
FT                   SPP1 gp7 family; PFAM: phage putative head morphogenesis
FT                   protein, SPP1 gp7; KEGG: efa:EF1457 minor head protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46645"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC7"
FT                   /protein_id="ABR46645.1"
FT                   /translation="MAKTPKSRFPSGAAWDYFKEVRGLLISSHANVIETFEKKISHNIR
FT                   NDGLNERNDNAILKINLLLDTLRTETLEYYFDENKIVKIADAFTKSVGNNIVQQFANQF
FT                   RSVLGVDPIGRDSKLLDIITAANKENIAYIKSIPENYHNNVETVILQGVRRGRSNKQIA
FT                   DGLQEAYKTSRTKAKFIARDQTGSLVADINKAKYEQSGLKGFIWSDVGDGNVRDKHKIF
FT                   NGKRFLWSEGAGTEGLLPGEDYGCRCTAEVDPDELLNI"
FT   gene            439720..440823
FT                   /locus_tag="Amet_0418"
FT   CDS_pept        439720..440823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lin:lin1728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46646"
FT                   /db_xref="InterPro:IPR016913"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC8"
FT                   /protein_id="ABR46646.1"
FT                   /translation="MLKQRYDRVEVNMMQEDGRGFLNYSLAAVKPGVYPYMDYESGQVI
FT                   YELKHPDDLIKVVEQLNNLPITDGHPYELISAHNSKELVAGWTHEKAEMQDVTMVNKAT
FT                   VFDAKLIADIVTGLKKECSLGFECRVIDESGVYEGQKYDRRQTDFKFNHLAMVKKGRCG
FT                   PECSARTDEKESFAVQIRTDEIENYKEKEGMKEMKIRLDGVEYEVPEVVATRVTALETK
FT                   SDELTKQVGQLEGKLDGKEDEIKKLQEKKDELEKNQLSEIKLDQAIEARLKVVQDAAII
FT                   LDPDYDFKGKKPREIKVDCIKVLGDESFTGEGKSEEYIDARFDTIVDFYKNTEHSSTGA
FT                   NNLKIKNDAGAGDLVTSMKSKRLQMKK"
FT   gene            440839..441339
FT                   /locus_tag="Amet_0419"
FT   CDS_pept        440839..441339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46647"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKC9"
FT                   /protein_id="ABR46647.1"
FT                   /translation="MTVQKYQPAATGAGRIAEASMSATARSMAAEGSPIKYGKAVKLGT
FT                   DKEIQVKAWDGAASTDIFAGIALNSVTGDLDNDQYLQGNPVSVLKKGTVWVKVSADSAG
FT                   VTAGQKAAVLEDGDFTAAPLSVDTNGVYGVELEGSEYLTSAAAGELVMLAINLPSTTKV
FT                   VQL"
FT   gene            441362..442276
FT                   /locus_tag="Amet_0420"
FT   CDS_pept        441362..442276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lin:lin1726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46648"
FT                   /db_xref="InterPro:IPR020049"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD0"
FT                   /protein_id="ABR46648.1"
FT                   /translation="MRGMHVRQDGMLLNQDLESIDKVAYEAKEEELTARTVVGLKTDDH
FT                   EGAETISYDKMTRRGAAKIFAYGASDDIPLVDADVERHTQKVYGVVVGFTIGIQEKRAA
FT                   QMANRTIDITKAIAARRAVAEKENRFFYVGSEAHQAEGLLNFTGIQTMPVALNAGETST
FT                   KWKDKTSEEIIEDIRLARKKVNALPGLTVDTLLLPPNQYEDLDKPVNAENYNMTIRKWL
FT                   QEQKWFTNIIRVADLEGAGDSSTDCLAVFDSSKDVVEMALPLDITRHPEVMLANMSSQI
FT                   NLEERTGGAIVRFPMGICRADGI"
FT   gene            442292..442624
FT                   /locus_tag="Amet_0421"
FT   CDS_pept        442292..442624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46649"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD1"
FT                   /protein_id="ABR46649.1"
FT                   /translation="MEITVINNSKFIKHVGEVTLNIGANEVEKKDWDKESKHPIVKDWL
FT                   KDKVVEVKEGLIEDISEITPAGKAIEIVQTTFSQEKLQKWSEQEERKTVLEAIQKQLKE
FT                   AIKSGE"
FT   gene            442627..442959
FT                   /locus_tag="Amet_0422"
FT   CDS_pept        442627..442959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lin:lin1724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46650"
FT                   /db_xref="InterPro:IPR025127"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD2"
FT                   /protein_id="ABR46650.1"
FT                   /translation="METTVERVRAIASHLGGLPDSTIEIYIEDAKLEMNSMEFKASFKE
FT                   KIMRYLTAHYATLDNPKIKSEKVDGLGAIAFSDSTSGKEGLKSTEYGQEVLRLLKKSNL
FT                   SMLVTS"
FT   gene            442972..443574
FT                   /locus_tag="Amet_0423"
FT   CDS_pept        442972..443574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lin:lin1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46651"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD3"
FT                   /protein_id="ABR46651.1"
FT                   /translation="MIVKDESRVPELLRELDYLDSHALKAGIMGEEDSELIMIAATHEF
FT                   GATIKPKNSKYLAIPLPAAGDTRPADHDDLFVPRGTKILAKPKGQGEKDFIPMFVLLKS
FT                   VMIPERSYIRSTFDENKNKINEMGQDLLINVLEGKLTGEQLYNRLGLYLQTLIQRKIKE
FT                   TKSPANSALTVANKGTDNPLIQTGRLRNAVTYEVVSL"
FT   gene            443571..443933
FT                   /locus_tag="Amet_0424"
FT   CDS_pept        443571..443933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46652"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD4"
FT                   /protein_id="ABR46652.1"
FT                   /translation="MMDFTRIIQRWEKQISVQQKTGQYIRGKWTEGISEVRHFRGTFLP
FT                   MSDREIRYSEGGSYTTQDKKLYVKEKLKDMQGNELLLKKGDIIIDYDGEYEIDRELEAP
FT                   EVVNYKKYMTKKKVVK"
FT   gene            443930..444436
FT                   /locus_tag="Amet_0425"
FT   CDS_pept        443930..444436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46653"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD5"
FT                   /protein_id="ABR46653.1"
FT                   /translation="MNEETLGDILEELKAFTNVTKAIFADQKGEKPQYPYITFKIIAEP
FT                   DDPSVGIYNYETVESENPNFDSDIEVQKIETSEPSFSINVFAKTAEEAKSVAMKTKDFF
FT                   KFHGCEWLKRKNIVTVSTSTIENRDALMIIDYERRYGFDVILRYTRELKKKIETIETYS
FT                   FSRIE"
FT   gene            444448..445452
FT                   /locus_tag="Amet_0426"
FT   CDS_pept        444448..445452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46654"
FT                   /db_xref="InterPro:IPR021808"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD6"
FT                   /protein_id="ABR46654.1"
FT                   /translation="MKKDFVVNISKLTAAIKQRGFGLILVLDTSKDHPYTLYNDIQGVA
FT                   DDYAVTDDAYKIASRIFGQNPAPQQVAIFGKEYDSEIGEPADLVTALNELVNVNNDWFA
FT                   LTCTENANAEVIALSGWIDTQEKMYFTTTQDLSLPAQIESEQTTVMFHHSPEAYVAEGL
FT                   AAYMLVRMIGGVTAKFRSISGVLASEITATELAQLHDDNGFSYIRKMGVLQTTEGKTTS
FT                   GEYIDVVLGAFFLQFKMEEESALLAVNTEKIAYDNVGIASLVSVAEKVLKLGVTQGIIL
FT                   RDDDDNGVFQINYVKREDTPTNDIANRVYNGVSWSADLAGAIHEGTISGVLKY"
FT   gene            445464..445868
FT                   /locus_tag="Amet_0427"
FT   CDS_pept        445464..445868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hit:NTHI1539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46655"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD7"
FT                   /protein_id="ABR46655.1"
FT                   /translation="MVTTYDMNGVNVIVGGRFITGFADGTAITSEANEDKFSVQVGVKG
FT                   EVTFSETNDPTGAIGIILKQTSPSVPYLDGLANRKGENAIVSAQIVDLTANGVNAGGNR
FT                   CRVTRTSKKEFSNSESKREYRIYVADYSAR"
FT   gene            445924..446178
FT                   /locus_tag="Amet_0428"
FT   CDS_pept        445924..446178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46656"
FT                   /db_xref="GOA:A6TKD8"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD8"
FT                   /protein_id="ABR46656.1"
FT                   /translation="MFRIVSAFISFPWIGYLLGETTGAFIGLILAVLYIPIEKFQGKPK
FT                   EKKEVSAEKVKLTGFPKFARILLIVSFTFTTLVMLLIYL"
FT   gene            446239..446562
FT                   /locus_tag="Amet_0429"
FT   CDS_pept        446239..446562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46657"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKD9"
FT                   /protein_id="ABR46657.1"
FT                   /translation="MKNKITVEGVEYIFQKVTPREWLKIRERSKNKYGNSSQELLYTEV
FT                   FEHVIISPKVGIDDFEEIETLEEVITAAINFQCKRQRKEEQKLSRHGQKELANMETGDG
FT                   GQD"
FT   gene            446671..448428
FT                   /locus_tag="Amet_0430"
FT   CDS_pept        446671..448428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0430"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="TIGRFAM: phage tail tape measure protein, TP901
FT                   family; KEGG: bld:BLi01480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46658"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE0"
FT                   /protein_id="ABR46658.1"
FT                   /translation="MSLRSLIFDVAFNGNASAVVQMDDATNELRETAMGATENIEGMDS
FT                   ATDELGRTTMGAGKVIEENWKKITLAAGATGLAIEKMARQQAELTTATRGLAVTTDMTE
FT                   KEIRTMVGSLTDHTFATEDALAGMDRLQQSGYNTQSQFESLLPVFDTFADATGKDMVSG
FT                   IDFFDRTLSALDIPLTEAEEHLDTMTWLITQTTVGMGEMGQLMRREAPTLRAMGLNVDE
FT                   IAIAMAGLEAEGIRGPRAVSGFQNALKDAEGDIERFWKELGVSQEVLENQSERLLEAEG
FT                   LTQALADANNSGDTAMQKLTSAAEQLAYQYGPLIELSSSLVPLLLAAGPAAKIASAAFA
FT                   VLATPVGAVGGAVAVLGVGVWQLWRNWDAVTERSGDAMDWLLDKSDNVVNGTIDKFAEL
FT                   GSRASAYVNDMASDIIDSIMSYPPLQAVNEVWDETLAYLNGIDLREVGSDIVQGLINGI
FT                   TSMGSDAAQAARDVASGIGNSVKSFFGINSDSKLMIEYGGNIVGGLETGIDSSIPNTTK
FT                   SMERMTDRALSGAVTNNSKMTFSPNVKIEVGNGTNARQAANELEREFNSLMDRYAKKLS
FT                   LRNPALTEA"
FT   gene            448441..449031
FT                   /locus_tag="Amet_0431"
FT   CDS_pept        448441..449031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin1715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46659"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE1"
FT                   /protein_id="ABR46659.1"
FT                   /translation="MARVKLGEVEFSTVGNESPEFSNEITDRPVEDIGTVSDHINNKPT
FT                   ILAIDGYVTGIHAGQKISVLRRYFKTKELLKYVGRNIFDNMSIEIFRTDHNNRVANGFS
FT                   FTMLLKEIKVAKSQTIQIPLADPVSPKPPAVAVAAVKTQTKEVTNKGTQSVRGQSADTQ
FT                   RYQALYDKYEAEKRSVEAAAKIQASFDRGFRSL"
FT   gene            449028..449357
FT                   /locus_tag="Amet_0432"
FT   CDS_pept        449028..449357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: efa:EF1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46660"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE2"
FT                   /protein_id="ABR46660.1"
FT                   /translation="MIDYISIEKNLIPYQFDIQLGGITFTSEINYNGEYDYFTIDLYKG
FT                   EEVVLLGEKIVYGKPLFTTFLHLPIPPVLIVPLDLADEETRVTYENLNVKVFLYIIGDE
FT                   PDAIQ"
FT   gene            449344..450120
FT                   /locus_tag="Amet_0433"
FT   CDS_pept        449344..450120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lin:lin1713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46661"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE3"
FT                   /protein_id="ABR46661.1"
FT                   /translation="MLFNRKVELIIGNKSYLSDNIDIDFSVPFDSDPEPNICDVSIYNL
FT                   SMDSINRIGKSTEVILNAGYGEDIGAILVGTVADYEQRNIGTDLEFKMMIAPGIDRWMS
FT                   KTFSKSYKEGMKASTILRDALSSFGLEIGELRLANDITYSKGKVVSGMLKNTIKNIATE
FT                   AGSKLYIKNNIAFVRPPNAGTATGFLLSSKTGMVGSPEPIIIDDKKGYKVNMLLNNKMN
FT                   TDSLVQIESRIVTGNFRVVKGQHLGDFITEVEVLPI"
FT   gene            450117..450413
FT                   /locus_tag="Amet_0434"
FT   CDS_pept        450117..450413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46662"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE4"
FT                   /protein_id="ABR46662.1"
FT                   /translation="MIDKVIQDILEERLADLHTFMLCRVVSITPQLTIRPIPKRKYKNG
FT                   RTEAYPIIINPLKLKNIPLEKDDVVAVAFSERALDGVGSRKHDLTDAVILGVI"
FT   gene            450413..450775
FT                   /locus_tag="Amet_0435"
FT   CDS_pept        450413..450775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46663"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE5"
FT                   /protein_id="ABR46663.1"
FT                   /translation="MKTFKIVDDDIVFDGQNNIVMVEGKDEEIQSINRVFTTRLNEFFL
FT                   EPEHGFDYSVLQTKQVDEEQIRLAVIEAANQDPRVQEVEELNIIVERKSRKVTIDFKVK
FT                   MQSGELLEGQEVLDIA"
FT   gene            450768..451955
FT                   /locus_tag="Amet_0436"
FT   CDS_pept        450768..451955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: efa:EF1479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46664"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE6"
FT                   /protein_id="ABR46664.1"
FT                   /translation="MPSFGLGAKGFKRKKYNDIIESMNTRARNLFGEDVNVSPRSPLGL
FT                   FFRVISWSVAILWQLAEKVYFSGYVDTAEGNQLDYVGKYIGIERRLAQLSEGELTITGD
FT                   ASTIVPQGFVVETNDGIQFQTIEEATIDGAGEVTVPIQAIVAGIESNVPANTITEITNP
FT                   TEGIDEVTNTAPTTNGRNPELDQEFKERYAISVSRGGASTLDSIRASLLELDGVRASLV
FT                   VENNTMITDADDRPPKSIECYVLGGNSEDVGKSILDTKAAGIESFGEETVTVNDDSGNP
FT                   HDIKFTYADVVDIYSNISITKNDKYPTNGDDLVRTELIKFIGGLDEDSNVYTGLGMGQD
FT                   VVYTRLIKVIYRIDGIDDVDLEIGVDGINYSVNNIVIAQAEVAEIDYTKVVVTSA"
FT   gene            451948..452577
FT                   /locus_tag="Amet_0437"
FT   CDS_pept        451948..452577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lin:lin1709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46665"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE7"
FT                   /protein_id="ABR46665.1"
FT                   /translation="MLNLLQRLTDNYRKDSSINIGKLLNVVVGELEEVKDSLETTEKYR
FT                   DIDQAIGATLDKIGVNVQQFRGVAPDEVYRILLKSKIARNLSKGDINTIIRVLAITLNT
FT                   EQKNIYIQELYRTLDNEPAAIFVSVPAALLNSVGFSVNQFGRLVNRIVAAGVRANVLFT
FT                   GTFAFSSLENESEFDIDVGFADTDQTSGGMLGEYYDPVDDTNLPLD"
FT   gene            452588..453157
FT                   /locus_tag="Amet_0438"
FT   CDS_pept        452588..453157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin1708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46666"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE8"
FT                   /protein_id="ABR46666.1"
FT                   /translation="MFNEQLPEWLNEGTEPPAQKKSDGWLPTEKPPAGWFNWLFNKIYK
FT                   CIKEIRQKVMNLDEDLGSHVAESVSEVIDFQRDASILGTQHIATPRKPKGITLYANITG
FT                   QATISIGFFGQIGAQKSFYSGSGSGIWRPYTGSAILISQGDTTNRLSGNIRNVENDGFD
FT                   ILWSQVSGANTGTITITAMVVYHGEG"
FT   gene            453159..453407
FT                   /locus_tag="Amet_0439"
FT   CDS_pept        453159..453407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46667"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKE9"
FT                   /protein_id="ABR46667.1"
FT                   /translation="MKYCVIKNTTKVIDGSSNSSEIMLQNALNAGLTEEEIEILTEEEY
FT                   QARKDLEPIAPKEPTLEEKNRADIDYIAIMTGVDIDV"
FT   gene            453400..453534
FT                   /locus_tag="Amet_0440"
FT   CDS_pept        453400..453534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46668"
FT                   /db_xref="InterPro:IPR010022"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF0"
FT                   /protein_id="ABR46668.1"
FT                   /translation="MFNRVKEYYETGLWSIDRVFNVVGKAISEEEYQEITGFLYPAKS"
FT   gene            453984..454983
FT                   /locus_tag="Amet_0441"
FT                   /note="ribosomal slippage"
FT   CDS_pept        join(453984..454529,454531..454983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Amet_0441"
FT                   /product="phage integrase domain protein SAM domain
FT                   protein"
FT                   /note="PFAM: phage integrase domain protein SAM domain
FT                   protein; KEGG: dsy:DSY2171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46669"
FT                   /db_xref="GOA:A6TKF1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF1"
FT                   /protein_id="ABR46669.1"
FT                   /translation="MRKEEAVVRIVGRLDLEFNGMLDQQKARQIIQEVLYDYDVNPAQR
FT                   SLVVQDDMNDKILLYLASKKIDGLAMRTLEGYSRNLNRFAYYMRKNVEDVTTMDIRMYL
FT                   ASYAKTGVKNGTIGTETDILRGFFRWLEDEEYINKSPLRKIKSLKPEKRIRKALTNEEM
FT                   EILRDGCKTYRQKALLEFFYSTGCRLEEVENVKKYDIDWQRLQLKVIGKGNKERTVYIN
FT                   AKAKVHIQKYLMARLDEEEALFVTERNPVKKLGRRSIEREFDKIEKTSGIKKSIYPHLI
FT                   RHTMATHLLNSGADLGTVQAILGHEDASITQIYAQISNTNVEHEYRKHMIQ"
FT   gene            455152..455811
FT                   /locus_tag="Amet_0442"
FT   CDS_pept        455152..455811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0442"
FT                   /product="Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like; KEGG: ctc:CTC02083 electron
FT                   transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46670"
FT                   /db_xref="GOA:A6TKF2"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF2"
FT                   /protein_id="ABR46670.1"
FT                   /translation="MSEKIEAEIIVLSMGPPSAENALREAIARGAHKGILLSDRKFGGS
FT                   DVKATALTLSAGINHIGDYDLIIAGMQTVDGDTGQVGAEVAEILGIPQISYVEELNDFD
FT                   DESVTVTTNIWEGLYLKKIKFPALMTVTKEINDPRLPSFKNKMKARKAEITLWGQNELR
FT                   DYLREDQIGLKGSATKVKKIEVPAAAVREGKLWRDNHTEAVDVLYDLFEVKKVLEG"
FT   gene            455820..456809
FT                   /locus_tag="Amet_0443"
FT   CDS_pept        455820..456809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0443"
FT                   /product="Electron transfer flavoprotein, alpha
FT                   subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like; Electron transfer flavoprotein,
FT                   alpha subunit-like; KEGG: tte:TTE0547 Electron transfer
FT                   flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46671"
FT                   /db_xref="GOA:A6TKF3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF3"
FT                   /protein_id="ABR46671.1"
FT                   /translation="MEYKGVLVYAEQRNQQIHKVTYELLDKGRQLADQLGVQVYCALLG
FT                   PADIDAQELIYRGADVVYYIEDNEAFNEPDELVYARNLQDLIVKIKPEICISGATSLGR
FT                   SVAPRVAAAIGAGLTADCTDLQIDEDRKLIQIRPAFSENILAHIKSECMPQMATVRYKE
FT                   FSEAKRDISRTGEIIKSSSLDYQNDAMVFIQELSQKKLDISEASVVVSAGTGLRSPEDF
FT                   KLLSELADLLNGVVAASRPLVEGGFISKDHQVGYSGNRVKPKIYIACGISGAPQHLAGM
FT                   KDSETIIAINTDPSAPIFSIADHGIVGDLYEVVPLLINKIKSMRAVKV"
FT   gene            456935..458086
FT                   /locus_tag="Amet_0444"
FT   CDS_pept        456935..458086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0444"
FT                   /product="Uncharacterized membrane protein"
FT                   /note="KEGG: pho:PH0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46672"
FT                   /db_xref="GOA:A6TKF4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF4"
FT                   /protein_id="ABR46672.1"
FT                   /translation="MNKKSGMPVFFALAFVWFTTHFGGGFASGAQVIQYFVKFGWFAIF
FT                   TPIISQLIIAIVLYFAWKFALEKKMFDYRDWANEFYKPIQGIMSNVFEIMYNLVLVTAT
FT                   AVAFATGGATIEGVFGTPYLLNTVVIAMALLLLTIFGAELVRKAASIIAVIIISGVVLI
FT                   YVPNVISSFGQITKNVADLRSGAIQNDTSFFSAMWSSLVYAGFQTTCIGAYIVHSNILK
FT                   DKSDAKKAALWGFIINSTVLMLSTLGILAFYNDGVLTESIPALFVVRNGVGSSWMVPLI
FT                   SILIILGAVSTGVNLIYGISRRIVNYLGRSESPAVFKEKERTRNIGASALYVAITWSIA
FT                   QFGLIPLIAKGYGTLGYISIFVIILPVIIKGIIGLKPKTKAKA"
FT   sig_peptide     456935..457024
FT                   /locus_tag="Amet_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.567 at
FT                   residue 30"
FT   gene            458180..459562
FT                   /locus_tag="Amet_0445"
FT   CDS_pept        458180..459562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0445"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   afu:AF0394 D-lactate dehydrogenase, cytochrome-type (dld)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46673"
FT                   /db_xref="GOA:A6TKF5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF5"
FT                   /protein_id="ABR46673.1"
FT                   /translation="MKVEIIEKMKNIVGVDWVVTELSRMQSYLSDETEHLLKPKANEDC
FT                   IVVKPSSAQEISGIMKYANQEKIPVVPRGGGTGLCGAAIPTHSSIVMSLERLNQYVELD
FT                   DKNLMVTVDSGFTLAQLNEELNKQKNLFFPIHPGDEGAQIGGMVAENAGGVSAVKHGIM
FT                   RNHVKGLEVVLPTGEIVNFGGKLIKDNMGYDMLHMMIGSEGTLGIITKVILKLYAKENH
FT                   RGTLLISFDTGEDAAAVVPKILQRGITPLAMEYMERYVVEKAAEHLGLTWPAKKGSVDL
FT                   MFILEETTEDELYAKSEIIVEMCEKHHAVDSMIAETAKEQRNILEIRSNAYTAFKEEIA
FT                   DALDMAVAPASVPDLVRDINTIAKKYNTISPVVGHIGDGNTHNFIMLVNGEKPSYLDEM
FT                   RQEMYEAAIKYGGTVTAEHGTGKTRKKHMNLQFSDREIEIMKGIKKAFDPNGILNPGTI
FT                   ID"
FT   gene            460101..460343
FT                   /locus_tag="Amet_0446"
FT   CDS_pept        460101..460343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46674"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF6"
FT                   /protein_id="ABR46674.1"
FT                   /translation="MSQMKEFQPVLQMIVCRLAQMIAREMDLSDKAALDSLYLSKLYEE
FT                   LEREETKVWNLSVPTLLRMFIEEQETGIIKFPQEG"
FT   gene            460346..460570
FT                   /locus_tag="Amet_0447"
FT   CDS_pept        460346..460570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46675"
FT                   /db_xref="InterPro:IPR024269"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF7"
FT                   /protein_id="ABR46675.1"
FT                   /translation="MDETLDFMVYCIESYKNAENLRGREAVELFNKYHVFDYIKASHGT
FT                   QDMACREYIIEDLNMYIDARRQVDTRRNL"
FT   gene            460571..460687
FT                   /locus_tag="Amet_0448"
FT   CDS_pept        460571..460687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46676"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF8"
FT                   /protein_id="ABR46676.1"
FT                   /translation="MEDKVFNLLEKMYSDLSSKIDNMDEQIQEMKSIMTPFG"
FT   gene            460892..462766
FT                   /locus_tag="Amet_0449"
FT   CDS_pept        460892..462766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0449"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   tte:TTE2604 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46677"
FT                   /db_xref="GOA:A6TKF9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKF9"
FT                   /protein_id="ABR46677.1"
FT                   /translation="MEGLCMYISKSKRPNGKYFISIAKGIRDPETKKSKKIQIKGFGTH
FT                   DLDSKSGKKALVQAEAELKEMIRLDEASRGFENFEDFIVSMSKDKLSLKHKNIGYLPYL
FT                   EIFNQLKLQSFFSKMVKDSKLDYSFSDMMFYQVLGRLFNPSSKLEVATRKDDFLYDFNF
FT                   VNNDNIYSSLDVFSGFNKHKSKALQDGIQVINDMEILLDTVDSEAKKILETNINNTSHE
FT                   LEELITSYDSNFEMNENKLFKHLNKHMEKIVPERNISLAFYDCTTYYFESFDEDGFRER
FT                   GMSKDNKRNETQVVMGLLIDTNGIPISYRLFKGNKHELHTMEEVIDDILNNYTIKEIII
FT                   VADRGLNSRANLEMIRGKGLNYIVGSKGSAVPKDLKEKKFNSSWNITSKAEAKYKSGYI
FT                   TSKRKVSHNDETYDELIIKKYSDVYKEREMFKQDKMLERAKKNIKDFTINSTTKSKSKY
FT                   YKAVDNPKEKINIEIDEEKIKQEQENFGYFYIVTNKVEMNPADIMVAYKSLYKIEESFR
FT                   ILKTNLKARPVYHFKERRIRSHFLICYLALVIQRVLEYKLEEKNVEISTHEIINGLEGF
FT                   VIDEIDYKVDKLYMISDKLFKSKINQDIFKIEKNVLLSNEISNIIKKM"
FT   gene            462812..462949
FT                   /locus_tag="Amet_0450"
FT   CDS_pept        462812..462949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46678"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG0"
FT                   /protein_id="ABR46678.1"
FT                   /translation="MASALFIMNDVPKSGNTGNEINHDTFWLSKTRGVFHCLTMISVFS
FT                   "
FT   gene            463002..463400
FT                   /locus_tag="Amet_0451"
FT   CDS_pept        463002..463400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0451"
FT                   /product="Zn-finger containing protein"
FT                   /note="KEGG: cth:Cthe_2665 Zn-finger containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46679"
FT                   /db_xref="GOA:A6TKG1"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG1"
FT                   /protein_id="ABR46679.1"
FT                   /translation="MMMNWLKKFMIGRSGGDQLSIYLLALSLVLTVIGQLAGTSIVVTI
FT                   GYIPLFVAISRVLSKDVQKRRMENYKFAIFISPIYAKLKKVESRIKGAKTHKHFKCANC
FT                   KTMLRVPKGKGEILVTCPKCKTKCTRKT"
FT   gene            463450..464220
FT                   /locus_tag="Amet_0452"
FT   CDS_pept        463450..464220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0452"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   gka:GK2503 chaperone protein (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46680"
FT                   /db_xref="GOA:A6TKG2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG2"
FT                   /protein_id="ABR46680.1"
FT                   /translation="MRVMKKIVGKVIYAIAKALSAILDSLIQLIETMVLLARSFSKGCL
FT                   ALMSMGGCLFFLFFVFPIGSRILRNPTALLAILFILVFPILGALLVSYLKYLKYITTAY
FT                   LFNLGNYLMDGVNYQYKAFSEYKVAYRKAEEDRKRKEQNRHYEQQREWEERLRQWRQQN
FT                   AQREQGSYGGQGNYGHSYANPIVEFKKKYEKCCDVLGVSYDADKYQIKLAYRRKAKQYH
FT                   PDVNKAADATKMFQGISEAYEFLNDDNIQRYKSV"
FT   gene            464758..465237
FT                   /locus_tag="Amet_0453"
FT   CDS_pept        464758..465237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0453"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: dsy:DSY3286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46681"
FT                   /db_xref="GOA:A6TKG3"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG3"
FT                   /protein_id="ABR46681.1"
FT                   /translation="MFKNKKIIVISWIAVLLWMGLIFYLSAQPATQSREVSEGVTEIFM
FT                   QTVERVAPDVAAELDIRMLNYLIRKNAHFFAYLTLGVLVLNGMRRSGVSGIRGIVIAFF
FT                   ICVLYAISDEVHQLYVPGRSGELRDVLIDSAGAMVGIGLYLGLGKIKKKVMISRV"
FT   sig_peptide     464758..464841
FT                   /locus_tag="Amet_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            complement(465310..466017)
FT                   /locus_tag="Amet_0454"
FT   CDS_pept        complement(465310..466017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0454"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pca:Pcar_2563 GMP synthase - glutamine amidotransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46682"
FT                   /db_xref="GOA:A6TKG4"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG4"
FT                   /protein_id="ABR46682.1"
FT                   /translation="MKKLLIIKTGTTFPSILKAHGDFEDFIMNQIEISPKDVHVSSVYK
FT                   NESLPDLNQVSAIMITGSHSMVTDYENWSVHLSQWLTQLLYQPIPVLGICYGHQLLAQT
FT                   FGGKADYNPKGIEIGTASIALTEAGEKDSLLGVLPKTFLGHVVHSQSATMLPNHGQVLA
FT                   QNEMDHHHSFFINKNIWGVQFHPEFNVDIMHSYIHQQEGFLTKKGYNLEKVYASVKEHG
FT                   YGKLLLQRFMELT"
FT   gene            466370..467371
FT                   /locus_tag="Amet_0455"
FT   CDS_pept        466370..467371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0455"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: oih:OB3476
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46683"
FT                   /db_xref="GOA:A6TKG5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG5"
FT                   /protein_id="ABR46683.1"
FT                   /translation="MTTIQKVAKEAGVSVATVSRVLNKSDRVAPKTKSIVEETIKRLKY
FT                   QPNMLGRNLRRSESRMILALLPSISNPFYTMIIKGIEDVARENEYNVLLCQTNSELERE
FT                   LVYINLLKQRLADGLISLDPTININVLRGVSQDYPIVQSCEYSEELNLPYVTIDNFQAG
FT                   YQAVKHLISIGKKKIALINSDNKFIYARLRQKGYLKALEEAGLGINEDFIINGENDFES
FT                   GQKSMQQLLARKDRPDAVFLVSDVLAIGALKTIRDMKLSVPEDIAVVGFDNIEFAIRMN
FT                   PALTTIAQPMYEIGRESCRLLINRIVNKDVEIEKIIMDFELIIRESTMKQVE"
FT   gene            467431..468453
FT                   /locus_tag="Amet_0456"
FT   CDS_pept        467431..468453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0456"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: bms:BR0544 ribose ABC transporter, periplasmic
FT                   D-ribose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46684"
FT                   /db_xref="GOA:A6TKG6"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG6"
FT                   /protein_id="ABR46684.1"
FT                   /translation="MKKIRIMLLMLILVVLIVGCGQQDTGTGVEDGKVLGVVMPNATHG
FT                   FLGESIQHAEAATKLYAEEYGFEYQFLTSAESSEQNNQLDTLINQNVDAIVLWPHNGDE
FT                   VRSGAQNVMDAGIPLIVYDRLIDGFEPTMEVMGDNFTIGEETGEYLNQYFANELAAGEV
FT                   HILEFKGDNSTVPQQRSDGLKRTAHENIVIVQEFSTGWQRATAQEQMETFLTASSVEEI
FT                   EAIKAIFTHDDEVVLGVLDAIMDYNGPAQLDIRLATGVGGRRENLDTFKPIKEGYAIDQ
FT                   VTYLFSPTMVRDAVEYGAKILNGESFSGLYLIDTMKIDESNEVEFRGSDIYKIRYESDL
FT                   "
FT   sig_peptide     467431..467502
FT                   /locus_tag="Amet_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.587 at
FT                   residue 24"
FT   gene            468517..470028
FT                   /locus_tag="Amet_0457"
FT   CDS_pept        468517..470028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0457"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: oih:OB2574 ribose ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46685"
FT                   /db_xref="GOA:A6TKG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG7"
FT                   /protein_id="ABR46685.1"
FT                   /translation="MFLQMKNISKNFGPVKALQDVSLEVGPGEIHGLMGENGAGKSTLM
FT                   NILAGAMQPTSGEIYFNDNKIHQMTTIKATEIGIRFIHQELNVINDLKVYENLFLREEI
FT                   VKNFFLLDHKKMIEKSAEIFKGMQIDIDPNQMVSELDTSRKQLVEIAKALLFQSKLIIM
FT                   DEPTTALTNNEIENLFSIMRTLKKEGVSIIYISHKMPELFSICDNFTVLRDGKFISSGA
FT                   FKQIDEEEATKMLVGRSISNMAFQRNDVMDETVMAVENLSCEPFFKDINFSLNKGEVIA
FT                   ITGLHGDGRGELAEALFGARKVTSGKVIVNGKALTLSNIRKVMKAGIGMVPRNRKERSI
FT                   ILDMSIKDNLSMAYFTTHHKKVRVNKKEEMERFERNRKLTDIKASDPNNLITSLSGGNQ
FT                   QKVIIARWLELGSDIYILDNPTQGIDVGAKYEIYRLINELTKHKKSVIIFSAEFSEIQK
FT                   VADRCLVMYKGRINAELKQNEMTEVKVMYYATGSNMEGVKCASKI"
FT   gene            470010..470987
FT                   /locus_tag="Amet_0458"
FT   CDS_pept        470010..470987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0458"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   cpf:CPF_1881 ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46686"
FT                   /db_xref="GOA:A6TKG8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG8"
FT                   /protein_id="ABR46686.1"
FT                   /translation="MRIENIIKSTNKKDLKKIFREYSYVFSFIILVMIAIAVNNRFLTY
FT                   NNLSTIVMQSSIKGIIALGMTLVIISGEIDLSVGSTCAFVAGLGVVVLNSTENIFIMLV
FT                   FCMAFGTLLGTVNGLLITKGKIASFIVTLATMSAYRSIVVQLGQGGPFNVSSEMYPSFR
FT                   MIASGKILGVPNLAIIFIFISVAMAFLMRETKFGKYVYAVGSNSNAAKLTGVNVERIKM
FT                   LSFSITGLLTGISAFLLSARLTSITAANVAMAFELDAIAAVAIGGTAMSGGRGRIFGTF
FT                   LGIIMLQMIEGILIAAKIPPFLNGLVKGVIIVVAVLLQRKKSGE"
FT   gene            471009..471944
FT                   /locus_tag="Amet_0459"
FT   CDS_pept        471009..471944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0459"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: tte:TTE1948 sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46687"
FT                   /db_xref="GOA:A6TKG9"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKG9"
FT                   /protein_id="ABR46687.1"
FT                   /translation="MKLGFLTGALGDIPLKEKIEWAHQSKFDCIEISCWPKMNSRDYSA
FT                   SDIDVDHFTQEDADELNEFLKEKNMFISSLAYYDNHLHEDLNLRKSYHDHLKKVINAAS
FT                   MLGVELVGTFVGRHQGLSIVENFQEFKVVFSDILDFAQEKNVKIIIENCPMPVWHEDGL
FT                   AGTISYSPELWDEMFKIFPHKHFGLNFDPSHLVWLQIDYIKALKDYKERILHIHAKDTK
FT                   MIRENLNRYGIYGKQLHKMDPFDLGWVEAKLPGNGDVDWNNFFKTLKEMDYKGVVSIEH
FT                   EDPSYEGNSELVKEGLLIGKENLERAISRQ"
FT   gene            471969..473018
FT                   /locus_tag="Amet_0460"
FT   CDS_pept        471969..473018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0460"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: bha:BH1248 NADH-dependent
FT                   dyhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46688"
FT                   /db_xref="GOA:A6TKH0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH0"
FT                   /protein_id="ABR46688.1"
FT                   /translation="MKMKIRVGIVGCGSIAKFRHAPEYHENPNVEIEGFYDHNVERAEA
FT                   LAKIYGGKVYSDYLDLIQDKTIDAISDCSTNETHHIVTSAALKNNKSVLCEKPMTTTVE
FT                   NANMILETKKNSKGILMIDHNQRLTSAHIRAKAILKSGELGKVITFTTTFGHKGPEYWG
FT                   ADKSKNTWFFNKNRSVLGVTGDLGIHKVDLLRFLLEDEIVEVSAMAGSLNKRNANNDLI
FT                   DVPDNMVCLLRTEKGNIGTAAFSWSYYGDEDNSTKIYCEKGTMMIYDNPDYQIVINKMG
FT                   KEKICYELEQIQSNDNQTSTGVIDEFIDAIISNREPVVTGEDGIMALKIVEAAMLAAET
FT                   NQTIKIDLR"
FT   gene            complement(473171..473713)
FT                   /locus_tag="Amet_0461"
FT   CDS_pept        complement(473171..473713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE2712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46689"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH1"
FT                   /protein_id="ABR46689.1"
FT                   /translation="MIKRIKTKLDVIEGMLYYWQATSEKDKVGEKYIITMAEQEEMQYI
FT                   YDEEFNQESVRKVLSAISNRELLNSESKKARKFWNNNMWMLEDLEYTNLMIAPLKTLNL
FT                   DALIDKLNNKAVNSQYEEPEVIFLPGHHDEYTIKDNKLIINFFRVKADLYEENKVMIGD
FT                   QLLVDYIEEKLSELVSQ"
FT   gene            473913..474896
FT                   /locus_tag="Amet_0462"
FT   CDS_pept        473913..474896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0462"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: chy:CHY_0890
FT                   hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46690"
FT                   /db_xref="GOA:A6TKH2"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH2"
FT                   /protein_id="ABR46690.1"
FT                   /translation="MDNLVDIFTETIKMSDGQSIHLKRWTPRVSSLKPVVIQIAHGMAE
FT                   HIQRYDEFAKALVKEGWIVHGHDHRGHGSTAKESGELGYFADEEGWERVIKDLNEVTRK
FT                   IKAEYPDSQVILFGHSMGSFLARRYVQLFPQEVDALILSGTGCSKGLLGRIGIQVAALS
FT                   EVVYGKKKQNKLLDKLAFGGFNVRFEPTETSFDWLSRDPQMIQDYIGDPLCGFIFTTEA
FT                   FYDMLKGIEELHKQKNIEKTPKNLPLYIFSGECDPVGDYGKGVKVVYETYVGLGIEEVH
FT                   YKLYPGGRHEMLNEINREEVYRDIIVWIKDALAEKNHSLSNVPKIK"
FT   gene            474940..475833
FT                   /locus_tag="Amet_0463"
FT   CDS_pept        474940..475833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0463"
FT                   /product="metal-dependent protein hydrolase"
FT                   /note="PFAM: metal-dependent protein hydrolase; KEGG:
FT                   cps:CPS_2163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46691"
FT                   /db_xref="GOA:A6TKH3"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH3"
FT                   /protein_id="ABR46691.1"
FT                   /translation="MEKPYKRVGTHHGRFHADEVMATAILMELFEIEVTRTRDPKILSK
FT                   LDIVYDVGGGVFDHHGIEKVYRDDGIPFAACGLIWNEFGRKVISMKESSLVESEIELVF
FT                   ESVDRALMKGIDAIDNGVRIGEQIVDLMDISSIVSMFNPPWDLEKSEKECFDRAVAVAS
FT                   SVLNNTIDHKLAVLRTRIPVSKAYKRRENPKILVLEKSCPWQKVLSEIDERNEVLFVVY
FT                   PDKDNYAIQTVRGEDGEDKKYLPKSWVGKEEKELAEVTGVADAVFCHTGRFIAVARRLE
FT                   SIVKMAELAINEEDKP"
FT   gene            complement(475914..476963)
FT                   /locus_tag="Amet_0464"
FT   CDS_pept        complement(475914..476963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0464"
FT                   /product="Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; KEGG: cth:Cthe_1297
FT                   nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46692"
FT                   /db_xref="GOA:A6TKH4"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKH4"
FT                   /protein_id="ABR46692.1"
FT                   /translation="MNKLKETIRMIEELDQETMQKARERVDNLIKPPKSLGRLEDLAVQ
FT                   LAGITKTIHPTVANKAIIVMAADHGVYEEGIAGFPQEITVVQTLNFVKGVTGVCALGKV
FT                   SGTKIIPVDIGVKEDLDPNAGVLIRKIKYGTDNMAKGPAMSREEAIRALEVGIEVANEE
FT                   IKNGVTLLGTGEMGIGNTTASTAILSVLGNFDPKEITGRGAGLSPEGIQRKAAVIKRAI
FT                   EVNQPDATDGIDVVAKVGGLEIAGMAGVMLAAAANRIPVVVDGYIATAAALIAVSLEPK
FT                   TKQYLIPSHASAEIGSIKATELLGIKPMIHMDLCLGEGSGAALVFPIVEAACHMINCMP
FT                   TFEEAGITI"
FT   misc_binding    complement(477062..477242)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 116.97"
FT   gene            477801..479114
FT                   /locus_tag="Amet_0465"
FT   CDS_pept        477801..479114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0465"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: hma:pNG7256
FT                   xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46693"
FT                   /db_xref="GOA:A6TKH5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH5"
FT                   /protein_id="ABR46693.1"
FT                   /translation="MEKKSSVYELEGVPPLKEAIPLGMQHVLAMFAGNITPIMVIAGAL
FT                   SISVQDRTFLIQASMFIAGVVTLLQLYFGAKLPIVMGTSSGFIGTSLAIGAKYGLAGIL
FT                   GASLIGGVFEGVLGFFIKPLRKFFPPLVTGTVVLTIGLSLIPIGVRSFGGGSGAADFGS
FT                   LSNLFLGTVVLVTILMLKQFTKGFSSASAILIGIIVGYLIAIPMGKVDFGTVQGAGWFS
FT                   FPTPLKFGLAFHWDAIVAMGVMYIVTAVETVGDISGITMGGLKRDATDKELSSGVIMDG
FT                   IGSSLAALFGVLPNTSFSQNVGIVALTGVVNRFAIATGAIFLIIAGLFPKVGALISIMP
FT                   SSVLGGAAIIMFSMITISGINLVTQEPLDGRNGIILATALALGLGMSSVPEILVNMPEG
FT                   IRLLFGGSGIVIAATVALVLNIVFPKTSTPEKAKESAV"
FT   gene            479340..479756
FT                   /locus_tag="Amet_0466"
FT   CDS_pept        479340..479756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_1757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46694"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH6"
FT                   /protein_id="ABR46694.1"
FT                   /translation="MAFVANDYNQISLNDSAFSLTQREKKFLAKSWAKAFAQKVFPAID
FT                   EEEFSVLYSDKAFRPNTPVNVIIGAMILKEMHGVTDEEILESLIFDIRFQYGLHTTSSM
FT                   EQPLSDRSLSRFRERCTTYEAMTGIVLFYKDSCI"
FT   gene            480588..481895
FT                   /locus_tag="Amet_0467"
FT   CDS_pept        480588..481895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0467"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bld:BLi03297 close
FT                   homolog to McpA methyl-accepting chemotaxis protein;
FT                   RBL01413"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46695"
FT                   /db_xref="GOA:A6TKH7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH7"
FT                   /protein_id="ABR46695.1"
FT                   /translation="MSNGNVSKIKSIRKAGMGLQFKLTVFIVLAFTFVTTGNSIFLQYA
FT                   SQVMDNLLLMNVMSTLVSIFLAGCVAFGIIKFFIKKPLDSLTDLGKRLANNNLTEKVQV
FT                   KSKDEFGQLSDMFNHTIENLRVLIGQIQNATETINLSTQQLADSSSDMNEFSEVISNST
FT                   QQLANGSNEQSQSITDIGHAVDELAKNIQDIDVKLKKLDESTDSVMEKAATGQVTIDEN
FT                   MNVMQEIADFTDGLGGTIRTLKNDSDEISQILQMINNIAEQTNLLALNASIEAARAGDA
FT                   GRGFAVVAEEIRKLAENSKGETENIEALIKNTQQNTSKAVSLMNDADKQIEKGLETSQR
FT                   TKDAFSSIIQGTEESILQVKEINSLSTDVASISQEISATVQEISAVIEESSAVTEEVAS
FT                   GTEQQGTEFKKMMGSIQKLSTIGEELTSLIGQFKTK"
FT   gene            481907..482116
FT                   /locus_tag="Amet_0468"
FT   CDS_pept        481907..482116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46696"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH8"
FT                   /protein_id="ABR46696.1"
FT                   /translation="MMFIKSKVIANDKQRLPNQNLLANKDQSKEKDEITRGKGSGEEVK
FT                   GQIRLWNSSYAKHTFRQRKFLEWE"
FT   gene            complement(482182..483113)
FT                   /pseudo
FT                   /locus_tag="Amet_0469"
FT   gene            483409..484200
FT                   /locus_tag="Amet_0470"
FT   CDS_pept        483409..484200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0470"
FT                   /product="molybdopterin dehydrogenase, FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG: dps:DP3068
FT                   similar to 4-hydroxybenzoyl-CoA reductase (HcrB)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46697"
FT                   /db_xref="GOA:A6TKH9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKH9"
FT                   /protein_id="ABR46697.1"
FT                   /translation="MFQIKNYAIPNTIEEAYQLLNEKRANTLLGGCGFLKMGKKTIPTA
FT                   IDLSHLGLDKIKEDENAIEIGAMTSFRAVEVSSILNDHFDGILPRAVKEILGVQFRNVV
FT                   TVGATVYSRYGFSDFITALLALDAYVILYKGGKIPLAAFLAQGCQKDILIKIVILKKNT
FT                   RAAFHAMRNSQGDYAILNVAVSKENNEFKIAVGARPQRAMIAREASKLLGEGQLSEAMI
FT                   EEVSILAAKELTFGSNMRGTKEYRQILCKALVKRGIKEVLS"
FT   gene            484197..484649
FT                   /locus_tag="Amet_0471"
FT   CDS_pept        484197..484649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0471"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: dps:DP3067 4-hydroxybenzoyl-CoA reductase (HcrC)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46698"
FT                   /db_xref="GOA:A6TKI0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI0"
FT                   /protein_id="ABR46698.1"
FT                   /translation="MMKINVTVNDEQLEMEVGYDEFLVEALRRYGFNSVKRGCDTGCCG
FT                   LCTIWINDQPTLSCSSLAVRANNQKITTIEGLQEEATDFAKVLVKEGAEQCGFCSPGFI
FT                   MTILAMKRELKNPTEEEIIHYLTGNLCRCTGYLGQLRAVKKYMGVV"
FT   gene            484652..486961
FT                   /locus_tag="Amet_0472"
FT   CDS_pept        484652..486961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0472"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: dps:DP3066
FT                   similar to 4-Hydroxybenzoyl-CoA reductase (HcrA)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46699"
FT                   /db_xref="GOA:A6TKI1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI1"
FT                   /protein_id="ABR46699.1"
FT                   /translation="MKIVNQSITKIDGMDIATGKPVYTDDLVNVKALVVKILRSPHAFA
FT                   KIKSIDVEKAKKRSGVACVLTHQDVPNQRFTMAGQSYPEPSPYDRLVLDEYVRYVGDEV
FT                   AIIAAVDERTAIEAMKMIKVEYEILEPVLNFEEAIGHPSVIHPEENLEVNFDIGMKREK
FT                   NIAATVLIENGDMEEALKNSPVIVEETYYTQAQAHGMMETQRAFTYLDVSGRLTIVTST
FT                   QIPFHVRRIVANALEIPKSKVRVIKPKIGGGFGGKQNASVEVFPAIVTLKTGKPAKIIY
FT                   DRKENLGCTSSRHAMKIKVKLGADHEGNIKAVDMEALSDTGAYGEHASTVLGVAGYKTL
FT                   PLYNTAKAVRYSGEAVYTNKMPAGALRGYGVTQGIFALESAINQLADQLNMDPAEVREK
FT                   NLIKQGETNPILSGSKAGEPGKLDSCTLDRCIEKGKELIGWKEKYPSQRVSDTKVRAVG
FT                   MAITMQGSGIAGIDTAAVTIKLNDDGLYSLLIGATEMGMGSDTILTQMAAETLEIGMDK
FT                   FIVHGIDTDLSPYDTGSYASSTTYVTGNAVIKAAEDLKGKMMRQASGMLGVPLKGLRFK
FT                   GDTIGVINHPDKQVSLNEIAADVGAGEGKQEQLMGSGTFGGDKSPPPFIAGFAEVEVDL
FT                   ETGKIVLIDYVAVIDCGTVINPNLARIQAEGGLVQGIGMAMYEDVLYDKAGRMMTNSFM
FT                   QYKIPCRKDINKITVAFEPSYEPTGPFGAKSIGEVVINTPPPAIAHAVFNATGVYVRNL
FT                   PITPEKVVKGMMESSK"
FT   gene            complement(487055..487591)
FT                   /locus_tag="Amet_0473"
FT   CDS_pept        complement(487055..487591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46700"
FT                   /db_xref="GOA:A6TKI2"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI2"
FT                   /protein_id="ABR46700.1"
FT                   /translation="MKYDVKDIAIIALTAALTVVIGYLFYVVGSFFPIPGYKFIIFAPF
FT                   LGFMIFIPTRKIQKVGVISAVSIVFAALMTPVSVFMGIAIFMTGITTDLLTLLLLHNYN
FT                   QMWKITASVGLYPMFSVLWSFLVSYYFTGNAMYQLVGGWISILLLCLVIYILGVVGAYL
FT                   SNKVIFSRISKSIIS"
FT   gene            488031..488363
FT                   /locus_tag="Amet_0474"
FT   CDS_pept        488031..488363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46701"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI3"
FT                   /protein_id="ABR46701.1"
FT                   /translation="MYDKDTVYIVGHGRTSSDNAITHHYKIFFISFVVKIETTEIIDLE
FT                   CSATVDITKKFVHSLFIGKKLGEFDEEIEEEIKRRYFGSSQRAIIVAYKDGVKKFNECK
FT                   QRYYDQ"
FT   gene            488686..489777
FT                   /locus_tag="Amet_0475"
FT   CDS_pept        488686..489777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0475"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: cac:CAC0192 similar to chloromuconate
FT                   cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46702"
FT                   /db_xref="GOA:A6TKI4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI4"
FT                   /protein_id="ABR46702.1"
FT                   /translation="MKIIDIKVGRILIPLKKPFKTALRTVEHVNNIIVKIETDTGHVGY
FT                   GEAPPTGVITGDTRGSIAGAIKEHIKNNILGMDIANFEEIMIRLEKSLVKNTSAKAAVD
FT                   IALYDLFGQLYNAPVYKLLGGYRKEMTTDITVSVNDPEEMVKDSMDAVSRGFKTLKIKV
FT                   GKNINLDLQRMDAIREAVGDDIHLRLDANQGWSSKEAIYAIKKMEDKGFNIEFVEQPVK
FT                   AEDLEGMKAVTENVSTLILADESVFSPKDAIEIIRNRAADIINIKLMKTGGIRNALRIC
FT                   AIAEMYGVECMIGCMLESKLSVTAAVHLAAAKSVITKVDLDGPLLCKEDPIEGGAIFQD
FT                   YKITVSDDPGFGFKNIDGIIWDS"
FT   gene            489809..490738
FT                   /locus_tag="Amet_0476"
FT   CDS_pept        489809..490738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0476"
FT                   /product="peptidase U61, LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61, LD-carboxypeptidase A; KEGG:
FT                   bld:BLi01397 YkfA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46703"
FT                   /db_xref="GOA:A6TKI5"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI5"
FT                   /protein_id="ABR46703.1"
FT                   /translation="MLKPKALKKGDTIGVIAPSSPALPEKVTGANKKLEEMGFKVKMAS
FT                   SCYETHGYLAGQDKLRADDLNDMFKDKEIDGIICLRGGYGAPKIVDKIDYEAIKANPKV
FT                   FVGYSDITSLHIAMNQISGLVTFHGPMAATDIAGGLDDFSEKEFIRAITNPEPMGMIQN
FT                   PNGIKVQTLVGGEAKGTIIGGNLALLTATMGTPYEVDTKGKLLLIEEIGEEPYRVDRML
FT                   TQLALGGKFKDAAGIILGDWNDCDPQKHKSSLSLMEVFKEIIVPFGKPTIYDLKAGHCR
FT                   PKVTVPFGVNAHLNADTGELVMEESATI"
FT   gene            complement(490845..491831)
FT                   /locus_tag="Amet_0477"
FT   CDS_pept        complement(490845..491831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0477"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   tko:TK2040 microsomal dipeptidase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46704"
FT                   /db_xref="GOA:A6TKI6"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI6"
FT                   /protein_id="ABR46704.1"
FT                   /translation="MDKKKIIEDMIIIDGHTDIPRDVYLREKKGEENVFKENHYLQLKK
FT                   SGVNIIFANIFTKCPPRDSMKVAMLHIENLLGTIAKYDDVVLIKNKSDLDFVLKTEKLG
FT                   IVLSLEGVEPLDSSLALLNIYYQLGLRAGMLTWNSANEFASGADHIEGGLTDLGKLTIE
FT                   KMNELGIIVDVSHLNEESFWDVLQLNKRPTIASHSNAKALFNHPRNLTDQQMLAIAKNG
FT                   GVIGAVSYFSKVDKENPDKIRHSDDDTETIDDFIKHIEYMVNLLGYDHVAFGFDFNIYL
FT                   GDFGVEGLESAENIKDVIALLIDRGHSIEDIRKIAGGNWIRILNTIL"
FT   gene            492143..492961
FT                   /locus_tag="Amet_0478"
FT   CDS_pept        492143..492961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0478"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: dsy:DSY3698
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46705"
FT                   /db_xref="GOA:A6TKI7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI7"
FT                   /protein_id="ABR46705.1"
FT                   /translation="MKYSIGQFAATLGVTVDTLRLYEKYGIISPIKNSENNYRYFNDLD
FT                   ARNLLTSRWYRSIQIPLQDAAILTQNASLDNIAEKVNETQLNLEAEIKKSTMLLNKIVG
FT                   INKELKEIKTEINKCKIKAMPGMYRLKQTKGNVLIQEDFLRDLVDTWMNALPYTFFSFR
FT                   IEKKEIVSLKKAFEYSWGLAIFEDEIGCFDVKMNENVEYISPKVYLSSIILSSQGEHIT
FT                   RDSIQFMMDYIKENNYKITEDIIGKIILTEKINGKNKSYLELNIPIQSHE"
FT   gene            493222..495150
FT                   /locus_tag="Amet_0479"
FT   CDS_pept        493222..495150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0479"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FMN-binding domain protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: eca:ECA0910 putative flavoprotein
FT                   subunit of a reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46706"
FT                   /db_xref="GOA:A6TKI8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI8"
FT                   /protein_id="ABR46706.1"
FT                   /translation="MKKKHIIKRLSIMSFYMLLIVLMMSGCTQQETNSIQASGYTAGTY
FT                   AAEADGYGGPVKVEVTFSETEITDAEILSHSETAGLGDAALERMKEQILVGQTLAVDTV
FT                   AGATISSSAMIAAIEDAVQQAGGDVEALKANGVEKPSEGKIEKLEADVVVVGAGASGVS
FT                   AAIAAADEGANVIIIEKTGAIGGASNLSWAGKFLNSSAAIEDELIIDEEKEIAEWIENN
FT                   HWRVDAAVIRQYVTQSGETYDWLTEKGYMTQYINFAGEQMHMLPPYETRQETLREMLAE
FT                   SVEKQDGQVFTETAAKQLMTNQAGDVVGVIAEKADGTTLEITAKSVIMATGGYGANAEM
FT                   VKEYFGFEGVNGGLGQNIGEGIKMAWEAGARVPDNIGGQMLHQTLARATNDLKTEYESF
FT                   EASYPLMLTYLPNFMNVGTSGARFRDEAATLKAVAAANTSAFHGPYHYVIVSQLQLDSL
FT                   MAEGMNGVKAPKLPGMPPEFYMDFSDQFTLDNPWENADKVFDSMVEKGHGFKGNTMEEL
FT                   AENAGMDVAVFVETLKNYEEATKTGADTEFGKTADYLISMGEEGPYYAIIAEINNLGSI
FT                   GGIVVNRNFQVLNEARVPINGLYAVGVEAAGVLYNDTYVGNGVGIGYAFTSGRLGGMQA
FT                   ASHVLGK"
FT   sig_peptide     493222..493314
FT                   /locus_tag="Amet_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.430 at
FT                   residue 31"
FT   gene            495476..496228
FT                   /locus_tag="Amet_0480"
FT   CDS_pept        495476..496228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0480"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: tte:TTE0770 NCAIR mutase (PurE)-related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46707"
FT                   /db_xref="GOA:A6TKI9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKI9"
FT                   /protein_id="ABR46707.1"
FT                   /translation="MDIHELLKKVKNNEMDIESAEALLKKLPYEDLGFAKLDHHRKLRS
FT                   GFGEVVYCSGKSTEHLIKIFQSFNEKKVDILGTRATKEQFQAVKAIVEEAEYDELSRII
FT                   KVVRSDIKKIGLIAVCTGGTSDIPVAEEAAQTAEFFGSNVMRIHDVGVAGIHRLFSKME
FT                   EINKANVIVAVAGMEGTLPGVIAGLVDKPVIAVPTSVGYGSNFNGLSALLTMLNSCAEG
FT                   ISVVNIDNGFGAGYLGTQINRLAVKGSE"
FT   gene            496221..497486
FT                   /locus_tag="Amet_0481"
FT   CDS_pept        496221..497486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0481"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   cth:Cthe_0369 protein of unknown function DUF111"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46708"
FT                   /db_xref="GOA:A6TKJ0"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKJ0"
FT                   /protein_id="ABR46708.1"
FT                   /translation="MSNQLYLECYSGISGDMAVSALLDLGADVDVLKKSLHSLNLEGYE
FT                   INIGRRQKCGIDACYFDVVLEGEANHHHDHQEKHDHHHGGHPVHRNIKDIYEIIDNSQI
FT                   SDRSKILSKKIFHVVAKAEAKAHGIAIDEVHFHEVGAVDSIVDIVAAAVCLDNLEINEV
FT                   MISDLYEGSGHVKCQHGVLPVPVPAVANIVMDNGLNLRITDTRGELVTPTGAAIAAAIK
FT                   TKDTLPASYGIKKIGIGSGTKDLPKANILRAYIIEDNRNYPKKTVAVEDHIDSLDDGEA
FT                   WVLETNIDDATGESLGFTMERLLENGANDVFFSPIYMKKNRPAYKLSVICTKENVKIME
FT                   SIIFKNTTTIGIRKHKIRRTVLKREVTTIDTKYGQVRVKVCEFENETYYYPEYEDIKRI
FT                   CNETGLGFQRVYDEVEKTKTVG"
FT   gene            497536..498348
FT                   /locus_tag="Amet_0482"
FT   CDS_pept        497536..498348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0482"
FT                   /product="ExsB family protein"
FT                   /note="PFAM: ExsB family protein; KEGG: chy:CHY_1281
FT                   conserved hypothetical protein TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46709"
FT                   /db_xref="GOA:A6TKJ1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ1"
FT                   /protein_id="ABR46709.1"
FT                   /translation="MLLQEKYEFLQNYIKNLGSLAVSYSGGVDSTFLLKVAYDVLGDNV
FT                   IAVTATSSTYPQREFEEAKRWIKDIGAKHIIIESEELDIDGFSENPINRCYYCKSELFT
FT                   KVREVAVENNIEYVADGSNQDDLGDFRPGMQAASELKVVSPLREAKMTKDEIRAISKQL
FT                   DLPTWSKPAFACLSSRFPYGHQITREKLTMVEQAEDYLYGLGFRQLRVRHHEDTARIEL
FT                   GESEFDRFINKDLMRQVGKKFNEIGYTYVALDLNGYRTGSMNEVLKDI"
FT   gene            498533..500191
FT                   /locus_tag="Amet_0483"
FT   CDS_pept        498533..500191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0483"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; KEGG: cac:CAC0367 arginine
FT                   degradation protein (gene RocB)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46710"
FT                   /db_xref="GOA:A6TKJ2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ2"
FT                   /protein_id="ABR46710.1"
FT                   /translation="MGNVDEHLLESIDLLLTDLVGIKSDTGTELEINVENFMHNWLKEL
FT                   QYFREKPEYLGCYKLPQDPLKRGAIWALRKGEGKKTIILLNHHDVVNADDYGLLSSYAY
FT                   NPEILMTRLKKIKLPQEARDDLGSGKWIFGRGTADMKAGIAIQLALLEQYSKVAHFKGN
FT                   ILLLSVPDEESLSRGMIASLSLLNDLKEKHSLNYELVINCEPHERSEEGAGTIHGGSVG
FT                   KMMPVIYVRGKQSHIGNVFQGFNPISLLSKIADEVELNPDFSDEAHNEVSPPPSFVCFR
FT                   DLKKTYDVSIPNAAVGYFSILTLKSTPEEITDRLKDISIKASEETIYKIGKKHKDYIDK
FT                   LGSSEKVARWDVKITTFAELYEEAQGTSGELFALDYNKTVEKIKKEIENKLIGLADATT
FT                   ILIEKTLAYIDDMDPRVIIGFIPPYYLHVSNRDFHHLSSSIEGLSDEINRFTLNKWNEM
FT                   YRSQNYFMGISDMSYFYMNERTDVVTSLGPNMPLWNKIYHIPFGEIEKLSIPVINIGPW
FT                   GKDIHKFTERVYKRDLLERTPSIIKHVMEHLLDEK"
FT   gene            500230..501423
FT                   /locus_tag="Amet_0484"
FT   CDS_pept        500230..501423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0484"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein; KEGG: gka:GK1208 succinyl-CoA synthetase
FT                   beta subunit (succinate-CoA ligase beta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46711"
FT                   /db_xref="GOA:A6TKJ3"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKJ3"
FT                   /protein_id="ABR46711.1"
FT                   /translation="MNIHEYQGKEIMKQYGISVPRSRITFTVEEAVQAAIDLGCEVIAV
FT                   KAQIHAGGRGKAGGVKITRSLEETKSAAEAILDKILITKQTGPEGKVVNQVLIEEGLKI
FT                   EKECYLSCAVDSTTSTVVLIGSPEGGMDIEEVAEKTPHKIFKESIDPAIGLQQYQARRL
FT                   AFNMGINEACLQEAAQCIMNIYRLFMEKDCSMVEINPLITTEEHKVVALDCKVCFDDNS
FT                   LCRHPEILKYRDLTEEDPREVQASKYDLSYISLSGNIGCMVNGAGLAMATMDMIDHFGG
FT                   APANFLDVGGGATAEKVKEAFKILISDKKVAGIFVNIFGGIMKCDVIATGILQAVNALD
FT                   LDVPLVVRLEGTNVELGKEILKSSWLDVITVNSMAEGAEKIVALVNGKGVVRDERLN"
FT   gene            501407..502309
FT                   /locus_tag="Amet_0485"
FT   CDS_pept        501407..502309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0485"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: bha:BH2469 succinyl-CoA
FT                   synthetase (alpha subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46712"
FT                   /db_xref="GOA:A6TKJ4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ4"
FT                   /protein_id="ABR46712.1"
FT                   /translation="MSVLIDENTKVIVQGITGFTGLFHTKQAMEYGTNIVAGVTPTKGG
FT                   TTVEGIPVFNTVKEAVKATGGNTSVIYVPPIFAADAILEATEAELELVICITEGIPVMD
FT                   MIKVKAFMKGKKTRLIGPNCPGVITPEVCKIGIMPGYIHKKGHVGVVSRSGTLTYEAVH
FT                   QLSTRGIGQSTAVGIGGDPVNGTSFIDMLKAFNEDEETYAVMMIGEIGGTAEEEAAEWI
FT                   QSNMTKPVVAFIGGKTAPPSKRMGHAGAVISGGKGKASSKIKTLEACGIKVASTPDVMG
FT                   ETLIAVLKENHLLEKCMID"
FT   gene            502447..503469
FT                   /locus_tag="Amet_0486"
FT   CDS_pept        502447..503469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46713"
FT                   /db_xref="GOA:A6TKJ5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ5"
FT                   /protein_id="ABR46713.1"
FT                   /translation="MTNLIRTLNPLAMLMILMIVTILVSAIIMTFMVKKKYEKISEDLH
FT                   NSSEDERNIYEYAVLNSIIEDYKTAATRNPNEVNTQAIIEKNFNRVHRGLSLGERFVRQ
FT                   AVSLMIILGLLGTFYGLTLSIADLVALLGGSGSSEMLNSMDSIVQGLINSVSGMSVAFI
FT                   TSLFGIASSIILTIIIVFVNIEDSKEAIMVEIEEYLDNKVALDFARQQALDPAAPRSNL
FT                   EIGMGQVMEGFTNSLNEKLSVLLETSAEQLIAATKESQTSAEAIQSSMESFNHSIETFS
FT                   ENTRDFSEFNHNLRTNIERMDVAFADLVQDLKENGKDLSKNQEAVESLSRAIDKLSERL
FT                   "
FT   sig_peptide     502447..502527
FT                   /locus_tag="Amet_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.666 at
FT                   residue 27"
FT   gene            503500..504444
FT                   /locus_tag="Amet_0487"
FT   CDS_pept        503500..504444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0487"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   cjj:CJJ81176_0627 chemotaxis protein MotB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46714"
FT                   /db_xref="GOA:A6TKJ6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ6"
FT                   /protein_id="ABR46714.1"
FT                   /translation="MKARKRSFKKFREDQNFWPSFTDMISTIALILFFLMILAYVQNIV
FT                   TGSNLEYARRQLQDTQQRLEASNLEISQAEDQLRLLTDRVDEIKAEVEDGEIALRLSEL
FT                   QIEDQSQIIAESNRELGNLRSRLQGIAVLRLDVLNRVKDSVEEEMARTRDRRDSPVYIA
FT                   DNGNIVIDEELVFDLNSYQIKPAGRQVLDELAMAFENILRDPEVRVNIDAINIQGHTDD
FT                   IGSAEYNRNLSANRSVEVVNYLLNSNPTLENRYASYFMASAYSKFRPIASNATEANRAQ
FT                   NRRIEISIILKDSNIQEVINEYLADSMNAFMNE"
FT   sig_peptide     503500..503619
FT                   /locus_tag="Amet_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.572 at
FT                   residue 40"
FT   gene            504719..506431
FT                   /locus_tag="Amet_0488"
FT   CDS_pept        504719..506431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0488"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, dimerisation and phosphoacceptor region;
FT                   KEGG: oih:OB2520 two-component sensor histidine kinase
FT                   involved in degradative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46715"
FT                   /db_xref="GOA:A6TKJ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ7"
FT                   /protein_id="ABR46715.1"
FT                   /translation="MYPQLYKKISFLKEQSEIMKIIFLYRYVSLIVTSSFYLLADSTHS
FT                   FENKIFIVACISISSVIISYLYIKNQNCTDKIMILILIETIGNSFILIPSGGLNSPYVW
FT                   YSLNTIVIASVALHKKYCWINLVVYLFSSTYLSHLILQKEQTLMQIISEESNLILSFIL
FT                   ITGIIQLLTKYAKRVQDEGLKLTETNRKLVLANKKNKESLGYIMELYEATQLFTTQETP
FT                   SDLIELMLDYSQKVMKTDTVIFIHPRREGKKVVIESNNLAEDLEEVICCEISSIWHNTV
FT                   ESEIPIEMIIKDQKYVFIAIKYNYKVFGILGITRTSTKMQNNYEEITEQLRFLASLSSI
FT                   TLEKFELEKVTEGLLINEEQNRIANEIHDGILQRLFSTSCGVFSIVKRVREMNTDEIEE
FT                   ELNIIRRAVNNVMKDLRSTVYGLSWKKDGANNFISDIESYINEIKALNNIDIKFDLTGD
FT                   DELLSIAQKKAMYRIICEGIGNAVRHGNAQNIEVSIISRRQGMSLIINDDGKGFNMRGI
FT                   DKSERFGLGVKNIYHLTHSLNGTIKFESQIGKGTRINIVIPNVIQEMYKEEVV"
FT   gene            506428..507045
FT                   /locus_tag="Amet_0489"
FT   CDS_pept        506428..507045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0489"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: tte:TTE1681 response regulators consisting
FT                   of a CheY-like receiver domain and a HTH DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46716"
FT                   /db_xref="GOA:A6TKJ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ8"
FT                   /protein_id="ABR46716.1"
FT                   /translation="MRILIVDDHPLVRKGIASILFLEKDVHEIKEAENIEEAIDMMAKF
FT                   SPEITLIDLNLGRQDGLEIVNKARAKGMATKFIVLTSSSKREDFLRAREAGVDGYILKE
FT                   AFAEDILYALRIVLRGKKFIDPEVIQYQTSDIRENSHLDELTPRERDVLTELGKGLSNF
FT                   EIGKQLFISEHTVKKHVSNILSKLELNHRTQAALFVNNSINI"
FT   gene            507100..507603
FT                   /locus_tag="Amet_0490"
FT   CDS_pept        507100..507603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46717"
FT                   /db_xref="GOA:A6TKJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKJ9"
FT                   /protein_id="ABR46717.1"
FT                   /translation="MRRKNKKRRKTTLSSRVVIYITIIAMLNIMGISYAAWSEGTRLDC
FT                   KVSTGNMELIFEHYEIEGLSKNINDELVIEDEFNISHGERGMKIGGRIIESGNRTLTLR
FT                   VKNNGSVPVRLAQVDNGYLENGEIMLEPQSTKEIIINNITINAREESINNNNHDVKLTF
FT                   EQLY"
FT   sig_peptide     507100..507207
FT                   /locus_tag="Amet_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 36"
FT   gene            507674..508483
FT                   /locus_tag="Amet_0491"
FT   CDS_pept        507674..508483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:1834 dentin sialophosphoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46718"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK0"
FT                   /protein_id="ABR46718.1"
FT                   /translation="MKNKTVVISLSLIFAVYVINTGYGNWRDEITIEISDDIELIQPQE
FT                   SLAAQSPQMLDVGGVSTPIGGGETVKQPTINNDVITGSGGESSQGKAGNTNTTPQENAS
FT                   SKDDIVEENSQTEEEDLVDNVISQNDVEVETSESDESNETSESDESNETSESDESNETS
FT                   GSDESNEASGSDESNETSGSDESNETSGSDESNETSGSDESNETSGSDESNETSESDES
FT                   NETSGSDESNETSESDESNETSESDESNETSGSNESNETSESDESNN"
FT   sig_peptide     507674..507736
FT                   /locus_tag="Amet_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.654) with cleavage site probability 0.397 at
FT                   residue 21"
FT   gene            508518..509726
FT                   /locus_tag="Amet_0492"
FT   CDS_pept        508518..509726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0492"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="TIGRFAM: peptidase S26B, signal peptidase; KEGG:
FT                   cpf:CPF_2579 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46719"
FT                   /db_xref="GOA:A6TKK1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK1"
FT                   /protein_id="ABR46719.1"
FT                   /translation="MIIGGNFLPTQKSKEKCVLLVLLVIGIYVMENSSVVAYIGSNHLN
FT                   YIIKPMIWMGITYTIWLFPRVKSKAKLKQRSFLNFWALNFAVIYIIVSVLAGIVDGLGR
FT                   SPYSHTPMGILKNIGFVGGAIVGREFIRSYLVNNLTDKENYLVFTLVSILMTVTSISLS
FT                   RFTNLSGHVDIVKFIAQYLAPGFAQNILATYLVFIGGPLTSIIYLGITQGFHWLSPILP
FT                   NLKWITTALIGILCPVFCLMSMQGIYNGTTKKNRRKDEESSLSWMITSVISIGIIWFAV
FT                   GVFPVYPSVIATGSMEPMIKPGDIILVKKIVDMEGIDNLKTGDIIQFKKGRILISHRIT
FT                   EVVEGNEGIAFSTKGDNNSSEDSDLVMPEQLKGRIVNVVPKIGWPTLLIKSKDEIPFEE
FT                   IEF"
FT   gene            510087..510707
FT                   /locus_tag="Amet_0493"
FT   CDS_pept        510087..510707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46720"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK2"
FT                   /protein_id="ABR46720.1"
FT                   /translation="MKRTKFLALALVVALMMMGAGYAYWTQDLTIQNTVNTGELDVQFT
FT                   ELELDVEGAAYMGSASSFLPADTDGEYNLKLDLIDAYPGAGFTVSFDLANTGTLAANVR
FT                   NFDITDTNNNADLVLVRSYTVGNSTESLTTDTTLQEVLDAFNALNDNEGISVEYDDSVS
FT                   VELVLEINPDADNQVDSDLYLEEDVTGAISFTINATAYQYNEI"
FT   sig_peptide     510087..510158
FT                   /locus_tag="Amet_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            510757..511521
FT                   /locus_tag="Amet_0494"
FT   CDS_pept        510757..511521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46721"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK3"
FT                   /protein_id="ABR46721.1"
FT                   /translation="MKKTKFLSFILIISIMAMGAGYAYWSQDLSITNTVSTGDLDVQFL
FT                   PVNILESGDYSGTIQLPDDILALLSSPRHFDGSDYMDVNLGYTGKDTINVTFDKIYPGA
FT                   GGFVSFIIVNQGTVPAKLKDVRTEGVDETYAGLKDYLDYSVRSVIKFQNNGGIYTNYEV
FT                   IETPIQADTLDEFRLALKEQLKDVTLQPSELIIINLPWWLGGGTIEYDETEALRSGYSI
FT                   SMPTNIDGIDDNDLEGQTLEFDLKLEYEQQTQ"
FT   sig_peptide     510757..510828
FT                   /locus_tag="Amet_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 24"
FT   gene            511669..512778
FT                   /locus_tag="Amet_0495"
FT   CDS_pept        511669..512778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46722"
FT                   /db_xref="GOA:A6TKK4"
FT                   /db_xref="InterPro:IPR035185"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK4"
FT                   /protein_id="ABR46722.1"
FT                   /translation="MKFKINKKIRIALLFIIALILVTTASVLYREYKNPRYQAEIVQLY
FT                   KYNNRTNINYEVFLKPNILYEQDRLGEGEVYITEFVDYIRTSYSYEFDGESDAQIEGDY
FT                   EIIAQVEGYTGSGESYRSIWKKNFILFPKQKFNTKEKGLILKEEISISLDEYNDFAKQV
FT                   IEASKISTSVEVSVIMNINLKADTGNGLVEEKLNPMIVMPLNTSSFEISGNLAEGRSGN
FT                   IEETKQVQLPVDNKKIMIYGIIIGIFILVLILMIFFTKSKIITDPLEKKLKKIFKKHGD
FT                   RLVALNSDLVITTESCNNVKSIEDLVRIADEIGKPMMYKHNTDYKEIKKFYVTNEDEVY
FT                   ILDLNETFVKNELSNKEELSNKEDGAVES"
FT   sig_peptide     511669..511746
FT                   /locus_tag="Amet_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.889 at
FT                   residue 26"
FT   gene            513172..514461
FT                   /locus_tag="Amet_0496"
FT   CDS_pept        513172..514461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0496"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: cth:Cthe_1368
FT                   S-layer-like domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46723"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK5"
FT                   /protein_id="ABR46723.1"
FT                   /translation="MKSKKNFVKMILKFLVLILVVGYFASDIVELTYSTINQSGPDVTV
FT                   TINNDGSISQEGNLFGDKLLYPGKEADGVSGVIRIQNQYNAAQISNLGVGVELKNVNQA
FT                   YDQGMVYDSFINHMKLSIRKGKLPISNIFEKHIIKDRSLKDLLYIKNDASENGYMLESS
FT                   EQFSISRNDFIDLQYALYMDQEAGNELQSVRADLSFLINVHGDIIDDPGNGGNGGNGGN
FT                   GGNGDNGNNGDNGNNGSNDKEELVEEPVEIIPDLNGHWAHDCIETLLREGIIVGYPDGS
FT                   IKPNNPITRAESAVLIAKALKIEKQDKFFSGYIDPLPGWAKGYIIAVSEKNIFVGYPMK
FT                   LFRPNRNITREEMVTVLIKGFEKELTPDMKLEYTDKEDIGEWALEYVKAGTSHEILRGY
FT                   PDGSFKPKQEITRAEAFTIICKLLGLHEEH"
FT   sig_peptide     513172..513249
FT                   /locus_tag="Amet_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.741 at
FT                   residue 26"
FT   gene            514472..514813
FT                   /locus_tag="Amet_0497"
FT   CDS_pept        514472..514813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46724"
FT                   /db_xref="GOA:A6TKK6"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK6"
FT                   /protein_id="ABR46724.1"
FT                   /translation="MKNTHSAMEEPMFKEKKYKLLWVLLFGTGVFNVCDYFLTLKAIGM
FT                   GYEEANPLVDGILHTPLFPITKLLIVPALLVLIWFLRKRVGKRVMLYAWTVFIAYFSLM
FT                   IYFGGIFLS"
FT   gene            515329..515988
FT                   /locus_tag="Amet_0498"
FT   CDS_pept        515329..515988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0498"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   KEGG: cno:NT01CX_0285 MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46725"
FT                   /db_xref="GOA:A6TKK7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK7"
FT                   /protein_id="ABR46725.1"
FT                   /translation="MKVIARLGLPAGLQSGLFTVFAMFIARIVAQWGAVPIAVQRVGSQ
FT                   IEALSWMTANGFSTALSAFVGQNYGAGKWERIQKGYYASLRIISVFGLGVTCLLIFAAR
FT                   PIFSVFLPEPEAVAYGIVYLQILGLSQVFMCIEITTAGAFNGLGRTIPPSIVGIAFNAL
FT                   RIPAALILSASMLGLNGVWWSISMTSVFKGIVLTTWFVALLQRQAFQVTNAGIKST"
FT   gene            516096..516554
FT                   /locus_tag="Amet_0499"
FT   CDS_pept        516096..516554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_5396 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46726"
FT                   /db_xref="GOA:A6TKK8"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK8"
FT                   /protein_id="ABR46726.1"
FT                   /translation="MVMLIMLVSLIIIYRKLKIGERGSRKMEVLLVHINFSVYLGWISI
FT                   ATIANITAFLVDIDWNGFGISPAIWTVSVMSVGIVLALLFIYLHKDIFYALVVDWAFLG
FT                   IYLKRTAPGTEAVLLVISAAIIGMIIISVAIVLAIIKKRVYVIRKSEL"
FT   gene            complement(516869..517654)
FT                   /locus_tag="Amet_0500"
FT   CDS_pept        complement(516869..517654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0500"
FT                   /product="Transcriptional regulator IclR-like protein"
FT                   /note="PFAM: regulatory protein, IclR; Transcriptional
FT                   regulator IclR-like; KEGG: cff:CFF8240_1062 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46727"
FT                   /db_xref="GOA:A6TKK9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKK9"
FT                   /protein_id="ABR46727.1"
FT                   /translation="MSQEEHRSTARVLDILKLLAFSDKGYSLTEISKLIGAPKSSLFPI
FT                   VQTLHKRNFIALDQSSSKYTIGLNSFIVGSSYIEHLDIVSYIREEMKTIVASCSETCQL
FT                   GILHKNEVLYIAKVDSSQPIRLISYVGKKIPAYATALGKALLSQFTDEEVQILYPEALV
FT                   PYTENTIVNIKELIHQLQAVRKTKIAYEKEEVAEHIQCIAVPLEKSNQIIAAISISIPI
FT                   FRVNKEKLLEIEKQLLKSKERIEQLLDNINFDPDKFFSV"
FT   gene            518093..519523
FT                   /locus_tag="Amet_0501"
FT   CDS_pept        518093..519523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0501"
FT                   /product="Gluconate transporter"
FT                   /note="PFAM: Gluconate transporter; Citrate transporter;
FT                   KEGG: msu:MS0335 GntT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46728"
FT                   /db_xref="GOA:A6TKL0"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL0"
FT                   /protein_id="ABR46728.1"
FT                   /translation="MLPSTFLLILIGAVVFLMFFILKLKMNPVLAILLVTIPLAILLGN
FT                   SPAEAIEAINQGFGATLTSIGIVIILGSIMAVIVQDTGAAIPIANFFVKLVRGKNVELG
FT                   PALAGYILSIPVFGDITTLLMAPIASTLAQKHKISMAKMAVFICVGLNITHALVPPTPG
FT                   ILAVTLQMGADLGRVILFGSVIGIIGFFILYFLLRDWSGKEMIQPIKEYLELPEELAGK
FT                   QEQAATGEGVLDNLPSTFHSFLPLFLPVILITVASFMKVSFDPQSTAYTIITFLGDRVI
FT                   ALLIGVAAAMTLAIGRMEKVKAIARKNDSRLREDCSLLECIFGSWVTRALQMAVLPLLI
FT                   TGMGGAFGRVLAAAPAAGGLAETIAASGIPALAIPWVITMAMMACLGSMTMAQLTSAAL
FT                   VLPILPSLGISPLAAVLAIGAGAIGPNHVNNSGFWVFSGFYNLNPKQALKYITFPSVVM
FT                   SIILFAIVFVLNSIGLLG"
FT   sig_peptide     518093..518245
FT                   /locus_tag="Amet_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.709 at
FT                   residue 51"
FT   gene            519626..521350
FT                   /locus_tag="Amet_0502"
FT   CDS_pept        519626..521350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0502"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: rpc:RPC_4380 dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46729"
FT                   /db_xref="GOA:A6TKL1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL1"
FT                   /protein_id="ABR46729.1"
FT                   /translation="MRNIKQKSASERLLWAQFDALQLGSGWDEEDIKKPQILIEDVFGD
FT                   SHPGSVHLNKLTEQVKYGVFETGGFPAQFHATDICDGCAQGHDGMNYILASREAICDMV
FT                   EVHGSVCSWDGMILASSCDKSIPAHLKAAARLDIPTIFIPGGSMRVGPNMTTSLVAGDI
FT                   SLRQKRKGEIEDQEVRDYKITGCPSVGACTFLGTASTMQCMSEALGLALPGSALMPATM
FT                   TDILRNSRKAGRKIMELVEKNITPSQILTKEAFVNAIIVHAAIGGSTNATIHLPDIASE
FT                   LGIELTPELFDEINHKIPYIGNINPSGEHLTESFWFAGGIPMVQLMIKEHLNLDVMTAT
FT                   GKTLGENLEDLQKENFFDRNLGYLANYGLKSEDVIFPIEKAKEIGSIAILRGNIAPEGS
FT                   VVKYSACDESLFVHKGTARVYNSEEDAHNAVVNGEINPGDVIVIRYEGPRGNGMPEMLM
FT                   TTEAIVCDKRLNGTVSLVTDGRFSGATRGAAIGHVSPEAASGGPLAWVATGDIIEYNIH
FT                   ERTLNVVGIDGAEVSSEEVDKVFVERSKDGVIPRPPRKGLFKRYTTSAVSAMKGAGY"
FT   gene            521677..522579
FT                   /locus_tag="Amet_0503"
FT   CDS_pept        521677..522579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0503"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   cje:Cj0021c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46730"
FT                   /db_xref="GOA:A6TKL2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL2"
FT                   /protein_id="ABR46730.1"
FT                   /translation="MKFIAFTTKDKENTRLGVYKNSESIVIDLNTIGLSRFFHDMNDLI
FT                   KNIKPKDIDVLKEVISLVEEKEYETYHVEEITLGAPIDRTIHDVICVGLNYAEHIDETK
FT                   KGFDENMEIPLHTVYFSKRANQVKGPGEEIESHSHLNESMDYEVELAVIIGKEGINISK
FT                   EEAKEYIFGYTILNDLSARGLQKNHVQWFRGKSLDGFTSMGPCIVHGSSVGFPLELDIK
FT                   SRVNDELRQNSNTKFMMKDVSTIISEISQGMTLLPGDVIATGTPSGVGMGFTPPRFLKA
FT                   GDTVECEIQHMGLLKNKIK"
FT   gene            522612..523772
FT                   /locus_tag="Amet_0504"
FT   CDS_pept        522612..523772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0504"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   art:Arth_1423 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46731"
FT                   /db_xref="GOA:A6TKL3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL3"
FT                   /protein_id="ABR46731.1"
FT                   /translation="MPSLSKTILNLEESGIREIMNLALGMEDVIRLEIGEPQFDTPEHI
FT                   IEATSQAARDGFTKYTANLGLLSLRETISNHVNNRFNLETSWENVAVSVGGVGAVSSLI
FT                   RVLADAGDELLIPSIAWPNYKMAIDCIDATPVFYKLDPNNDFLPSIENLESLVTPKTKV
FT                   LVINSPSNPLGVVIPQKLIKELVEFAKKHDLFLISDEVYEEIIFEGDHISTLPYDTDGR
FT                   VIGVFSFSKTYAMTGYRLGYAIGNKEIIKEVGKFQEVNVMNACGIAQKAAEAALKGSQD
FT                   CIREMVAVYKDNMEAATRLMDEYEIPYQQPTGAFYLWVNIGCKDATVFAKDFLVQHKVA
FT                   IAPGNTFGPEGSPYIRISLASKKEDILEGIHRLAVMLGKSKLAVNA"
FT   gene            523817..524605
FT                   /locus_tag="Amet_0505"
FT   CDS_pept        523817..524605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0505"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ter:Tery_2821
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46732"
FT                   /db_xref="GOA:A6TKL4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL4"
FT                   /protein_id="ABR46732.1"
FT                   /translation="MSNRIQNELSEGKYVVGPFMKLASPAIVEIMGKAGFDYVIIDCEH
FT                   GPTNMLQAEDMVRAAKLVGISPVIRVSANDPVMISRALDIGADAVQVPQISTKEDAERV
FT                   AKAAKFAPLGERGSCPYVRAAEYSHLDKKEYFKKANEETMVIIHIEGEEGAKNIDEILS
FT                   VEGIDVIFIGPYDLSQSLGVPGEVDHPKVVEMMEMVVEKAKGKGKTVGTFVESPEGAHR
FT                   WIDLGVQYISYAGDTGIIYQACKDIMQQIQSVEAISQDQI"
FT   gene            524670..527090
FT                   /locus_tag="Amet_0506"
FT   CDS_pept        524670..527090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0506"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="TIGRFAM: pyruvate formate-lyase; PFAM: formate
FT                   C-acetyltransferase glycine radical; pyruvate
FT                   formate-lyase, PFL; KEGG: cno:NT01CX_0385 pyruvate
FT                   formate-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46733"
FT                   /db_xref="GOA:A6TKL5"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL5"
FT                   /protein_id="ABR46733.1"
FT                   /translation="MKNVVTYNEKELRRSMTPRIEAMRKEIVHSKPILCSERALLVTEA
FT                   YAETEALPSVTRRAFALKKILGNMTQNIFEGELIVGSHGSNGRRSAPVFPEFSTKWLEE
FT                   ELDEILETRTQDTFIVPKNVKEDLKDIFPYWRGKTIHDRYRAMLPDETKRARDAYMFTR
FT                   GLFEQNGYGHTAYDIPKLLKVGLVGIKSEVNEKMQTLDLTTSEGLEKKLFYEGLIVCCD
FT                   SVIAYAKRYAQRALELADQEKNPVRKKELEKIADVCQWVPENPARDTWDAIQVVAFMQL
FT                   IIQTETNGDSVCPGRLDQYLYSYYKNDMAEGRYTIDEIQELLDCLWIKLNEIIKIQASE
FT                   SVRIHPGFPMTPTVTIGGQTPEGEDATNELSYLMLNSQEHIRLTNPQFTVRFHKDTPED
FT                   FKLRVVEVVKLGTGMPAMFGDEACIAALKRGCPDMPMERIRDYRIVGCVELAPRGFQGR
FT                   VNGGFLNVARVVDLALNNGVDRLTNEQIGPQTGAPEDLKDFDDVLTAVRTQTAYFVKHQ
FT                   VINAAVVDMVQREHTPHLFLSSLVEGCIENGKDMTQGGSLWGGTPILHVGEATAADSLI
FT                   GVKKAVFDDQLISMKELKEILDSNFAGAQGEKIYQALLAMPKYGNDDDYADEVMQKMIN
FT                   IFFDEIEKHKDIDGRFYTSTILTLGATVPHGWTTGATANGRKATMPVADSMSASNGADK
FT                   EGPTAMLLSASKIDQTRTIEGNVVNLKFTKMALEEKKNLQQLVNLVSVYFDDLKGQEIQ
FT                   VNVVDESTLKDAQEYPEKHQDLIIRVAGYSARFTELAKELQDDIIRRTEYNTL"
FT   gene            527125..527901
FT                   /locus_tag="Amet_0507"
FT   CDS_pept        527125..527901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0507"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="TIGRFAM: glycyl-radical enzyme activating protein
FT                   family; PFAM: Radical SAM domain protein; KEGG:
FT                   spd:SPD_0229 glycyl-radical enzyme activating protein
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46734"
FT                   /db_xref="GOA:A6TKL6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL6"
FT                   /protein_id="ABR46734.1"
FT                   /translation="MAESLLEIEGVIYNIQRYSIHDGTGIRTTVFFKGCPLRCLWCANP
FT                   ESQKIEIEEMGERKIGRIATVQEVLDVVSRDKMFYNRSGGGMTLSGGEPLMQPEFASAL
FT                   VKEAKRQDIHTAIETSGYQQWDLLWSVIENIDTVLFDIKTMDAQQHLEVMGTSNQLILE
FT                   NAKRIAKMNKEIILRIPIVPGYNDSWSNMVETVNFAKEIGIKEMHLLPYHQLGESKYKQ
FT                   LDRNYKLKGVRPPSKEKLQDMALKIHRNWKVNVSVI"
FT   gene            527981..528295
FT                   /locus_tag="Amet_0508"
FT   CDS_pept        527981..528295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46735"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL7"
FT                   /protein_id="ABR46735.1"
FT                   /translation="MEVKKGKWVEIHDIILQTSQRAHHLPEDTKQVPLEMRVKGFLLQD
FT                   AKVGERVKIRTLIGRVIEGELTIDNPRHEFDYGEPVPELLTIGTELKSRLFSERWKDHE
FT                   "
FT   gene            528288..529703
FT                   /locus_tag="Amet_0509"
FT   CDS_pept        528288..529703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0509"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein, beta
FT                   subunit; KEGG: tte:TTE1236 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46736"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL8"
FT                   /protein_id="ABR46736.1"
FT                   /translation="MSRAGKSYDEVTQRKNEIMKDALGIDYDRFSIGTIGFDYEKMMEE
FT                   VGYPLEETIRIQRETGVGQTPLVEMKNITKLVRSMSEPGKGATILVKDEAQNPSGSFKA
FT                   RRAALSVYEAQKRGYEGVIAATSGNYGAAVASQAAMRGMKCIVVQETHDSRGVGQPEIL
FT                   EKGRICEALGAEVVQLTVGPELFYQFLVLLEETKFFNASLYSPYGIAGIETLGYEIATE
FT                   VKERYGKEPAAVITTHAGGGNVTGTARGIKKAHCDNTKIIAASVDLSGLHMASDKDFNK
FT                   KSFTTGHTGFGMPFMTWPDRSDVPKNAARPLRYIDRYVTMTQGEVFYACEMLAQLEGIE
FT                   RGPAGSISLAAAIAIAKELNDDEVIVVQETEYTGAGKHPTAQLTFATKQGIEVRRGNPE
FT                   EGIPGKSVVIPEKPEQMSVKDYDIDKLRTSYLKNALKDVDIKTLIKEDIDYLAEEIRKD
FT                   SSFVKEYIEKMGS"
FT   gene            529743..531092
FT                   /locus_tag="Amet_0510"
FT   CDS_pept        529743..531092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0510"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: pfu:PF1232
FT                   4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46737"
FT                   /db_xref="GOA:A6TKL9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKL9"
FT                   /protein_id="ABR46737.1"
FT                   /translation="MNDIIKGLEVIQKDDELISLGTRIAFYPLAIKEAKGAILMDYDGN
FT                   EIIDFLSAACVSNVGHSHPRVVNAIIEQTKKFIHYNPAYAVHEQMGNLAEELIRITPGD
FT                   FPKRVAFSLSGGDANDNAIKVARSYTKRTKVISYFRAYHGTTYGALSLSAVSLPMRRDL
FT                   GPFVPDVYHIPYPDCYRCNRKSPDSGCNMDCMEKLKELFNTVVPAEEVAAIFLEPFQGD
FT                   SGVIEPPAEYIEELVKVCKDNGILLVVDEVQSGFGRTGKWFASEHYNLEPDIIVLGKSI
FT                   ASGMPLAALVARKEILEGWGAPAGSYSTAGNPICCAAALATIDIIEEEGLVKKAEELGN
FT                   YTIKRFEEMKEKHPLIGDIRGKGLMIGVDLVKDRGTKERAKDETAKVSYRCWEKGLFIT
FT                   FFSGNVLRIAPPLTISKKELDKALDIIEEALCDVEAGRVPDEILESVKGW"
FT   gene            complement(531217..533358)
FT                   /locus_tag="Amet_0511"
FT   CDS_pept        complement(531217..533358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0511"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: ThiJ/PfpI domain protein; Catalase domain
FT                   protein; KEGG: bha:BH1980 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46738"
FT                   /db_xref="GOA:A6TKM0"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM0"
FT                   /protein_id="ABR46738.1"
FT                   /translation="MNTGPQQPQNTMEQNSKNEKLDLHRVDHNNELLTTNQGGRVSNTD
FT                   DSLKAGARGPTLMEDFHFREKMTHFDHERIPERVVHARGFGVHGYFQVYEPMAELTKAK
FT                   FLQDPTKKTPVFVRFSTVVGSKGSADTVRDVRGFATKFYTEDGNYDLVSNNIPVFFIQD
FT                   AIKFPDVVHAIKPEPHNEIPQASAAHDTFWDFVVNTPETAHMIMWLLSDRAIPRSFRMM
FT                   EGFGVNTFRFVNEQGKARFVKFHWKPLLGVHSLVWDEAQKLAGKDPDYHRRDLWDAIDM
FT                   GEYPEYELGVQIVEEEEEFNFDFDILDATKIWPEEMIPVKRIGKMTLDNNVANFFAETE
FT                   QVAFHPGHVVPGIDFSNDPLLQGRLFSYLDTQLIRLGGPNFHEIPINRPMAPIHNNQRD
FT                   GYHRMTIDRGRVSYSPNSLQNDAPHPAPEADHGYVHHAEKVEGQKVRERSESFRDHYRQ
FT                   ATLFWNSMSSAEKQHIIEAFHFEVGSVMDKQIKQRVVNMFNNVDGQLATQIAVGVGADS
FT                   PAALGGNGVTATSPAVSQENTVKDARTRKVAILLENGFNYPEVTQVMSAFNGAGVHTEI
FT                   VSKNLGMLTSVDGQQLEVGKNYATTASIKYDAVYVPGGPQSINSLMMQGDALHFVNEAF
FT                   KHAKAIGATNEGVDLLMASAIQGVNMAGGNTQDQLITEMGVVTVRNVTDTNQFSQEFTN
FT                   AIAQHRHWSRQNKKQMIPA"
FT   gene            complement(533508..534623)
FT                   /locus_tag="Amet_0512"
FT   CDS_pept        complement(533508..534623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0512"
FT                   /product="spore germination B3 GerAC family protein"
FT                   /note="PFAM: spore germination B3 GerAC family protein;
FT                   KEGG: bha:BH2186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46739"
FT                   /db_xref="GOA:A6TKM1"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM1"
FT                   /protein_id="ABR46739.1"
FT                   /translation="MKKVIKLLIVLLLISSLSACWDARDLEELLIVFGLGIDMSEENPE
FT                   NYFFTIGFPTIIEEAPEQKSEFSTEAPSLGKGKSNLQQKVYRAISYDNVKIVVLGEEAA
FT                   RQGIIQHVDSMLREPLFRGTTRFAVVKDRAADLFELQPPVALFVSTFIFDSIQQNYENT
FT                   TVPITTLRNFSNQYYTIGIEPAMPFICYGADRTELNVGCVALFRGDKMIHRLQGHDSKA
FT                   FMLLIDEIHGGLYTFDYIPEGTEKGEFISITLKGGRSKIKTKLIDSQLYIYHDISINGN
FT                   LGEYTASEHIMTEEKIEETENYLAGEVKKHLQSTVEILQYELQNDNVGYGKYVKANHPE
FT                   FFNGENWNHQFSEAVIHVNPSVRIRTVGISP"
FT   sig_peptide     complement(534564..534623)
FT                   /locus_tag="Amet_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.990 at
FT                   residue 20"
FT   gene            complement(534644..535759)
FT                   /locus_tag="Amet_0513"
FT   CDS_pept        complement(534644..535759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0513"
FT                   /product="spore germination protein"
FT                   /note="TIGRFAM: spore germination protein; PFAM: Spore
FT                   germination protein; KEGG: bcz:BCZK2852 spore germination
FT                   protein; possible amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46740"
FT                   /db_xref="GOA:A6TKM2"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM2"
FT                   /protein_id="ABR46740.1"
FT                   /translation="MYQKHKNGEITAIQSAIFLISIMIGTGILGLARSVAEVSNQDAWI
FT                   SVFINGLFISFVVMIIVYTVSKFPQHNFLQYNCYLLSKPLGYFVTLCYVIYAILVTAII
FT                   TTFLTEMVYTWLLPNTPMTVIKLMIVITMVYMTRNGITTLARFTESIAFLLIPFAFLIF
FT                   VGLPEASFINLRPIGGSGLSSIFKGTIPSFFAFAGYESLLVYYPYISNKQKPIMKYSIS
FT                   AIMIVTIFYTAVVMSQIALYGSDEIAVVLYPSINYLTAIDFPIIERTEIFFTIFWIFTV
FT                   LATIGIQYLVAGILLQNIFQTKTTNIFVYALSPVIFLLSLYPKNTAVVVSLGEKIGQLN
FT                   IFFGFLFPFLLLIMYLIKGKDNRHNKENRTG"
FT   gene            complement(535778..537331)
FT                   /locus_tag="Amet_0514"
FT   CDS_pept        complement(535778..537331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0514"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   bcz:pE33L466_0139 spore germination protein KA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46741"
FT                   /db_xref="GOA:A6TKM3"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM3"
FT                   /protein_id="ABR46741.1"
FT                   /translation="MNFLNRFFKNKKESKTEIKISDEVHIPLHISKSVNINRENLEKAF
FT                   ENCDDLTYRTVKLQDHEKTIEVLLIYLNNLVDLKDINQNIIKPLNSYDASNNVQSRDEK
FT                   ININTIEEIINTHDIQRINNMKYAMEGILSGDTLLLMDHDVDGLLLRTQGGEIRSIEES
FT                   DVESVIRGPRDSFIENVHVNIGLIRKKIKSPSLKVKQLIIGSESHTIVCVCYMENIVNQ
FT                   QALSNIMNKLKEIKIDGIFESGYIEQYLEGSPYSPFPQMQITERPDKVCGNLLEGKIII
FT                   LVDGSPVSLILPISFFQLFQSPEDYYERVLFGNFTRLLRFLGFFIATSLPSIYVALISF
FT                   HQEMLPMDLIIDLSRSRAQVPFPPVIEAILMEVTIELLRESSARLPGTIGQTIGIVGAI
FT                   VIGDAAIQANIVSPVMIIVVAVTALGSYVLPHYSSTYPLRMIRFPIILMAATFGAFGII
FT                   IAWTWIIIHLCSIDSFGYPYLSPLAPLDPNIKKDALIRGTLWGFRKRPQTANKGNRSRW
FT                   "
FT   gene            537610..538482
FT                   /locus_tag="Amet_0515"
FT   CDS_pept        537610..538482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0515"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; SMART: extracellular
FT                   solute-binding protein, family 3; KEGG: fnu:FN1135
FT                   phosphonates-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46742"
FT                   /db_xref="GOA:A6TKM4"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM4"
FT                   /protein_id="ABR46742.1"
FT                   /translation="MNKKLMIILMIVLISAVAGCTSAKEETIRMGFVPMMDGDKLIESV
FT                   EPLAEMLSEEIGVKVEAFTATNYVGVVEGLGSGQVDFGFIPPFAYVLANSESNAQVVLT
FT                   ALNSSGESSYRSQFLVRSDSDINDFQDIHNKTVAFVDPSSTSGYLFPGAHLMAEGVELE
FT                   QDIEYIYSGGHDKALQLLLNGDVDVATTFVDVRQRYEKDFPNAMEQTRVLGYTNDIPNI
FT                   SVTVKGSMDADMQEKIKNALLTIAEDEEGSALLKELFNMYGFVEATDEDYNIIRETAKS
FT                   MNVDLQEAN"
FT   sig_peptide     537610..537681
FT                   /locus_tag="Amet_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 24"
FT   gene            538494..539240
FT                   /locus_tag="Amet_0516"
FT   CDS_pept        538494..539240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0516"
FT                   /product="phosphonate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ser:SERP2285 phosphonate ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46743"
FT                   /db_xref="GOA:A6TKM5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM5"
FT                   /protein_id="ABR46743.1"
FT                   /translation="MIKLENVSVLYNKKNLAVDDISLDVERGQFVGVIGLSGSGKSSLL
FT                   KTVNLLVRPSKGNVYIQGTDIGLLRNDKLRDIRREIGFVFQDFNLVERSSVLENVLVGR
FT                   LGYKSSLKSFFGLFDDTDYEIAVDALEQIGLKDKMFARTDQLSGGQKQRVAIAKTLCQK
FT                   PKIILADEPVSSLDLSSAQVVMDYFKQINEKSQITIMINLHDVNLAKKYCSRIVALKDG
FT                   KIFFDKEVGEIDDRELQELYEKNQQV"
FT   gene            539218..540834
FT                   /locus_tag="Amet_0517"
FT   CDS_pept        539218..540834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0517"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fnu:FN1137 phosphonates
FT                   transport system permease protein phnE"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46744"
FT                   /db_xref="GOA:A6TKM6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM6"
FT                   /protein_id="ABR46744.1"
FT                   /translation="MRKTSRYKKHISKTNKYKEYMSHKRKKIYIFLGLAIFALTFFCVM
FT                   IDFSFLRIYQGIPSMYNLVERMLSPNLSYTQEVFSKLLETIEIAVTSSFVGVLLAMPFA
FT                   LLTAGNITPSRHVAMILNRFFAFLRTIPNLIWAALLVSVFSIGQFSGIVALTITGFLIA
FT                   LKLFRENIETINENLLNSTKSVGANQIQVLRYCVLPTILELAASVFFMVLEINIRSATV
FT                   LGLVGAGGIGQIMWRDLNHLRYDNLATLVLILLLTIGTIDALSFIVRRYIKRSFILHQS
FT                   IESYKRAPQKRILQLILLSIVLGFWIMNAIDINYARLIMGLEQGYLMISRMIRFEWAYV
FT                   PRLLEGIRESFFIAIFATMTGAIGALFLSFFTAYNTAPLKVTSFLTKGMVNLLRTFPPI
FT                   VTAIIFFRGVGPGPLAGAMALSIYTTGVLTKLYSEVIENSHENIKNSILVTGSTNLNAF
FT                   RYGILPETLPAFISLVLYRLESNIRTSTILGIIGAGGIGTILSMNITWRNWERVGLLIL
FT                   GISIMIMSIDVLSYYLRKRLV"
FT   sig_peptide     539218..539367
FT                   /locus_tag="Amet_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.637 at
FT                   residue 50"
FT   gene            complement(540894..541781)
FT                   /locus_tag="Amet_0518"
FT   CDS_pept        complement(540894..541781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0518"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   chy:CHY_0168 cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46745"
FT                   /db_xref="GOA:A6TKM7"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM7"
FT                   /protein_id="ABR46745.1"
FT                   /translation="MKNILYNTGYFFKEAKTIIRLDLLSNVFSLFSTGLIFFILSMVIS
FT                   GWWISTEVMEVIQGESEINIYFDESMNSDNSLQLVEMIQGINGVREARIVDASEAYDRM
FT                   ESILGQEAEVLSFFDDNPFSPFIEAKIYLEEIDPVLGELNQIPEVSHVRDNREVLDRLS
FT                   SLASILSILGYLVVAAVGISTLVIISHIIRQGIYSNRDQINTLRLLGAPELFIALPFLL
FT                   GGLLLTLGGGLLASMMSAAALKQVYAQMSGPLPFIPLPPRDILMSNLVILIMSLSASLG
FT                   LMGSLLGLSSSKNH"
FT   gene            complement(541783..542457)
FT                   /locus_tag="Amet_0519"
FT   CDS_pept        complement(541783..542457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0519"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dsy:DSY4865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46746"
FT                   /db_xref="GOA:A6TKM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM8"
FT                   /protein_id="ABR46746.1"
FT                   /translation="MIEAKGVYLTYPDGTMALHNIDLQVQPGEILYITGPSGSGKTSLL
FT                   KLLLGIEYPTGGSLRVLEQPMSKEEATNIRRLRMVLGPVFQEFRLIKGRTAMENVMLGM
FT                   RFLGLPHHQIKKDAHDALVKVGLEHKKFAPVENLSWGEGQRVAIARAVARKPALILADE
FT                   PTGNLDKDNALNILSLLNSFRDEKTAVVITTHATHLIEEIDDGKFIQMEAGGICGERMG
FT                   AT"
FT   gene            complement(542484..543605)
FT                   /locus_tag="Amet_0520"
FT   CDS_pept        complement(542484..543605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0520"
FT                   /product="Membrane-bound metallopeptidase-like protein"
FT                   /note="KEGG: sth:STH2334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46747"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKM9"
FT                   /protein_id="ABR46747.1"
FT                   /translation="MFKTKKTRVIMSFSFAILFTLLFLPLSMATEQADPFSEIQENLTG
FT                   ISQEERQIIENLFILVQEIEEMENEETELLLDLSVIEGELKVLENLTRNEELAYEERRD
FT                   VLKHVLKSYQRRGPGSYLEIVLSSDSLSALLRRLNTLRDLTRNTGALLDELAESKEKLS
FT                   IEKSKLTEKAMLVEAKQQELQQSIARNLQLQVEQEAYLASLEDQREYYQEHLSNIQSVW
FT                   DELKLIFSASTKEFSRIIGEGNLPTDAMEISFTSLGIKGTIDEDVINALISEYLDVEEL
FT                   RFNFHPGMVQLKMPNQHLVLTGTFVIENGHTLKFVAEEGSFYGILLTSSAVKELFKEGA
FT                   LVLNLKPLLFGNTLRSVEVQEGSLELLSRLRLF"
FT   sig_peptide     complement(543516..543605)
FT                   /locus_tag="Amet_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.796 at
FT                   residue 30"
FT   gene            544144..546024
FT                   /locus_tag="Amet_0521"
FT   CDS_pept        544144..546024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0521"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; KEGG: bsu:BG11359
FT                   class III heat-shock protein (chaperone)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46748"
FT                   /db_xref="GOA:A6TKN0"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKN0"
FT                   /protein_id="ABR46748.1"
FT                   /translation="MIKKEFKAESKRLLDLMINSIYTHKEIFLRELISNSSDAIDKIYY
FT                   KALTDESMIFNKEDYYIKITTDKENKMLIISDMGIGMTKEELEENLGVIAQSGSFTFKK
FT                   ENEIKDGFDIIGQFGVGFYSAFMVADSVTVISKALGSDQGYKWESIGAEGYTIEPYEKE
FT                   SVGTEIILKLKENTEDEKYEDYLEAYRLKTIIKKYSDFIRYPIKMDIETSKPKEGAEGE
FT                   YEEIVEEQVVNSMVPMWRRNKNELTKEDYDLFYSEKHYGFDKPLKHIHISADGAVRYNA
FT                   ILFIPEKIPYDFYTKEYEKGLELYSSGVLIMNKCSDLLPDYFSFVKGMVDSEDLSLNIS
FT                   REMLQHDRQLKIIAKKIKEKIKSELELLLKNERERYEEFYDSFGRQIKYGVYSDFGQNK
FT                   ETLKDLLLFYSSKEKKMVTLDEYVGRMKEDQKYIYYASGDSIEKIDKMPQTELLAEQGY
FT                   EILYFADDVDEFAIRVLVDYKEKEFKSVSSGDLGIEEKDEKEEQEEQTQGSKEVFAFMK
FT                   EALSQKVKDVRPSKRLKNHPVCLATDGDVTIEMEKILSAMPNNQEIKAERVLEININHD
FT                   VFKTLKEAFDNDQEKLKIYTNVLYNQALLIEGLTINDPVEFTNDICKLMS"
FT   misc_binding    546231..546413
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 103.64"
FT   gene            546504..547139
FT                   /locus_tag="Amet_0522"
FT   CDS_pept        546504..547139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmn:PMN2A_1035 ABC-type metal ion transport
FT                   system periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46749"
FT                   /db_xref="GOA:A6TKN1"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN1"
FT                   /protein_id="ABR46749.1"
FT                   /translation="MYSIETKYIAFYCLHIHSKCGLLFIKMSSYTIFTIYYHKRSRCVV
FT                   KKKLSILFGVALLMLVLVACGSNEEEVNTAEDDGHEIPYEWSGVYTFEEDTYTLKFNKN
FT                   EGDESCMIAFISKESGITDIEHHAIHIMEADMEDIAADSHFVAKDEYGYNLILNPDTSN
FT                   FTIDMEKSGEYFLFVEHFPEEFDLQVLDSSGNELMAKDMVEYEGDHQH"
FT   gene            547161..547832
FT                   /locus_tag="Amet_0523"
FT   CDS_pept        547161..547832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0523"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: tde:TDE2131 cobalamin biosynthesis protein
FT                   CbiM, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46750"
FT                   /db_xref="GOA:A6TKN2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN2"
FT                   /protein_id="ABR46750.1"
FT                   /translation="MLARASKVILKGIFELEVIQVHLSDGVLNLPMAVTTSIAAGGVMI
FT                   YAIKGIKEEEIPKISLMTAAFFTFALISIPIGPSSVHPLLAGLLGIMLGRRSPIAIFIG
FT                   LLLQAIIFQHGGLTTLGVNTLLVALPALASYKLYSKLTCNKKSPAIWAGFIGGFAVFTC
FT                   VSLLILVLFMTDSRYSEGFFSVVNVLAVGYLPLIAMEAILTGFIISFIYRIRPHILETT
FT                   S"
FT   gene            547861..548622
FT                   /locus_tag="Amet_0524"
FT   CDS_pept        547861..548622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0524"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: mla:Mlab_1390
FT                   excinuclease ABC, C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46751"
FT                   /db_xref="GOA:A6TKN3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN3"
FT                   /protein_id="ABR46751.1"
FT                   /translation="MVSTKPTKRTDYHNGHEKLISWGRNWETRTKIMTCFMTAFGLIGL
FT                   DKLSLLIFSFSLLLLIVISMGFSIKYILSKLVLLLPFLALMSVPLIIGPGFPVTNDRFV
FT                   FPLILTLKALSVSLLMFIMILSQPLQQFLNALSHMHLPPFFISILFLSWRYTFVLWDTL
FT                   KNTQSALVSRLFNTSFRKRTFKTYGEVMGGILIKSIDRSEKLYRAMIARGFSGRISSSK
FT                   PQSITRWDIIKSFLFVGVIISLNIIEKWWFV"
FT   gene            548619..549431
FT                   /locus_tag="Amet_0525"
FT   CDS_pept        548619..549431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0525"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   chy:CHY_1630 cobalt ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46752"
FT                   /db_xref="GOA:A6TKN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN4"
FT                   /protein_id="ABR46752.1"
FT                   /translation="MKAIMIEGLRYNYPDGTLAIDNISLTIEKQKKIAFLGANGSGKST
FT                   LLHHLNGLIIPQEGSIKIMGNVINKKNIREIRKAVGMVFDNPEDQLFSTTVYDDVAFGP
FT                   RNLGYDEDAVHDCVNKALSLVGAKELQQRPPYNLSLGQKKKVSIAGILAMNPEIMVLDE
FT                   PFSGLDPYSLEQLLCILERLYKEGNTLIISTHDVDLAYSWADECVILRDGKLLAHGSTQ
FT                   LLEDKSLMEKAKLQVPNLYSIFKDTPLRPKNSEEGRALLGKLLEKQSR"
FT   gene            549493..549930
FT                   /locus_tag="Amet_0526"
FT   CDS_pept        549493..549930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46753"
FT                   /db_xref="GOA:A6TKN5"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN5"
FT                   /protein_id="ABR46753.1"
FT                   /translation="MKRISIICMIILLFAFTVSPVYAHKMLIEPIEDGVIKVNYEDGSV
FT                   SSRTEVVVYDSNGAEILTGSLDENGYFYYDTDLDATRIVADDGLGHRVEWQVGDPAVYS
FT                   NHGSKWKKISLVVAIFVVIGSVFFLRNKKAKEKELLGTPRD"
FT   sig_peptide     549493..549564
FT                   /locus_tag="Amet_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            complement(550244..551284)
FT                   /locus_tag="Amet_0527"
FT   CDS_pept        complement(550244..551284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0527"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: swo:Swol_1894 HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46754"
FT                   /db_xref="GOA:A6TKN6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN6"
FT                   /protein_id="ABR46754.1"
FT                   /translation="MPIIPTTHLTPGARTSRDIVAKNGTKLLSSGTVLSQYIIQYLNRW
FT                   QIKSVYIQEESIEIVSTRKRNQQQSTQLYESTIAATEGIMVRFKGISRLKLKEIRKIID
FT                   DISSFSDISLTLDAITQINNQSKYTYHHSVNVAIYCSFIGKSLKLEDALLKKLIYAGFL
FT                   HDIGKTQISPSILSKPGKLNDQEFQEIKSHPIYGYHLVRENTLFSHDIALGVLQHHERE
FT                   DGKGYPLGINGEQIHLFGKIIAVADIFDAMTSTRPYKGKQSALKIAEELMNDYFGVLDQ
FT                   KIVRTFVSKLSDFYIGSRVILENGDVGEIIAKNPDSPMKPLIKIGNRFIDLSVTPSMKI
FT                   LDILVF"
FT   gene            551514..552341
FT                   /locus_tag="Amet_0528"
FT   CDS_pept        551514..552341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0528"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   chy:CHY_1566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46755"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN7"
FT                   /protein_id="ABR46755.1"
FT                   /translation="MNTKEIMDIALELAGLNEIPADSGIIVEGEHIKKVAIGVDMELAE
FT                   MLLARDLGVDLVITHHPSGGSPRINLHKVMDNQIDSMIRAGVPINKAQKALKEKKDEIE
FT                   RGLHVSNYDRAVSAAKLLKMPFMGIHTPTDILAERKVQGLLDEKLKEQPKATLQDIIKA
FT                   LETLPEYQRTMAKPAVRVGAKDDYAGKTFVTMAGGTGGGKNVIKAYFEAGVGTLVAMHM
FT                   PEDVIKSVREQNIGNVVVAGHMASDSVGINEFAKALEEKGIEVIRMSGLIDPT"
FT   gene            552516..553244
FT                   /locus_tag="Amet_0529"
FT   CDS_pept        552516..553244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0529"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: sus:Acid_5580 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46756"
FT                   /db_xref="GOA:A6TKN8"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN8"
FT                   /protein_id="ABR46756.1"
FT                   /translation="MEMSFLKSRWIVGVLIIFLGVIALLNNFGFTELRLSDMISTYWPI
FT                   LLVLWGIDALISRGSKGEVVSGLILVFLGVTFIGRNLDLFYLDLSLFWNLFWPVIIILV
FT                   GVSFLKGSNKVKKSNMAIMGGIERKRDRWDLESSSYFALMGGVELDLTLANIPDEEVIL
FT                   DLTAIMGGIDIWVPDNIQVICEGTSILGGIELLDRATGGIVASTKASQNGDGESKKCIK
FT                   IYSRAIMGGISVQSKKNIAI"
FT   gene            553418..553774
FT                   /locus_tag="Amet_0530"
FT   CDS_pept        553418..553774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0530"
FT                   /product="Peptidase M15A"
FT                   /note="PFAM: protein of unknown function DUF882; Peptidase
FT                   M15A; KEGG: mma:MM3062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46757"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKN9"
FT                   /protein_id="ABR46757.1"
FT                   /translation="MNNIQISKNFKLKEFQCGDGGYQVRLDSQVLKKLQELREQTGRPV
FT                   LINSGYRTPSYNQQVGGSPRSQHLLGKAADIMVPGMELESLARVAEGIGFGGIGIYRTF
FT                   IHVDVRSEKVRWKG"
FT   gene            553838..554464
FT                   /locus_tag="Amet_0531"
FT   CDS_pept        553838..554464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0531"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: gka:GK1466
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46758"
FT                   /db_xref="GOA:A6TKP0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP0"
FT                   /protein_id="ABR46758.1"
FT                   /translation="MLNLYIVRHGETEWNTQRRMQGWQDSNLTERGIEDARALHDHLIK
FT                   VEFDSIYASPSSRAFKTAELIKGERKLKIIKDDNIREIGLGNWEGKTTEEIEQMDPKAY
FT                   QHFWKAPHLYNRESVETFTCVQKRALKTINKLIEEESAGNILIVTHAVTVKTIMGHFQK
FT                   QSLEKLWEPPFIQNTSVSLIRIENNLPSIVLYGDTSHLQEAYETY"
FT   gene            complement(554573..554884)
FT                   /locus_tag="Amet_0532"
FT   CDS_pept        complement(554573..554884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0532"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   cno:NT01CX_0170 hypothetical UPF0145 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46759"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKP1"
FT                   /protein_id="ABR46759.1"
FT                   /translation="MILVNTDYISKKELETLTIVKGSTIQSKHLGKDILSGFKTLVGGE
FT                   LTAYSDMMNEARAIATKRMVAEAQGVGADAIINIRYASSAVMGGAAEIMVYGTAVKFV"
FT   gene            complement(554865..555104)
FT                   /locus_tag="Amet_0533"
FT   CDS_pept        complement(554865..555104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46760"
FT                   /db_xref="GOA:A6TKP2"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP2"
FT                   /protein_id="ABR46760.1"
FT                   /translation="MRRDFMKYIAPILIIILIAGLIGLYGFGVLFVLDSMNAPLLITII
FT                   ISIVFVGLIASLGYTLIQRIKEIRKEDDDDLSKY"
FT   gene            complement(555108..555374)
FT                   /locus_tag="Amet_0534"
FT   CDS_pept        complement(555108..555374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB2607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46761"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP3"
FT                   /protein_id="ABR46761.1"
FT                   /translation="MPYFVAILEILDPEKDAQILDIHKAYLQKYIAEGKIFAKGPFTDH
FT                   TGGLIIYQTNSYEEAKTLAENDPVIKENTRKMIFKQWKSTLPE"
FT   gene            555525..556361
FT                   /locus_tag="Amet_0535"
FT   CDS_pept        555525..556361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46762"
FT                   /db_xref="InterPro:IPR018911"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP4"
FT                   /protein_id="ABR46762.1"
FT                   /translation="MKKILFLIISALLIFALLGCAQESEPPPPEEPIEEEDVIDNGESE
FT                   EVVPDEAHTIEDNLKDDIEIFGEEEVLEEAGEWFAQFDEAEEGAYVYQHPDMTYIKINA
FT                   GERRTGGYGIHVKDYDEDAYPRLVTIEIREPGEDEMVTQALTYPSIILGIESEMASQYE
FT                   VQTVDGNVFDLEDKLVFAKFEMPEADEEIDNPVPVKGKIIAFEGAFVLRILDDEEELIH
FT                   EEHLQADTGGPNWGSFDEEIEYPEPETQGGSLEIGEYSAKDGEYIMREKISVKFNK"
FT   sig_peptide     555525..555590
FT                   /locus_tag="Amet_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.732 at
FT                   residue 22"
FT   gene            556434..556637
FT                   /locus_tag="Amet_0536"
FT   CDS_pept        556434..556637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46763"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP5"
FT                   /protein_id="ABR46763.1"
FT                   /translation="MKKNQPKRAMDENFFKEMNYELAGDIGAIDNEDMVNNRKLKSNQT
FT                   EKNNEKEKEKIKNRVKIPDSCD"
FT   gene            556954..557577
FT                   /locus_tag="Amet_0537"
FT   CDS_pept        556954..557577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0537"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcl:ABC2499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46764"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP6"
FT                   /protein_id="ABR46764.1"
FT                   /translation="MKFEKIVVGIEEANGYIFYDENSLEAVVIDPGDEAKTFMKYIDKR
FT                   YLKPIGIILTHYHYDHIAAAEALKKKYQCPINAHKKEIDGLKDPEINYSKREYAKEVSI
FT                   TPDVLLSHGDTISVGALQLEVIHTPGHTPGSICLAVKDEKVIFTGDTVFSDALGRTDLA
FT                   GGSEAMLRKTIRNKVSKWDDDVRVYPGHGESALMAQLRSRREIK"
FT   gene            complement(557742..559028)
FT                   /locus_tag="Amet_0538"
FT   CDS_pept        complement(557742..559028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46765"
FT                   /db_xref="GOA:A6TKP7"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP7"
FT                   /protein_id="ABR46765.1"
FT                   /translation="MKTVEMKYGTGSTNVSIPAEHLLSIIKNNPMNINGTEEEIILNSL
FT                   EKPVGTPKLREIVHPGEKICIVFSDITRAWQKMSTFIPYIVAELNQAGIKDEDILFISS
FT                   TGSHRGHTKEEHSWLLGADITSRCEIIDHDCLNEENLVYLGTTSFGTPVSVNKRAMECD
FT                   HIVLTGAIVFHLLAGWGGGKKSVLPGICSYNTIMTNHALSLSPNVGEGSNPLVRSGNWV
FT                   DNPLHEDMLEASSFVNPSFMLNVIVGADGSICHAVSGHYVKAHEAGCQVVQEMDGVEIQ
FT                   EKADLVIASAGGYPKDINLYQTSKTLINAKEAVKDGGTIIILSQCIEGFGNDHVQEIIQ
FT                   NYDTVVERENALREDFSIAKYIGYFVSEAAERFNLILVSEMEQSLVERANIRVVKTIEE
FT                   ALTLTYKEMGKNLKTHLMPQGANTLPQVK"
FT   gene            559368..560537
FT                   /locus_tag="Amet_0539"
FT   CDS_pept        559368..560537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0539"
FT                   /product="Uncharacterized membrane protein"
FT                   /note="KEGG: sal:Sala_1461 uncharacterized membrane
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46766"
FT                   /db_xref="GOA:A6TKP8"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP8"
FT                   /protein_id="ABR46766.1"
FT                   /translation="MKRNPMDFMPAYFTVAFVWFTTHFGGGFASGRQLVEFFVQYGWYA
FT                   LFTPVIAIAINALVFYYAWDFSVAHQKFQYRSWTDAFYKPYERVFSNLYDVVFNLVLVV
FT                   ATAVAFATGGATLADVLGTPYLLNTLVIAIIMFILTIYGANIVRAAASWIAVIVITGLL
FT                   FIYGSNLVVTLPNLMTVLNEAPAPRGFWYALWQSIKYAGLQAALLGGYVAVTDVLKNKQ
FT                   DVKRAAICGFILNAGIMVLASAVVLSYYPTIISEAVPVVFIIRNGFGGVALELLVSLLI
FT                   FLGVISTGVNLIYGGSKRIVSVWAKPEEGEKSIKNKRIIASGIYVFITWSIALMGLIPL
FT                   VAIGYSYVAYLALPIVVIPVLYKGITKRGGEKGKSNELDAMTAADGPKA"
FT   gene            complement(560690..561643)
FT                   /locus_tag="Amet_0540"
FT   CDS_pept        complement(560690..561643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0540"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein, beta
FT                   subunit; KEGG: tac:Ta0113 probable threonine dehydratase,
FT                   biodegradative"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46767"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKP9"
FT                   /protein_id="ABR46767.1"
FT                   /translation="MISVQDILNARERIQDYITVTPLDFSMGLSTKTMKIYLKLECQQK
FT                   MKSFKTRGVLSKMTSLTNEEKKKGVTTISSGNHGAGMSYASSLLDIQRVKIFVPETTPL
FT                   AKVKKINYYGAEVVQVGRHYDETHKIAMEIIQEEKLTFIDSCSDTMVIAGQGTIGLEIL
FT                   EQNPDIDVIVVPIGGGGIITGISIAAKHINPNIQVIGVQPTACPAMVKSLEDKTCYLEY
FT                   PSEESLCDALVGGVGEIPYKMAAQCIDDIIVVDEVTIKQATAMLLTEEKVVAEPSSATG
FT                   VAAIMLRQELFEGKNVAIVITGGNLDPALMKRLLTE"
FT   gene            complement(561785..562747)
FT                   /locus_tag="Amet_0541"
FT   CDS_pept        complement(561785..562747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0541"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   Peptidoglycan-binding LysM; KEGG: tte:TTE2219 LysM-repeat
FT                   proteins and domains"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46768"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ0"
FT                   /protein_id="ABR46768.1"
FT                   /translation="MYYSQAPCPTGTISYTIQSGDTFYAIARAYNISLDVLLAANPGVN
FT                   PDRLMVGQRICIPISTPPSTGCPVGTVPYTIRAGDTFYSIATTNNIPLDALLTANPGVN
FT                   PDRLMVGQVICVPRNTPPPTTACPTLRVGSRGPDVERLQRLLRDNGYDPGPIDGIFGTR
FT                   TQLAVIAFQRDLNIVADGIVGPRTWTGLGVDCTAPPVPPTPPSPTCPTGTTPHTIVAGD
FT                   TFYNLAIQYNTTVDAIRRANPNVNPDNLQVGQRICIPVTTPPSPTCPTGTAPHTIELRD
FT                   SFYNLAIQYNTTVEAIRRANPNVDPQNLIIGQIICIPLP"
FT   gene            563103..565271
FT                   /locus_tag="Amet_0542"
FT   CDS_pept        563103..565271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0542"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: Peptidoglycan-binding LysM;
FT                   metallophosphoesterase; 5'-Nucleotidase domain protein;
FT                   KEGG: bld:BLi00814 similar to 2',3'-cyclic-nucleotide
FT                   2'-phosphodiesterase; RBL02320"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46769"
FT                   /db_xref="GOA:A6TKQ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ1"
FT                   /protein_id="ABR46769.1"
FT                   /translation="MLQKGKRTCKKAFSRTTIMVLAFVLIFALVAVPQVSAAEKVVHEL
FT                   VIMGTTDIHSYIMPYDYLKDAEAPKIGLSKTATLVDQKRVQHANTLLFDAGDAIQGSML
FT                   AYLEAVVEPLKEGEVHSTINAMNIMEYDGAVIGNHEFDFGLDFLQRAHEDAQFPIVSAN
FT                   IYKVGTDETYFTPYVILDREVDGKAIKVGVIGFVPPQVTTWSKLHLEGKVEAREIVETA
FT                   EKFIPMMREDGADLIIAVGHTGIDISENASENVGYQLSQVEGIDAMILGHQHRLFPSET
FT                   YADMEGIDVEKGLINGVPTIMPGSWGNHLGLIKLELVHRDGVWEVIDSQSIVEGVEEVE
FT                   AKPSIVEFVKERHTATIEYVNGAVGRTVANLNTFFGRVMDNKVTKLVNDAQLWYANNFF
FT                   KGTEYEDANLISSTAPFKMGRQGPTYFTNVEAGGIAIKDVADIYIYDNTLHVVKVNGEE
FT                   LLQWIETAADNFEQIDPSKTEDQVLLDYAFAGYNFDVFTDIEYQIDVTQPSGSRVVNLS
FT                   YEGEPVTAEMEFVVVTNNYRATGGGDHLKGAEIILSSTDENRNIIIDYIREMGEADPQE
FT                   ENNWSILPIETAGRLIFRSSLLGKDYIESEGLTNVSYIGEEEGWGLYTYNFPPVVATEE
FT                   VIEPEVIQEEVVEVEVTIPEVVQEVVEESATLSETARVHVVQSGDNLWNIARKHYGSGT
FT                   YYYQILEVNQEIINQAALIYPGQQLMLP"
FT   sig_peptide     563103..563216
FT                   /locus_tag="Amet_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 38"
FT   gene            complement(565341..566498)
FT                   /locus_tag="Amet_0543"
FT   CDS_pept        complement(565341..566498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0543"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: cac:CAC2436
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46770"
FT                   /db_xref="GOA:A6TKQ2"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ2"
FT                   /protein_id="ABR46770.1"
FT                   /translation="MRSLKQFFTIFFVIIFFLSTPMVSWANTDAPLQPLSEVVRGRIIS
FT                   IETPEVDEEKHGSFTTDVQSVLVQVTQGEFRDSEITIDHTLSGNMARDFYYQEGDRVLL
FT                   WIESTNGEMSRAYIREVTRDHYLMYLTLFFIFSLLLIGGKKGAKAIITLCITGLLVIKV
FT                   LLPLILEGFNPTIVTIVIASIIVSSTLIIISGFNRKTYAAIIGTIGGVIIAGILASTMT
FT                   SLTRLTGLSNNEAQTLMYLPQGTRFNFQGLLFSGMIIGAMGAVLDVGMSISSSMDEISR
FT                   ANPSLTTKELIGSGLNIGRDIMGTMSNTLILAYTGASMHLLLVLSAYDVPLSRIMSVEP
FT                   IATEVIRILSGSIGLIYAIPLTAIAAGFLYNSPALQQKKPIKNKV"
FT   sig_peptide     complement(566418..566498)
FT                   /locus_tag="Amet_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(566552..567400)
FT                   /locus_tag="Amet_0544"
FT   CDS_pept        complement(566552..567400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0544"
FT                   /product="helix-turn-helix-domain containing protein, AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   KEGG: bld:BLi00865 YfiF"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46771"
FT                   /db_xref="GOA:A6TKQ3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ3"
FT                   /protein_id="ABR46771.1"
FT                   /translation="MKKTNIDFDYPDRSFHFSAREVFGHYTMLSNHFHDQYEIYYLLSG
FT                   ERHYFIKDRIFHVKSGTLVLINRQDVHRTTDADTQDHVRVLLNFSKDYLLSSPYVIALL
FT                   DGLFMNNNYVIPFLSAEQQYVEVLLDKMIHEIEHQSTGFQVALQALLMDLLVYTSRYIE
FT                   SNRHDVLAPPSQVHEKISQIVQYINTNYQTPLTLSSVAQNFFVSQYYLSRTFKQATGFT
FT                   FVEYINNIRIREAQRLLRETNHKVIDISEAVGFGSISHFGRVFKEVTRFSPLNYRRLNT
FT                   E"
FT   gene            567629..569026
FT                   /locus_tag="Amet_0545"
FT   CDS_pept        567629..569026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0545"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: pho:PH0577
FT                   damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46772"
FT                   /db_xref="GOA:A6TKQ4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ4"
FT                   /protein_id="ABR46772.1"
FT                   /translation="MSIQLNKKDSKRRKFILEGDLWQVVLSISMPLAIYNGFNHLFSFL
FT                   DTMMAAHIGSEVVSAISYLVQIKTMIMAIGAGLAIGGGIIIARYYGADDIRNAKKCANT
FT                   LVFLTIGISLILLAVLLPFTKQILRLANTPEELIAVGSGYFTVEIIMIISIFINNVYIA
FT                   IEKAKGNTKSILHLNLMVLAVKLALTALFVYVLNYGITMMAMATLIAHLMLTVFAMTHM
FT                   LRPDNVFRISFKDVDLSLKFIWPILVLALPIFFERFTFSFGKVIVNSMSAFYGSMVVGA
FT                   LGVSNNIGGVIISIGNGFQEGEASIISQNLGNENFERAVNVFKKTLIVSLVLGGMGLLL
FT                   TTVFMDQIIRVFARGDLAFAEEITNVFKYERWAVVTMTVSSAVMGLLYGFGYTKLSLVI
FT                   NFMRLFALRIPTLYLFQTFTNLGSESVGIAMLVSNGLIGVTSVIIGFVIIEKMKKEGRY
FT                   HKIVTTH"
FT   gene            569181..569891
FT                   /locus_tag="Amet_0546"
FT   CDS_pept        569181..569891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0546"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cth:Cthe_1288 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46773"
FT                   /db_xref="GOA:A6TKQ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ5"
FT                   /protein_id="ABR46773.1"
FT                   /translation="MKDKKILLVEDDENISKIIKLYLEKEGFVVSCCYDGIVACETFLK
FT                   NKYDLVLLDLMLPGLDGYQVCQKIRETSYTPIIMLTAKGDLEEKVKGLHIGADDYVTKP
FT                   FEIHELLARIHAMLRRIEQDHEEVNRKEGNRLEYDNLIFDIDAFIIYLNEDIINVPRRE
FT                   AQLLKYLMMYPNQVFKREELIEGIWGWDFEGEDRVIDLYIKRLRKRLKSKTKQSWSIKT
FT                   VWGIGYKFEVEKSV"
FT   gene            569884..571275
FT                   /locus_tag="Amet_0547"
FT   CDS_pept        569884..571275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0547"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: cac:CAC3219 membrane
FT                   associated histidine kinase with HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46774"
FT                   /db_xref="GOA:A6TKQ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ6"
FT                   /protein_id="ABR46774.1"
FT                   /translation="MFKSIFKKFLLTYMAISIISLLMVAGVASYFMEQEIYGQREQFLE
FT                   QKALQVNRLFFQLEDNKISVDYFINMLNMIQTNDKIGISVILDEHKPANIEEFGRRPVS
FT                   SNRSGTNHEMQENEYFIAYFESEEERDIQMMTVSIPLIIDDALMGEVLIYNPVANVELI
FT                   TANVNKSIFLTFIAISIPLALLLFFISRKFTTPLIHMNEVAHNISRGDFSQSVAVQGKD
FT                   EVAELGHALNHMAFKIQGLEELRKDSIANVSHELKTPLTTIQNFIEGILDGVVPKDQEE
FT                   NFMEIALDETKRLGRMVEELIVLSSFEKKLVKLDVSPNNIGNLVDGVFLQMKFHLQEKK
FT                   IRVEKRLDTTIIAEVDQERFRQVLINLLDNAIRHMPENGKIEVCLEKSLDKNFILEIHD
FT                   SGPGIKEEHLPYIFERFYKADPSRKKSGGAGLGLTISKHIVEAHGGEINIKNGRDKGLS
FT                   VEITL"
FT   sig_peptide     569884..569970
FT                   /locus_tag="Amet_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.439 at
FT                   residue 29"
FT   gene            complement(571409..571888)
FT                   /locus_tag="Amet_0548"
FT   CDS_pept        complement(571409..571888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46775"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ7"
FT                   /protein_id="ABR46775.1"
FT                   /translation="MKMNTKFKKLLFIGVLAVSMVTLAACGGGAEDSPWEDDANENEIG
FT                   IEEPVTNNEPSQAEYSEEEMVPTDGTYTAMGMTQDEQGQIEVELTVVDAQINDFKVIAQ
FT                   DGIELDESTVESFRAELLNNKAIEYFSVDEVSGEPQEIDVLMQATLEAYLQALLG"
FT   sig_peptide     complement(571796..571888)
FT                   /locus_tag="Amet_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.302 at
FT                   residue 31"
FT   gene            complement(572006..572785)
FT                   /locus_tag="Amet_0549"
FT   CDS_pept        complement(572006..572785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0549"
FT                   /product="phospholipase C zinc-binding protein"
FT                   /note="PFAM: phospholipase C zinc-binding protein; KEGG:
FT                   cth:Cthe_3193 phospholipase C zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46776"
FT                   /db_xref="GOA:A6TKQ8"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ8"
FT                   /protein_id="ABR46776.1"
FT                   /translation="MTDTKVKEQTFGHLLKLKGMKVITIEFFETTYDYFLRTVFGIANP
FT                   IKKSIIKTQCKVHKFINIQALKILRNDGYAEEYNFFSSYILDINKGAVWADQDFKSSNH
FT                   FYNPYKKKGLYGRRSAMELGVDYYFQAIGLWREGAFNESLFYLGAALHIIQDMTIPQHA
FT                   NIRLLDSHRQYETFVKRTYQYIDDFKVERGTYLLDSVEDYIRFNARIALKIHKRFKKIV
FT                   DEEHRYYRLTKCGLPLAKKTTAGAMIMFYKDVFSKNQ"
FT   gene            573390..574424
FT                   /locus_tag="Amet_0550"
FT   CDS_pept        573390..574424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0550"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: rsp:RSP_1605 TRAP-T family transporter,
FT                   periplasmic binding protein, DctP"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46777"
FT                   /db_xref="GOA:A6TKQ9"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKQ9"
FT                   /protein_id="ABR46777.1"
FT                   /translation="MKKLITMFLGTILLVSLLTACSSPATPTEGDAEDATESVQPVTIQ
FT                   IGYENHPGEPLDLAVNEWKRLVEERSNGNMTVQVFPSSQLGSKNDIIDQMMAGDSVITL
FT                   ADGAFYADRGVPDFGIVFGPYLFDTWEEAWKLTESDWYAGQSGLLEEKGLKLLTSNWMY
FT                   GDRHTLTTNPVRTVEDLKGMKIRVPNNTIQVKGFEVLGATPTPMALGDVYTALQQGTID
FT                   GLENPLPVLYNGKFHEVAKYLTLDGHVRNFTTWVMGAEFFNSLTAEQQQILMETGNEAG
FT                   LYNNELQEQVNEETLELFKAEGVEIIEVDPAVFQEAAKSFYSLPEFTSIWSEGLYDTVK
FT                   DAMK"
FT   sig_peptide     573390..573458
FT                   /locus_tag="Amet_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.354 at
FT                   residue 23"
FT   gene            574564..575079
FT                   /locus_tag="Amet_0551"
FT   CDS_pept        574564..575079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0551"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: oih:OB0242
FT                   C4-dicarboxylate transport system permease small protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46778"
FT                   /db_xref="GOA:A6TKR0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR0"
FT                   /protein_id="ABR46778.1"
FT                   /translation="MEIKNKVLKYLLDMDYFIAGISLIMLIGTTFMGVLMRYFFNNPYT
FT                   WLEEFQLWCFVWLVFFGSGAAFRSGSHVSIDVVVDLMPPIARKIVGVFGYIVVMFILAY
FT                   IMFHGSNLVKQLLDTGRYTNILKVPYPVIYSALPIGCVLMMINHTIVTALLFFTEKVET
FT                   EGTEEEWI"
FT   gene            575070..576359
FT                   /locus_tag="Amet_0552"
FT   CDS_pept        575070..576359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0552"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: msu:MS0528 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46779"
FT                   /db_xref="GOA:A6TKR1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR1"
FT                   /protein_id="ABR46779.1"
FT                   /translation="MDISAVGLGAIIVLVFLFLQIPVFASLLAGSVTYFMLTPNIPTQI
FT                   IAQRVISGIESIPLLAVPFFVCAGVFMNYSGVTKRVMEFCEILMGRTSGGLAQVNVLLS
FT                   TLMGGLSGSNLADAAMQAKMLVPEMEKKGFSKEFSSVVTASSAMITPLIPPGIAMIIYG
FT                   SIANVSIGRLFIAGIGPGILLCVSMMILVSVISKKRGYKPARETRVTPKELISGLGTAA
FT                   LPLFLPVIIIGGIRLGIFTPTEAGAVAIIYSLILGAVYREMKFSHIITGLKETITSTAS
FT                   IMLIVGAASAFAWVLTREQIPQQMTGLIVSMISNKYVFLIAVNIFLIFVGMFIEGNAAM
FT                   IVLVPLLAPVAVEYGVNEIQFAMIFIFNMAVGCLTPPMGTLMFVTCGITKCKIKNFIKE
FT                   AIPFYILLLICLMLLTFVPVFSTGLVDLIY"
FT   sig_peptide     575070..575147
FT                   /locus_tag="Amet_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.610 at
FT                   residue 26"
FT   gene            576459..577115
FT                   /locus_tag="Amet_0553"
FT   CDS_pept        576459..577115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0553"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: tte:TTE2558 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46780"
FT                   /db_xref="GOA:A6TKR2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR2"
FT                   /protein_id="ABR46780.1"
FT                   /translation="MNKSNAVQLPLKDKAYNLIKEQIIKCQLMPGSDLSEAQIAMELGI
FT                   SRTPVREAVLQLNREGFITIYPRKGMIVSSISVKDIQEVFQIREMIEPHMAKTACKNMS
FT                   KEYLLGLKEKFKAIKFGLDSASDMAYFDLDIEFHKYILERGNNNHLIRFMNEIFDLDYR
FT                   IRVMSTLDRDDVEKRSSPEHFDIIDALISKDEKRIEDTIRRHLINSREVALMRIY"
FT   gene            577209..578237
FT                   /locus_tag="Amet_0554"
FT   CDS_pept        577209..578237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0554"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bth:BT_3617 sorbitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46781"
FT                   /db_xref="GOA:A6TKR3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR3"
FT                   /protein_id="ABR46781.1"
FT                   /translation="MEKMKAVHINDDATIQVVEIDRPTPKKGEALLKIKYCGICGSDIQ
FT                   TYTGNQPFATYPRIPGHEFSAEIIEIEENDMGLQKGMIVTANPYFNCGKCYSCLRGKVN
FT                   CCENNETMGVQRDGSFAEYIVMPIERIVDGKGLDAKTLSLIEPFSISYHAVNRVNIQKG
FT                   DKVLVIGAGAIGIFAALAAKLRGAEVYISDIFDERLEAALKMGADGTINVKNENLQERV
FT                   KDITNGNGMDVCIEAVGMPETFLDCIENVCFGGKIGLIGNGKRETTFNHSILLKKELDV
FT                   YGSRNSLNDFIPLVDLVSKDKIDILQIVSDILPLENVKEAFDLLKNNDGSKMKVLVEFD
FT                   KV"
FT   gene            578335..579786
FT                   /locus_tag="Amet_0555"
FT   CDS_pept        578335..579786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0555"
FT                   /product="Mannitol dehydrogenase, C-terminal domain"
FT                   /note="PFAM: Mannitol dehydrogenase, C-terminal domain;
FT                   Mannitol dehydrogenase rossman, N-terminal domain; KEGG:
FT                   cac:CAC0695 altronate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46782"
FT                   /db_xref="GOA:A6TKR4"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023668"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR4"
FT                   /protein_id="ABR46782.1"
FT                   /translation="MKLNKTIYKEARNYPEKIVQFGEGNFLRAFADWTIDKMNKEANFN
FT                   SGVVVIQPLQGGLIDKLNDQDGLYTLYLNGIKDGEVVSEHAVIDCVTRGINTYTNYDEY
FT                   LAVAENPELRFMISNTTEAGITYNEQDRLEDRPQASFPGKLTALLYHRFKTFNGSKDKG
FT                   LVFIPCELIEKNGEKLKETVLKLAALWNLENDFKVWIDEANTFCNSLVDRIVPGYPKER
FT                   MEEIRQELGYDDDLVVEGEPFHLWVIEGPAWVKEAFPAHKVGLNVLVVDDMTPYRTRKV
FT                   RILNGAHTSMVPVAYLYGIDTVRESVEDSVVGQFIKETIFEEIIPTLDLPREELDGFAN
FT                   DVLDRFRNPFIKHQLMSISLNSMSKFETRVLPSILEYENRKGELPKKLTFSLAALIAFY
FT                   KGERNGEKIALTDDAAILEQYKTLWKAYEGKEDQLKHIVTTILSNEKIWKMDLNQISGL
FT                   TDMVTNYLSKIQEHGVKNVLQRMMK"
FT   gene            579788..581275
FT                   /locus_tag="Amet_0556"
FT   CDS_pept        579788..581275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0556"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain; KEGG: cac:CAC0696 putative
FT                   altronate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46783"
FT                   /db_xref="GOA:A6TKR5"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR5"
FT                   /protein_id="ABR46783.1"
FT                   /translation="MKSFIKINETDNVVVALTDLKNGEIIELGDLQVVLQEEIKRGHKF
FT                   ALKEITQGEHILKYGAPIGYATQTIAKGHWVHSHNTKTNLEGVSEYQFNQKLNELIAEN
FT                   RNLNFDGYRRRNGSVGIRNELWIVPTVGCVNGIAQMIIEKFKEEVKPEGIDAIEVFKHN
FT                   YGCSQLGDDHKNTKVILGDVVRHPNAGGVLVLGLGCENNYISAFKEDLGEYDQDRVRFL
FT                   ITQEVGDEVQEGVNRLKDLYEEMKTDKREVVSISELKIGLKCGGSDGLSGITANPLLGV
FT                   FSDFLISQGGTTILTEVPEMFGAENILMGRAENEDVFDKTVNLINDFKQYFIEHKQPIY
FT                   ENPSPGNKEGGITTLEEKSLGCTQKGGIATVVDVLKYGETLKKKGLNLLDAPGNDLVAA
FT                   TALGASGCQIVLFTTGRGTPFGSFVPTIKISTNSAIYNLKPHWIDFNAGTLVENETMEE
FT                   ALERFIEYIIEVANGKLVNNEKNNFREISIFKTGVTL"
FT   gene            581628..583130
FT                   /locus_tag="Amet_0557"
FT   CDS_pept        581628..583130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0557"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: tte:TTE2002 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46784"
FT                   /db_xref="GOA:A6TKR6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKR6"
FT                   /protein_id="ABR46784.1"
FT                   /translation="MKKYIMALDQGTTSSRAILFDQEGKRVGSSQKEFTQFYPKAGWVE
FT                   HDPMEIWGTQSGVAREVLETTGISTQDIAAIGITNQRETTIIWDKNTGKPIYNAIVWQC
FT                   RRTAGICDELKAQGMETYIRENTGLVVDAYFSGTKVKWILDHVEGAREKAENGELLFGT
FT                   VDSWLIWNLTRGKVHVTDYSNASRTMLYNIKELKWDEKILEALDIPKSMLPEVKASSEV
FT                   YGHTDHQTFGGADIPIAGAAGDQQAALFGQACFQPGMAKNTYGTGCFMLMNTGEKFVPS
FT                   ENGLLTTLAWGVDGKVEYALEGSIFVAGAAVQWLRDELRIIRDAEDTEYLATKVADSNG
FT                   VYVVPAFTGMGAPYWDMYARGAILGLTRGAKAEHIIRATLESIAYQTRDVLEAMQEDSG
FT                   IELRSLKVDGGAVSNNFLMQFQADILGVQVDRPEIIETTALGAAYLAGLAVGFWRDKNE
FT                   IANKWKVDTVFSPTMENTKKEKMYRGWKRAVNRALKWELEEE"
FT   gene            583641..584708
FT                   /locus_tag="Amet_0558"
FT   CDS_pept        583641..584708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0558"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: fnu:FN1258 C4-dicarboxylate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46785"
FT                   /db_xref="GOA:A6TKR7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR7"
FT                   /protein_id="ABR46785.1"
FT                   /translation="MKKLGIKLSVILVLLLLITGVLTACGGGETPAEAETEGEVTTEVE
FT                   SDDDYKLVLRLSHVFSPEEQLTKSMDLVADSIYEKTNGAIEIQTFPQGQIAAYKDGVEQ
FT                   VVRGADFISVEDPSYIGDYVPDFTAMVGPMLYDTYAEYVAMTDTELVADMKRRAEEKGI
FT                   KILSLDYVFGFRNVITDKVIETPADLNGVRLRVPGSQLFIETLNAMGANSTPLPWGETI
FT                   SAMQQGVVDGIEGSEFTNLGNSIYEVRKNVALTRHFLGACGVYISTDVWDGIPAKYQKI
FT                   IQDEYNAGAIHMVELLTEQHAGVVEELESYGVQFNEVDREAFVEATAHIYDTFPGLTPG
FT                   IYDLLQEELAIIRGQ"
FT   sig_peptide     583641..583715
FT                   /locus_tag="Amet_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.602 at
FT                   residue 25"
FT   gene            584865..585377
FT                   /locus_tag="Amet_0559"
FT   CDS_pept        584865..585377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0559"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: fnu:FN1257
FT                   C4-dicarboxylate transporter small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46786"
FT                   /db_xref="GOA:A6TKR8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR8"
FT                   /protein_id="ABR46786.1"
FT                   /translation="MSMRRIINNLEEIISSFFVSITVSLVILNVILRYVFNMGIYWSEE
FT                   AATISFVWSVFIGAGACYKKKMHIGIDLLTQLASVKVQGIIHLLVNLALVGINGYITYL
FT                   SIVFVRASVGKPTAVLGISSAYMSAAVLAGFAIMTFHSIRFFIAGVKVLITGEVNKEVE
FT                   EANIISK"
FT   gene            585415..586695
FT                   /locus_tag="Amet_0560"
FT   CDS_pept        585415..586695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0560"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: fnu:FN1256 C4-dicarboxylate
FT                   transporter large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46787"
FT                   /db_xref="GOA:A6TKR9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKR9"
FT                   /protein_id="ABR46787.1"
FT                   /translation="MAYVPVAIVFLLYFSSIPIAFALFAATLSYFTFINTGMPVDLVLQ
FT                   RFITSTASFPLLAIPFFIMAGAIMNYAGISSKLMKMADVLTGHMVGGLAQVNVVLSTLM
FT                   GGISGSANADAAMQCKILVPEMEKRGFNRAFSAAITAASSSIAPVIPPGINLIIYALIA
FT                   NVSVGRMFVAGYVPGLLMCLALMVTVSIISNKRSYKPSREKKATLMEVLLQTKESIWAL
FT                   FLPFGIIMGLRFGMFTPTEAGAIAVLFCTLVGFFVYKELKIQHFPEILKDTIYGTSSVM
FT                   LIIVAASVFGYYMSWERIPQSITSVLLNVTESKVMMLMVINLLLLFMGMFLEGGAALII
FT                   VAPLLVPVVVSLGVDPIHFGIIAIVNIMIGGVTPPFGSMMFTTCTITGVPITDFIREVY
FT                   PFIIALLVALLLVTYLPGLILFLPNLM"
FT   sig_peptide     585415..585492
FT                   /locus_tag="Amet_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.970 at
FT                   residue 26"
FT   gene            586716..587423
FT                   /locus_tag="Amet_0561"
FT   CDS_pept        586716..587423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0561"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: fnu:FN1891 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46788"
FT                   /db_xref="GOA:A6TKS0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKS0"
FT                   /protein_id="ABR46788.1"
FT                   /translation="MLMIAHRGASGDAPENTIAAMDLAIKQNCDGIEMDVQLTKDGQVI
FT                   VCHDWTVDRTTNGTGEIRNLTVEEIKKLDAGSWFSEKFTGEKIPTLEEVINHVPHSLLL
FT                   NIEIKIQAFDDRDIAKQVLVILEKYDRIENTIVSSFNHLQIQRIKKLKPAVKIGSLYEA
FT                   YLLNPCDYFKQNDLNLYSFHACGYYINHEVIKELQDNHIKVYCWTINDKENANLLKDMG
FT                   VDGIISNFPDMLK"
FT   gene            587562..588128
FT                   /locus_tag="Amet_0562"
FT   CDS_pept        587562..588128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0562"
FT                   /product="glycerol-3-phosphate responsive antiterminator"
FT                   /note="PFAM: glycerol-3-phosphate responsive
FT                   antiterminator; KEGG: cno:NT01CX_0613 glycerol uptake
FT                   operon antiterminator regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46789"
FT                   /db_xref="GOA:A6TKS1"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKS1"
FT                   /protein_id="ABR46789.1"
FT                   /translation="MKETIFERIVENPIIAAIQKESDLDIALLSQVNTIFLLRADIFNI
FT                   KYLVDKIKSNDKSVFIHMDFLEGIGRDAKAIDYIAKVVKPDGIISTKSSHIKIAKEKGM
FT                   FTIQRFFLIDNQSYNMTIKSVELTHPDMIEIMPGVIPGVIGRMTKKLTTPVIAGGLIES
FT                   KQDIIEVLKAGALGASTGKKELWEL"
FT   gene            588277..589002
FT                   /locus_tag="Amet_0563"
FT   CDS_pept        588277..589002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0563"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   MgtC/SapB transporter; KEGG: cth:Cthe_1919 MgtC/SapB
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46790"
FT                   /db_xref="GOA:A6TKS2"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKS2"
FT                   /protein_id="ABR46790.1"
FT                   /translation="MISIGETILRLVLSALTGGLVGMEREANNRPAGLRTHVLVTLGST
FT                   LIMLISMYGFDGLGVDGQGGEPARLAAQVVSGIGFLGAGTILRTGNNISGLTTAASIWV
FT                   CGGIGLAIGSGYYIGGLTTAGIVFFTLKSLGLVENKLFKKKYKSLILQCRERPGLVGDI
FT                   GHLLGKNNIIIKDIKVINEYDQYDEYDESNSIEIHFMVKIPSKFYGEKFFEELLDINGI
FT                   RDAMWDGTSKVYNVKRSVK"
FT   gene            589113..590411
FT                   /locus_tag="Amet_0564"
FT   CDS_pept        589113..590411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46791"
FT                   /db_xref="GOA:A6TKS3"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKS3"
FT                   /protein_id="ABR46791.1"
FT                   /translation="MKPIGLAYGRKEVLLGLPEKTLVQVLEGKPNGHEKTEEAIIVEAL
FT                   SNPMGTDRLQDIVKAGQRVCLVISDVTRAWQKMSLYLPYIVEELNQAGILDENIIFLCA
FT                   TGSHRKQSREEHKLLLGEELALRFQVIDHDCRDESNLVDLGKTSFGTPVQINRIAMDCD
FT                   HIIITGAIVYHDLVGWGGGKKSILPGIAGYQSIMGNHGLSLSHIEGAGTHPHVKSGNIV
FT                   QNPLHEDMLEAAGIVNPSFLFNVMMDEAGNIGNAVAGHFEGAHEVGRKLVSESDGIFIN
FT                   EKADLVIASAGGFPKDMNLYQASKALSNGKEALKPGGTMILLCQCEEGFGHPEVQEIIT
FT                   GFESNLARETELRRNYTIAKYAGFLVTEIAAKYKVILVSEIDPVLLEAANIKVVSTLES
FT                   ALKLVGGIQDAILKTYVIPKAANVLPIVASDSN"
FT   gene            590544..591047
FT                   /locus_tag="Amet_0565"
FT   CDS_pept        590544..591047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0565"
FT                   /product="amino acid-binding ACT"
FT                   /note="KEGG: cth:Cthe_1377 amino acid-binding ACT"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46792"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKS4"
FT                   /protein_id="ABR46792.1"
FT                   /translation="MFILIQQMYTVDKQKGGVMMERDGGTHYIVNEKALPIVLLKTVEA
FT                   KELLKKGEVVTIHEAVDRVGMSRSAYYKYKDYIFPLYEMNKGKIITMHLILKHLPGILS
FT                   EVLNQIAESEASVLTINQSIPAHGIANISVALETRQMTINIEELILKMEQIKGVQKINI
FT                   LAQE"
FT   gene            591090..592388
FT                   /locus_tag="Amet_0566"
FT   CDS_pept        591090..592388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0566"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; amino acid-binding
FT                   ACT domain protein; homoserine dehydrogenase, NAD-binding;
FT                   KEGG: cac:CAC0998 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46793"
FT                   /db_xref="GOA:A6TKS5"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKS5"
FT                   /protein_id="ABR46793.1"
FT                   /translation="MIKLGKIKIALLGMGTVGTGVWQIVHENKEEILRSCGYEIEVSKI
FT                   LVRDLEKKRNADIPQSLLTTNYEEIVNDKEIEIVVELMGGIEPAKGYIMKAIENKKHVV
FT                   TANKALIASHGDEIIEKAKEKKVIIQYEASVGGGIPVLQAIKEGLSGNKIQEVMGIVNG
FT                   TTNYILTKMTKEKVDFETVLKEAQDKGYAEADPTADIEGYDAAHKLTILASLSFGSNVN
FT                   FDSVYREGITKITPLDIEYADELGYAIKLLAIGKEKDNEMELRVHPTFIPLSHPLAAVG
FT                   DAFNAVFLKGNAVGELMFYGKGAGDLPTGSAVVGDMISIIKNKCNLADESLKTVDKKPN
FT                   KSVKPMSEINCEYYIRVMVKDRPAVLGKIASLIGDSGVSLSTVIQKGEGDPSVSLVFIT
FT                   HRTNEGNIKRALDAIIAVPEVVELANLIRVENS"
FT   gene            592441..593502
FT                   /locus_tag="Amet_0567"
FT   CDS_pept        592441..593502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0567"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein, beta subunit;
FT                   KEGG: tte:TTE2619 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46794"
FT                   /db_xref="GOA:A6TKS6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKS6"
FT                   /protein_id="ABR46794.1"
FT                   /translation="MWEGIISKYSSYFGVADGEKVITLNEGNTPLIAAENIGEMLGGIK
FT                   LYLKYEGLNPTGSFKDRGMTMAVSKAVEAGSKAIICASTGNTSAAAAAYAAKAGIQCFV
FT                   LIPNKKIALGKLSQAVIYGAKIIPVEGNFDDALRIVQEIAAEGRVTLVNSVNPYRLIGQ
FT                   RSGAYEVCEQLEGEIDYLSIPVGNAGNISAYWAGFKDYFEAGKLKKLPVMLGFQAEGAA
FT                   PIVENRIFENPETVATAIRIGNPASWEKAVAARDDSKGLIDKVTDEEILSAQRLLASKE
FT                   GIFVEPASAASVAGVIQLSKKGYFKKGQKVVCVLTGNGLKDPSVVDVEKELKVYGVHTE
FT                   EIKILINECLGGE"
FT   gene            593504..594400
FT                   /locus_tag="Amet_0568"
FT   CDS_pept        593504..594400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0568"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: GHMP kinase; KEGG:
FT                   ctc:CTC02357 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46795"
FT                   /db_xref="GOA:A6TKS7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKS7"
FT                   /protein_id="ABR46795.1"
FT                   /translation="MIHVTVPATTANVGPGFDCLGIALSLYNHIEVEEIPEGLVIEVSG
FT                   VDQDLIEKDEGNLVYQSMLKAFKAIGYQPSGLRIKQYNGIPVARGLGSSAACIVGGVLA
FT                   ANKMCGSPLSQDEMLEIAVEVEGHPDNVAPALLGGVVVSNRYEGKTHYVRALVHEDLKF
FT                   LTAIPNVPLGTKEARDALPRVVAFEDAVFNVGKSSLLVAALFSGDLEKIKPALQDRLHQ
FT                   SYRAKLMSSLESVFLETEKAHLDSVFLSGAGPTVILLRWQKEGQREIKFRDIIYRMEEN
FT                   WEIQDLKGDNIGAQVLN"
FT   gene            594647..594910
FT                   /locus_tag="Amet_0569"
FT   CDS_pept        594647..594910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0569"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: ade:Adeh_0152 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46796"
FT                   /db_xref="GOA:A6TKS8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKS8"
FT                   /protein_id="ABR46796.1"
FT                   /translation="MCRGEVVLTNELGLHARAASAFIKESSKYKCEIKILKDNNEYNGK
FT                   SIISILGMGAVTGDSITIICDGSDEKKALETLIQLVKNQFHE"
FT   gene            595096..596286
FT                   /locus_tag="Amet_0570"
FT   CDS_pept        595096..596286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0570"
FT                   /product="Histidine--tRNA ligase"
FT                   /EC_number="6.1.1.21"
FT                   /note="PFAM: tRNA synthetase, class II (G, H, P and S);
FT                   KEGG: cth:Cthe_2880 histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46797"
FT                   /db_xref="GOA:A6TKS9"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKS9"
FT                   /protein_id="ABR46797.1"
FT                   /translation="MVLEKVFLPEGVQDLLMKDCHHRRLIEGRLMEEWVKQGYMEVSSP
FT                   TLEYYDLFRQGEQMLRGNKMFKLIDAKGDLLVLRPDGTLPIARMVATKMKDMVYPLKIC
FT                   YIQDIFRLDQEQAGKQREFRQAGVEVFGVESYEADGQVIITAIESLKALGLSDFQIEIG
FT                   QTKILQSILDSMAVTTDEKDEIIMLIHNKNFSTLESLLEKLDIDPKTRLILKEIPNLFG
FT                   TPQGVMESVAALPINDNIKRALEELQQICHMIQAYGFGQYISVDLGMTAPLGYYTGIIF
FT                   KGFTKDLGTILCSGGRYDRLLMSFGMNCPATGFALLIDQIRKALHLGQQKKKESGPPYY
FT                   LLVSHEGRHEEVAKEATRLKKTGCIVEVSLLKDPQAIDIYAKRRGVDKIIEIGEKK"
FT   gene            596386..597015
FT                   /locus_tag="Amet_0571"
FT   CDS_pept        596386..597015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0571"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase, catalytic region; KEGG:
FT                   cac:CAC0936 ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46798"
FT                   /db_xref="GOA:A6TKT0"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKT0"
FT                   /protein_id="ABR46798.1"
FT                   /translation="MNVIKIALAKGRLADQSVKLLESIGIDCGPLLDKGRKLIVALPKD
FT                   HLEVVFVKAPDVPTYVEHGAVDMGIVGKDVLLEANKQLYEVLDLQFGKCKFSVAGSTSM
FT                   ENYPTPHMRVATKYPNIAKNFFQSKGQSVEIIKQEGSVELAPMVGLADVIVDIVETGNT
FT                   LRENGLMVFEDIVEISARLVLNQVSYKTKHQEIRGLIDRIAEKTGK"
FT   gene            597030..598331
FT                   /locus_tag="Amet_0572"
FT   CDS_pept        597030..598331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0572"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: tte:TTE2138
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46799"
FT                   /db_xref="GOA:A6TKT1"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKT1"
FT                   /protein_id="ABR46799.1"
FT                   /translation="MEVLDFKDIDQQTLLAKLEGRNTLDFREYNEVVQEILDEVNKKGD
FT                   QALLSYTEKFDGVKLTSGDLLVKPEEFERAYEKVSEDFIKALRVAIENIRAYHSRQRQN
FT                   SWFISEQQGIFLGQKITSIARVGIYVPGGTAAYPSSVLMNAIPALVAGVKRIAMVTPPL
FT                   KDGSVNPNVLVAAKELGIEEIYKVGGAQAIGALAFGTDSIPKVNKIVGPGNIYVATAKR
FT                   LVYGYVDIDMIAGPSEILVIADESANPRYVAADLLSQAEHDTLSSAICITTSRFLAEQI
FT                   KTELIRQTKELERKEIVEASLKQFGQIIVVETLEEATTLANEIAPEHLELCVAQPFELV
FT                   QAIENAGSIFLGHFAPESLGDYIAGPNHVLPTSGTAKFYSPLSVDDFIKKSSLLYYDRS
FT                   ALEKVKNEVMILAQVEGLTAHKNAVKVRFEEDEE"
FT   gene            598321..599412
FT                   /locus_tag="Amet_0573"
FT   CDS_pept        598321..599412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0573"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class I and II; Allinase-like;
FT                   KEGG: cno:NT01CX_1063 histidinol-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46800"
FT                   /db_xref="GOA:A6TKT2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKT2"
FT                   /protein_id="ABR46800.1"
FT                   /translation="MRNDLVRKSIEKLQPYEPNEIYCDIKLDANENNGATMLWNEKIAK
FT                   ALMGLQINQYPDTNAEEIKGILGRQLGVQKDQLVIGCGSDQLITMLFNAFVDSKDRILT
FT                   LSPTFSMYRVACDIAGGITVEAPLGKDFEFDYFTFIKAVKKVEPKMIFLTNPNNPTGGV
FT                   ISREHIIKIIENTTAVVVVDEAYYEFYGETVADLVNYYSNLIVLRTLSKGYGLAGARIG
FT                   YSISNKTVTRVLKKVKPPYNVSSLDQIAAKVCLENKVLLQESLREVIEERENLIAALES
FT                   VDEIKTFKTKGNFVLIEVEEAKLLFNYLTETGIAVRYFGGQGPLKNCIRISVGTKEENR
FT                   VLMKAVKGYFIKKTESLASGVSA"
FT   gene            599442..600029
FT                   /locus_tag="Amet_0574"
FT   CDS_pept        599442..600029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0574"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   cth:Cthe_2884 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46801"
FT                   /db_xref="GOA:A6TKT3"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKT3"
FT                   /protein_id="ABR46801.1"
FT                   /translation="MTRSYRGDRRTKETDIELILNLDGKGQGKIATGIGFFDHMLEQIM
FT                   KHGQLDLELKAVGDIEVDFHHTVEDVGILMGKAIAEALGDKKGIVRYATAFIPMDEALS
FT                   MVSMDISGRPFLQYGVNYSGEFVGQFEVQLVEEFFRALAFNSGITLHIQTQYGRNNHHI
FT                   VESIFKAFAKALREAITIDPRIEGVLSTKGSL"
FT   gene            600045..600653
FT                   /locus_tag="Amet_0575"
FT   CDS_pept        600045..600653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0575"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: tte:TTE2135 glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46802"
FT                   /db_xref="GOA:A6TKT4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKT4"
FT                   /protein_id="ABR46802.1"
FT                   /translation="MIAIIDYGMGNLRSVQKAFEKMGIQAVITAEQAVIESAQGLVIPG
FT                   VGAFEDAMKNLRDKKLDQWIMEAVEKQTPLLGICLGMQVLFQWGEEGEGCQGLGLLKGD
FT                   VVKLPEGEKIPHMGWNALEDLKKCQLLEGVGQGDYVYFVHSYYVRPEVDEVIKARAGYG
FT                   INVPAIVQQDHILGVQFHPEKSGDVGLQILKKFGEMVYQ"
FT   gene            600650..601363
FT                   /locus_tag="Amet_0576"
FT   CDS_pept        600650..601363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0576"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: oih:OB0548 phosphoribosyl
FT                   formimino-5-aminoimidazole isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46803"
FT                   /db_xref="GOA:A6TKT5"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKT5"
FT                   /protein_id="ABR46803.1"
FT                   /translation="MIIYPAIDIQGGQCVRLTQGKKEERKMYFDSPQAVAQRWQAEGAE
FT                   FIHVVDLDGAFGKGEENMEAIEAIVKAVEIPIQVGGGIRSIEKIQQLLDLGVTRVILGT
FT                   KALTDEAFLREAIEKYGDRIIVSIDAKEGYVATEGWVKTSSRRALDFAKSIEEIGVKRI
FT                   VYTDIAKDGMLQGPNFDEIQRMKDSVGMEVIASGGISCETDLQGLKEMDVKGVIVGKAL
FT                   YEGKVQLGKLRGMDI"
FT   gene            601360..602118
FT                   /locus_tag="Amet_0577"
FT   CDS_pept        601360..602118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0577"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: tte:TTE2133 imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46804"
FT                   /db_xref="GOA:A6TKT6"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6TKT6"
FT                   /protein_id="ABR46804.1"
FT                   /translation="MITKRIIPCLDVRKGRVVKGVNFVDIKDAGDPVALARAYNDQGAD
FT                   EIVFLDITASHEERYILLDVVKKTSEEIFIPLTVGGGIRTVEDMRQIIKSGADKVSINS
FT                   SAVKNPSMITDCARQFGSQAVVIAMDVKRGADGRYEVYVRGGREKTGLEAVDWARRVAQ
FT                   LGAGEILLTSMDRDGTKSGYDLEITKRISQAVNIPVIASGGAGSVQDFADAFIEGQADA
FT                   ALAASLFHYNEVSIPRLKQSLHEMDISMRR"
FT   gene            602127..602777
FT                   /locus_tag="Amet_0578"
FT   CDS_pept        602127..602777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0578"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase;
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG: tte:TTE2132
FT                   phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46805"
FT                   /db_xref="GOA:A6TKT7"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKT7"
FT                   /protein_id="ABR46805.1"
FT                   /translation="MKGLEEVTFDEKGLVATIIQEMSSNEVLMVAYMNRESLKKTLETK
FT                   ETWFWSRSRGELWHKGGTSGHIQRVKEMRYDCDGDALLVKVEQTGVACHTGEKSCFYST
FT                   LYKEEAVKKKEAMLEESENIEELLSSLYERIVDRKAHPKQGSYTNYLFDKGVDKILKKV
FT                   GEEASEVIIAAKNPGKEELVSETSDLLYHLLVLLVEKGVSLEAIYQELNSREK"
FT   gene            complement(602876..606316)
FT                   /locus_tag="Amet_0579"
FT   CDS_pept        complement(602876..606316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0579"
FT                   /product="pyruvate carboxylase"
FT                   /note="TIGRFAM: pyruvate carboxylase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; pyruvate
FT                   carboxyltransferase; Conserved carboxylase region;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp; KEGG: cno:NT01CX_0659 pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46806"
FT                   /db_xref="GOA:A6TKT8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKT8"
FT                   /protein_id="ABR46806.1"
FT                   /translation="METKKFKRILVANRGEIAIRIFRACQELSIRTVAIYSNEDKCALF
FT                   RTKADESYQIGSNKGPVEAYLAIDEIIALALKKGVDAIHPGYGFLAENPEFSKKCEEAG
FT                   IEFIGPTHVMIEQLGDKIQSKLVAKAAGVPVIPGVEKPIADEAQALRFAGECGYPVMLK
FT                   AAAGGGGRGMRIVTQEEDLVESFLSARSEAKKAFGIDSIFIEKYIEKPKHIEVQILGDK
FT                   YGNIVHLLERDCSIQRRHQKLIEFAPAVSLSQEKREAICHDALKIARAVHYRNAGTVEF
FT                   LVDAHGDHYFIEMNPRIQVEHTVTEMITGIDIVQSQILIAQGYPLNSSQVGIGSQENIK
FT                   ANGYSIQCRVTSEDPANHFAPDTGKITEYRTGSGFGIRLDGGNGFTGATISPYYDSLLV
FT                   KTTSWSRTFDDAIKKGIRSIKELKISGVKTNTAFLINVLNHETFIKGDCDTNFIADHPD
FT                   LFDIAPKNNKELKILKFIGEKVVNETKGIKREFDVPTVPYVERPLGLSGTKQILDQEGP
FT                   AGIVNWVKNQEKLLLTDTTMRDAHQSLMATRVRTKDMVKIAKATSILGQDLFSLEMWGG
FT                   ATFDVSYRFLKESPWARLEALRKKVPNILFQMLLRGSNGVGYKNYPDNVIREFIQESAA
FT                   SGIDLFRIFDSLNWLKGMEVAIDEVLKTGKIAEACICYTGDILDTSRDKYSLQYYVNMA
FT                   KDIEKTGAHILAIKDMSALLKPYAAYKLIHALKQEVSMPIHLHTHDTSGNGVATILMAA
FT                   EAGVDIVDTTFNSMSGLTSQPALNSVVAALENTERATGIKLDDLEAISTYWDAVRPVYS
FT                   QFESGLKSGTTEIYKYEIPGGQYSNLKPQVESFGLGHRFGDVKEMFKQVNDMVGDIVKV
FT                   TPSSKMVGDLAIFMVQNDLTPENILEKGQDLAYPDSAVSYFKGMMGQPMGGFPPELQKL
FT                   VLKGEEPITVRPGEMLEPEDFQAIQQHLKDKHKLTPTKQDMLSYALYPKVFEDYLEYLK
FT                   DYGDFSRMGSDIFFHGLEEGETCEVEIAQGKVLILKLLHIGRLNNTGHRNVIFEVNGNR
FT                   REVQILDKDRGSEISVDAIKMADPHNKLEIGASIPGTVLKVLVKEGDTIKAKEPIIILE
FT                   AMKMEASITAPVSGVIESILVKEKQQVQSGELLIKFKEQ"
FT   gene            606747..608246
FT                   /locus_tag="Amet_0580"
FT   CDS_pept        606747..608246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0580"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   cfe:CF0515 sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46807"
FT                   /db_xref="GOA:A6TKT9"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKT9"
FT                   /protein_id="ABR46807.1"
FT                   /translation="MSQKNEQWGSRIGFIAAAIGMAIGTGNIWRFPRVAAANGGGPFVI
FT                   AWTIALFVWAIPLLMGEMVMGRKTGLGTIGAFRDFVGKKYTWMGTWIAVVCLGIMFYYS
FT                   VVMGWTMKYFTLAVSGAFQPGVTTAQTEAIWNVFTTTPSQTITFHFLSMLIAGFIIYKG
FT                   VKGGIEKASKIMIPTLFVLLIAAVIRALTLPGALQGLEYLFTPNLHMLKNPTIWLEAFT
FT                   QAAWSTGAGWGFIITYSVYTKQKEDVAGNCMIMGFGDNIGALIAAMTVLPAIYALSPTP
FT                   EFAAEALSSGNTGITFIYLAQLFTTMPAGQFLAAIFFLAMAISALSSLLPMIEVGVRNL
FT                   MDMGFDRKKATASIVVAGFLLGIPSAYSLHFLDNQDWVWGVGLLVSGLFVAFALAKYGL
FT                   ERARNNDINTEWADFKVGKWWSTCIRLFPVFFVVVTGWWFMQAISWYPGNWWAPFEVFS
FT                   AGTIVFQWAILIVIALLTNNWLASKIGAGRDITQGDDESVL"
FT   gene            608681..608827
FT                   /locus_tag="Amet_0581"
FT   CDS_pept        608681..608827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46808"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU0"
FT                   /protein_id="ABR46808.1"
FT                   /translation="MYLLGEGTFIKGSSFLYVFLGYQQVKHCNHEGEDNIKGGMYYFVV
FT                   SNE"
FT   gene            608889..610631
FT                   /locus_tag="Amet_0582"
FT   CDS_pept        608889..610631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0582"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cac:CAC0250
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46809"
FT                   /db_xref="GOA:A6TKU1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU1"
FT                   /protein_id="ABR46809.1"
FT                   /translation="MKSIKTKLIIYFCTLILFTTLIISFLAYNSGLNGMQELEEELLRE
FT                   KLMGDIASSTFYLQQYFGNVEYENGQLIDAKGNNIEGNNEMVDAILKDMGSAATIFAKS
FT                   DDDFKRIATNIMGEDGQRAVGTYLGKDSLAYGDVAQGKQFVGEAMILDNAYMTVYKPIN
FT                   DESGNTIGILFLGVPRERSNQLIQGHINGLRNGLSMVTVIGLIIGIIFVYTIAKKIADP
FT                   IAILALEIEKISNYDLYFDENSKTKKYLNNKDEIGTITRALDVMQRNLIDLVKDISGTA
FT                   QQVAASAEELTATSQQSATAADEVAKTIEEIAEGANDQAKDTEKGVEHVNELGELIEKD
FT                   QQYIKDLNISANEATKLKDEGFKILKDLVEKTKINSESTEEVYTIIVNTNESAEKIENA
FT                   SQMIRSIAEQTNLLALNAAIEAARAGDAGRGFAVVAEEIRKLAEQSNSFTKEIAGIIKE
FT                   LTDKTGHAVDTIQEVEKVTASQTESVQFTNDKFKGINGAIEKMKEIITEINQSSEKMGG
FT                   KKNQIIEIIENLSAISQENAAGTEEASASVEEQTASMGEIANASDSLARLAEEMQGAIA
FT                   KFKY"
FT   sig_peptide     608889..608978
FT                   /locus_tag="Amet_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.776 at
FT                   residue 30"
FT   gene            610847..611740
FT                   /locus_tag="Amet_0583"
FT   CDS_pept        610847..611740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0583"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /note="TIGRFAM: glycyl-radical enzyme activating protein
FT                   family; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Radical SAM domain protein; KEGG: tko:TK0290
FT                   pyruvate-formate lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46810"
FT                   /db_xref="GOA:A6TKU2"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU2"
FT                   /protein_id="ABR46810.1"
FT                   /translation="MEKGRIFNIQRYSLHDGPGIRTTVFLKGCPLNCWWCHNPESKDRK
FT                   QQILFTQQRCIHCGSCHDTCSQKAIQEGKINGENCTLCNKCVDRCPTEALELVGKDMTV
FT                   AEVMGEIEKDRIFFEQSKGGVTFSGGEPLSQGEFLYELLRVCGQKGIHRGVDTSGFSSW
FT                   QQLEKIAEVTDLFLYDLKHINNDKHIEYTGVSNQGILRNLEKLSALHHNIYIRIPIIPY
FT                   INDNDENILETSRYLATLNVKNVTLLPYHDTGIDKYQKVKEDYRLVHVKVPSQEQMIAI
FT                   AEKMRGFGLNIRIGGS"
FT   gene            611742..614120
FT                   /locus_tag="Amet_0584"
FT   CDS_pept        611742..614120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0584"
FT                   /product="Formate C-acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="PFAM: formate C-acetyltransferase glycine radical;
FT                   pyruvate formate-lyase, PFL; KEGG: gsu:GSU2101 formate
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46811"
FT                   /db_xref="GOA:A6TKU3"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU3"
FT                   /protein_id="ABR46811.1"
FT                   /translation="MEELRGINARTKKLRKQSETIHPSISIERAVLMTQAYEKYSGKVS
FT                   EPMLRALSFKHLMENKTICINDDELIVGERGPTPQSAPTYPELCCHTIEDLEMMNDREK
FT                   ISFTVTAEDKKIQREKIIPYWQGKSIRDFIFNEMTEEWKDCYHGGIFTEFMEQRAPGHT
FT                   VGDDKIYKRGFLDFKLEIMEQLESLDYYNDIEAYEKQEQLKAMEICADAIIIFAHRHAE
FT                   KAKELAENEENPQKKRELEKIAEVCLRVPALPPGNFWEALQSYWFVHLGVITELNTWDA
FT                   FCPGRLDQHLHPFYQKGIEGGTLTPQGAKELLECFWVKFNNQPAPPKVGITLQESGTYT
FT                   DFANINIGGLKIDGSDGVNEVSYLLLEVIDEMKLLQPSSNIQVSKKNPDYFIKKAAEVI
FT                   RKGWGQPSVFNADAVVEELLRQGKSIEDARCGGTSGCVETGAFGKESFILTGYFNLTKV
FT                   LEITLNNGFDPVTGKKIGVQTEVVENLHSFKALFEAFKVQLNHFIDIKIKGNNIIEKLY
FT                   AHYMPSPFLSILIDDCIKNAKDYNAGGTRYNTNYIQGVGIASITDSLSAIKSHVFDDKL
FT                   FTLRQLMETLHVDFKGHEPIRQLLLNKTPRYGNDDDYVDSIMVKVFDAFYQAVNGRKTM
FT                   RGGTYRINMLPTTCHVYFGSVIGATPDGRKAGRPLSEGISPVQGTDKKGPTAVIKSASK
FT                   MDQLKTGGTLLNQKFTPNMLEGEAGLENVVHLVRSYFRLDGHHIQFNVVDAATLKKAQA
FT                   NPEAYQNLIVRVAGYSDYFNNLNKGLQDEIIARTEHQAM"
FT   gene            614384..615139
FT                   /locus_tag="Amet_0585"
FT   CDS_pept        614384..615139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0585"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: fnu:FN0047
FT                   exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46812"
FT                   /db_xref="GOA:A6TKU4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU4"
FT                   /protein_id="ABR46812.1"
FT                   /translation="MKLVSWNVNGIRACVKKGFLDYFNEVDADIFCIQESKLQEGQIEL
FT                   DLEGYEQYWNYAVKKGYSGTAVFTKEKPISVKYGVGEEEDEEEGRVLTLEFDQFYLVNV
FT                   YTPNSKRGLERLDGRMIWEDEFRAHLKELDAIKPVILCGDLNVAHEEIDLKNPKSNKKS
FT                   AGFTNEEREKMTELLTSGFIDSFRYFYPDLEGAYSWWSYMGKARERNAGWRIDYFVVSE
FT                   RLKNQLKEAAIHPQIMGSDHCPVVLELDI"
FT   gene            615535..616536
FT                   /locus_tag="Amet_0586"
FT   CDS_pept        615535..616536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0586"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: btl:BALH_0606
FT                   ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46813"
FT                   /db_xref="GOA:A6TKU5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:3CTP"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU5"
FT                   /protein_id="ABR46813.1"
FT                   /translation="MANIREIAKRAGISIATVSRHLNNTGYVSEDAREKIQKVVDELNY
FT                   TPNALARAMFTKNSKTIGLMVPNISNPFFNQMASVIEEYAKNKGYTLFLCNTDDDKEKE
FT                   KTYLEVLQSHRVAGIIASRSQCEDEYANIDIPVVAFENHILDNIITISSDNYNGGRMAF
FT                   DHLYEKGCRKILHIKGPEVFEATELRYKGFLDGARAKDLEIDFIEFQHDFQVKMLEEDI
FT                   NSMKDIVNYDGIFVFNDIAAATVMRALKKRGVSIPQEVQIIGFDNSFIGELLYPSLTTI
FT                   NQPIEALAYTIIELLIKIINGEGVLIEDYIMEVKLIERETTISLKDLDPASI"
FT   gene            616615..618111
FT                   /locus_tag="Amet_0587"
FT   CDS_pept        616615..618111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0587"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gka:GK1894 sugar ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46814"
FT                   /db_xref="GOA:A6TKU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU6"
FT                   /protein_id="ABR46814.1"
FT                   /translation="MNGEIKLRVSNIEKSFPGVKALDGINFSAKKGSVHVLCGENGAGK
FT                   STLMKIINGIYKADAGEILIDGKVVEIQNPIQARSLGISMIFQELNYMPEMTIEESLFV
FT                   GSWPTHKYGNVNWAEIRKRTIELLEKENLDYSPETKLKDLSVSDIQMLEILKAISYNAE
FT                   IIIMDEPTSAITQKEVEVLFKKINQLRDRGSSIIYISHKMDEIFRIADEITVLRDGCVV
FT                   DSRPKDEYDIDMVIAHMVGRKLDGNFPKEDIKIGEKILEVKDLTNQGNFKDINFHVNEG
FT                   EIVGFAGLMGAGRTEIMRSIFGLDGYQEGEVFIKGEKVVIKNVKSSIDKKMVMLSEDRR
FT                   RYGIIPVRSVKENVSLSSLKKFIYGGKLHAKKETDTIQDYATKMRVKTPSIETSIESLS
FT                   GGNQQKVILAKWMLTDPDILILDEPTRGIDVGAKYEIYKLMSELSKQKKGIIMVSSELP
FT                   ELIGMCDRIYVMAKGRIMGELKRDEFTQEGIMKLATKKTS"
FT   gene            618127..619116
FT                   /locus_tag="Amet_0588"
FT   CDS_pept        618127..619116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0588"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ret:RHE_CH01211 probable sugar ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46815"
FT                   /db_xref="GOA:A6TKU7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU7"
FT                   /protein_id="ABR46815.1"
FT                   /translation="MKTDRMKKIWSDIKSKYSIFLVLAALVIVSWIANENFLSVGNLSN
FT                   VSRQIAVVTILAFGQTILIISGMLDLSSGSVLALAGVLSVSVYTMTESLLLAFIVAILA
FT                   SVACNMLNGLMVTKFKAPPFIATLAMMTMARGAALLYTNGQNIYQIGDYVKFGQGSTFG
FT                   VPTPIVFMIIILFITWYILKHTTLGRSVYAIGGNEEAANASGINVNKVKMKAFIVNGIF
FT                   VGIAGVIFMSRVNGGMPNGAVGYEFKSLTAAIIGGTSFTGGIGTAVGTLAGSFIVGFLD
FT                   NIMVLTRVNSYLQQIVRGAIIALAVIYDIWSKQKRTKKKLGNIQEKSK"
FT   sig_peptide     618127..618234
FT                   /locus_tag="Amet_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.673 at
FT                   residue 36"
FT   gene            619165..620151
FT                   /locus_tag="Amet_0589"
FT   CDS_pept        619165..620151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0589"
FT                   /product="ABC-type sugar transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: bha:BH2323 putative simple sugar transport
FT                   system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46816"
FT                   /db_xref="GOA:A6TKU8"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU8"
FT                   /protein_id="ABR46816.1"
FT                   /translation="MKKKLIVLLAITLIMAMLAGCTSPANNGAGGDENGETVYRVAYVA
FT                   RTQSDSFAAWLANAISEEADKYDNIIIDVFDGQASDSTQNSLIENAITSNYDAIIIQPN
FT                   NGEAQKSYAEQAVAAGIITITTNARIEGVQGASSVDADPYEQAKVNADVALEQIPQNAN
FT                   VVVLKGPPGNFHADARRDSWQKEFFDKRPDVTIVGEEIANWNKDEAMTYMETWVQANSK
FT                   IDAIIAMNDNMAAGALEVVRDDSNFAGMLSYGVDGTAEAVLLIQEGVMTQTSLQSAYDL
FT                   ATALLDTSNKLLTGAETQIDIDIDAPVINSDNVEEYVEMHKRAGAIR"
FT   sig_peptide     619165..619248
FT                   /locus_tag="Amet_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.426 at
FT                   residue 28"
FT   gene            620247..621287
FT                   /locus_tag="Amet_0590"
FT   CDS_pept        620247..621287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0590"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   cpf:CPF_0732 L-iditol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46817"
FT                   /db_xref="GOA:A6TKU9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKU9"
FT                   /protein_id="ABR46817.1"
FT                   /translation="MKNRAVFMQGTDNMVTKDVPMPKIKEKDVLIKVDIVGICGSDVHY
FT                   YKHGKIGDFVVEGEFILGHEAAGEVVEVGEQVKGLTVGDRVTMEPGKTCGKCEFCKGGK
FT                   YNLCPDVEFFATPPYHGVLTNYVSHPEDMCFKLPKNVSNVEGALVEPLAVGLHASDQGG
FT                   VKLGDTVVIFGTGCIGLMTIISCKAKGAAKIIVVDILENRLEVAKKVGATDTINAKEVN
FT                   VLKKIQELTDGKGAEVVIDAAGAAITVKQTVDAVKPGGTIVLVGMTPKDEVEFNFMKLM
FT                   GKEAEVKTVFRYRNLYPIAINAIASGAINIKDIVSHEFDFEQTKEAFDFVAEHASDVVK
FT                   AVIKIK"
FT   gene            621325..622797
FT                   /locus_tag="Amet_0591"
FT   CDS_pept        621325..622797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0591"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: mta:Moth_2025 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46818"
FT                   /db_xref="GOA:A6TKV0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV0"
FT                   /protein_id="ABR46818.1"
FT                   /translation="MYFIGIDIGTTSVKIIAIDEDGKIVKSVSKEYPLSYPKPLWSEQD
FT                   PEDWWKQSINGFKELLDDLDKKEVKAIGFSGQMHGLVTLDENDKVVRPAILWNDQRTEK
FT                   ECNYLNNEIGQSKISQWTGNLALAGFTAPKILWLKENEPDNFAKTKKIMLPKDYVAYKM
FT                   SGVFATDMSDASGTLYLDVKNRKWSSEMLRVLGVTESQLPDLFESYEAIGCMKPDIAQE
FT                   LGLSKDVKIIIGGGDQAVAAVGGGVVKAGSCSLSLGTSGVVFTSNEDFFVDENNSLHSF
FT                   CHANGKYHLMGVTLAAAASLKWWVEGINKSDDFDGLLNEAKDAEVDDQLFYLPYLMGER
FT                   TPHNDPNARGTFIGLNITHERKHMTRAVLEGVAFSLRDTFEIMKAMGVEINDISINGGG
FT                   AKSTFWCEIIADVLNVKVNKLNSNEGPAYGAAILAAVGFGRFHTVEEACSQFIKITESI
FT                   NPNEENSKIYNEKYGKYTKIYPATKELFKQLI"
FT   gene            622972..623955
FT                   /locus_tag="Amet_0592"
FT   CDS_pept        622972..623955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0592"
FT                   /product="pyridoxal phosphate-dependent enzyme, D-cysteine
FT                   desulfhydrase family"
FT                   /EC_number="3.5.99.7"
FT                   /note="TIGRFAM: pyridoxal phosphate-dependent enzymes,
FT                   D-cysteine desulfhydrase family; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein, beta subunit;
FT                   KEGG: ssp:SSP0338 putative
FT                   1-aminocyclopropane-1-carboxylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46819"
FT                   /db_xref="GOA:A6TKV1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV1"
FT                   /protein_id="ABR46819.1"
FT                   /translation="MTIPKSLKLANLPTKIEKLERLSKSLGDINIYIKRDDQTGTEVSG
FT                   NKVRKLEFAVQEALDQGCDYLITCGGIQSNHARATAAVAAKLDINSYLVLRSNGDDPVE
FT                   GNYFLNKILGAEICLITPEEYRDNRMKVMEEIQRELAGQGHKAYILPEGASNGIGTFGY
FT                   YQAMEEILEQEAELDVKFDAIVTAVGSGGTYAGLFYANKLRKNEAKIYGINVCDDADHF
FT                   KNRVQELVHESIQYTKRPIHFKKEDIHMIDGYVGEGYAQSRQEELTFILDFAKLEGIIL
FT                   DPVYTGKAMYGLVEEIKKGSFNGFKNILFIHTGGLYGLFPKGNQLF"
FT   gene            complement(623952..624608)
FT                   /locus_tag="Amet_0593"
FT   CDS_pept        complement(623952..624608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0593"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: tte:TTE1807
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46820"
FT                   /db_xref="GOA:A6TKV2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV2"
FT                   /protein_id="ABR46820.1"
FT                   /translation="MIFIKLEFIGYIYDNNIVINPYEKEEYYMQSVDQSLQLLKDIRSI
FT                   RKYKKDPVSRSILEQIIDCGRMSPTAKNQQPWEFIIVDDKKLLTALGEVTPHGEFLKNA
FT                   PACIAVFTKTSSSYYIEDGSAATQTILIAARLHGLKSCWIAGNQGSYDGEEIPLCEGIP
FT                   CYEPKNSIPLTEEVQKILKTPQDLQLISIVSIGYSDESPIVEKRPLEEVIHWNQF"
FT   gene            624743..628168
FT                   /locus_tag="Amet_0594"
FT   CDS_pept        624743..628168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0594"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   zinc finger, SWIM domain protein; SNF2 helicase associated
FT                   domain protein; SMART: DEAD-like helicases-like; KEGG:
FT                   cth:Cthe_2451 SNF2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46821"
FT                   /db_xref="GOA:A6TKV3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV3"
FT                   /protein_id="ABR46821.1"
FT                   /translation="MGIMKGIKGNFKFFDLDGLIIVSKLRLMIYYSDKEKIGFILLVYL
FT                   TKIKSSNNHSVREMRESMLRINRELLEDIVSHPNAYYNGVEYHKKNRVVDLKFRRDKKH
FT                   FIAKVKGSNHYDIEVNFNQQGEMGEATCTCPAYDRFWGYCKHIVAVLLSIKEIDERGGL
FT                   YKKNGNQQIDSILEYFHNQQLNERISVKLQIYYEVERHSMDETVESYLTLKVGEERMYV
FT                   VRNIKEFIENVYNVKPQYFGKQFTFEPEIHGFGEGDQRVLDLIYEIHENETLSDSSFLG
FT                   KSGNTLFDGKRVQLGDQALKRFLNLIREEKLQTEDRVKVCILDREPQNILVYEGDLPVD
FT                   FQLEKQGEETILKLNYQGDVIRLVADGEYFLTHHGICRVTEQQRSGFMPFYRTMVVNQT
FT                   NKLVIPKEKEEQFISEIYPIMKAVGKVEISPELSKTIYSPPLKAEVYFDQVDQLVKAEI
FT                   RWVYGNMTLRPFEESKKEAGQILLRDIKKEEEIIGFFERNQFKIKNKQIYLEEEAAIFQ
FT                   LIYKELDKLQKISEVYYSETFKGMELKSAASFRGGIQLNREEDLLEFQFDIDGIEDHEL
FT                   TDLMESLRKKKKYYRLKDGSFIPLEEERLIAIDELMKQLDLSGENIHGKVIEIPKFKGI
FT                   FVDEFLKQRDLGFVKKNKAYRQFIEDIKEFEEVEYDEPQELKEILRNYQRLGFRWLKSL
FT                   TRYGLGGILADDMGLGKTLQILTYLVDEKEKRGQGTALIVSPTSLVYNWIAEVEKFTPE
FT                   LRIKAIVGSKNEREEIMKEIDEYDIIITSYPLIRRDAELYETRSFRCCILDEAQHIKNP
FT                   VSQNAKAVKAIRATHRFALTGTPIENSLTELWSIFDFVMPGYLLSHHKFKGRFEKPIVK
FT                   DRDSEALASLGKLIRPFVLRRMKRDVLQELPEKIESKMVAELTEDQKKLYLAYLKQIKG
FT                   QIQEEIEQNGFERSQMKILAGLTRLRQICCHPSLFVENYEGGSGKLDLLEEVVAASLEA
FT                   GHRILLFSQFTSMLKMIREKLDQQGIEYAYLDGSTPMEARGEIVKEFNEGKGSIFLISL
FT                   KAGGTGLNLTGADTVIHFDPWWNPAVEDQATDRAYRIGQKNKVHVMKFIAQGTIEEKIF
FT                   KLQERKKEMINAVIQPGETFLAKMNSQELMELLK"
FT   gene            628403..628684
FT                   /locus_tag="Amet_0595"
FT   CDS_pept        628403..628684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0595"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   swo:Swol_1410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46822"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV4"
FT                   /protein_id="ABR46822.1"
FT                   /translation="MMNIKPSAAIRKNYNEISELCKRSGEPVYLTKNGEGDLVVMDIEA
FT                   FARRESMLLLRENLIASEEGRLSGKKGYSIDEVSNMMKDAVKEVLDGQ"
FT   gene            628674..628991
FT                   /locus_tag="Amet_0596"
FT   CDS_pept        628674..628991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0596"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   dsy:DSY1238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46823"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV5"
FT                   /protein_id="ABR46823.1"
FT                   /translation="MDNEGKLYKVIISDEAAQMLVSHSRFLTQVSETAALQLIAEFNKK
FT                   AKSLERFPERNPWLFDLLVPSGKYRRLLMAKRYLLVYQVKESTVYVDAVVDCRQDYGWL
FT                   L"
FT   gene            629292..629876
FT                   /locus_tag="Amet_0597"
FT   CDS_pept        629292..629876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0597"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bld:BLi02021
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46824"
FT                   /db_xref="GOA:A6TKV6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV6"
FT                   /protein_id="ABR46824.1"
FT                   /translation="MASQSEIKYNRLVEKAEMLFIQFGYKAVSVDEISEAAGISKMTIY
FT                   KYFDSKETLFIEVMLLLMDRQYNLIEAKLNDISGTLEKINFMMNYSLEGAKDYSLALYK
FT                   DIMNIPHITERLIAVKNEKNKVLFESMIREGMEKGEVKRGDVVFMADMIIMMIEAFGQR
FT                   HFYKINNREDLEGLTKSLFDFLKYGLLGGGA"
FT   gene            629882..630592
FT                   /locus_tag="Amet_0598"
FT   CDS_pept        629882..630592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0598"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: swo:Swol_1715 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46825"
FT                   /db_xref="GOA:A6TKV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV7"
FT                   /protein_id="ABR46825.1"
FT                   /translation="MESNVLMKVENVNKIYEMGEVKVAAVKEIDLELYQGEFVVILGPS
FT                   GSGKSTLLNILGGMDLPTQGKVFMEGQEITDYNDRKLTNYRREKIGFVFQFYNLMANLT
FT                   ARENVELATEICKNALNIDEVLEAIGLGERKEHFPAQMSGGEQQRVAIARAVAKNPALL
FT                   LCDEPTGALDFETGIKILSLLKKINQDYNKTVVIITHNMPIGEMADRVIKMRSGEIIEV
FT                   KVNDNPIHPEGIEW"
FT   gene            630592..632949
FT                   /locus_tag="Amet_0599"
FT   CDS_pept        630592..632949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0599"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   swo:Swol_1714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46826"
FT                   /db_xref="GOA:A6TKV8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV8"
FT                   /protein_id="ABR46826.1"
FT                   /translation="MKKLDVRLLRMIKNTKGQFISIVVVIILALTIYGSFNMMADNMGN
FT                   TISHYYEITNFGDVFVEVVRIPRAAIDQLTTIEGVEVAQGRVTADVPLRVEDPNEKVNV
FT                   RIVSLPREDYRINELYTIEGREMQEDVRTTVVLEQFSEARGIQLGDQITPYIAGREYPL
FT                   EMIGIVGSPEYIYLMENQQSLLPTPERFGVIYVTEEFAQSVLGFQGSYNEVMIKIEDEH
FT                   LDRIDSITDEIEDQLDRYGVRRTIKREDQLSNSMMMEEVSQLDQMATSVPLLFLVVAAV
FT                   IINIMLSRIVKNDRMAIGVMKALGYGNFNIMGHYVKYALAIGLVGAVIGIIFSVFLSQA
FT                   FTNLYIQFFNIPLLQMDVYYIYVLYGLILTSVFCIVSGLIGARSVLRILPADSMKPEAP
FT                   KAGGRILLEKVKFIWNRISFSWKMVIRNILRNKKRGIFLVLGIALTFGITMLPIFMTSV
FT                   WGNLFTIHYGEFQTMEYNVDFAHPMNDNAIRELQQIIDVDHIEPKIEIPFELRNGWRKQ
FT                   VVSVIAVPRDTRFYHFTSPSKQSINLDTRGMIITEGIARSLGAQIGDEILLKSFMPDQE
FT                   DQLIRVSGITQQLLGSNGYMDIETMNDVLGERGIITGALIDSQDDVSLKLQDVKNISLV
FT                   QSVEDMKNSFEEFMEMMIYSVSILMLFGGILGFAIVYNTTIISISERIMEFSSLRVLGF
FT                   EKNEIYKMISRENAVMTVLGIAVGVPVGYGMCYGIVSAFETDLYKIPLIITPSSYVFAA
FT                   MMTAFFVAIAQLATIRKIYKMNFIDALKNRIS"
FT   gene            632992..634224
FT                   /locus_tag="Amet_0600"
FT   CDS_pept        632992..634224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0600"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; secretion protein HlyD family protein; KEGG:
FT                   dsy:DSY1327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46827"
FT                   /db_xref="GOA:A6TKV9"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKV9"
FT                   /protein_id="ABR46827.1"
FT                   /translation="MKKKIIGAIIIVIVLGAAAFFMMNRGIVVEVEMAAVTQGNIAKYV
FT                   EELGVVKTKNQASVYADTAGRVTDVLVKEGEQVNTGDVLVRLDSQQLSRQKRELEAQRL
FT                   GIIAQYNEATQSIDEKEIEKLELEIEVIERRIKEAKRVVENNKRLYEAGAISYEEYNIT
FT                   VTSLEAEQSNLEGVQLDLELIKKPISENISAQYEAQLRQLDIQMEALESQSGDFVITAH
FT                   MSGTVLMKAVEKGSYVQPGVPLLEIGDTEILYIESDLLIGDIANVEVGAPVIISNKDLR
FT                   IIDLQGTVTKIHPQAFSSVSDLGIEQKRIKVDIEFEGSVAILRPGYDLDVNIIIESKEN
FT                   VLLIPENAIFQQAGRDFVFVNVNEQAILREIEKGIESQRRVEIVSGLQKGDQVIVSPSG
FT                   ELEEGVQIKSK"
FT   sig_peptide     632992..633084
FT                   /locus_tag="Amet_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.297 at
FT                   residue 31"
FT   gene            634291..635652
FT                   /locus_tag="Amet_0601"
FT   CDS_pept        634291..635652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0601"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dsy:DSY4423 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46828"
FT                   /db_xref="GOA:A6TKW0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW0"
FT                   /protein_id="ABR46828.1"
FT                   /translation="MKVLLVRPARIKQAVTLGEFMYSEPIGLEMVYAMLENQHHVEIVD
FT                   MMSEKITLEDKLKAFQPEVVGITSLCIDVFAVRALAEAVKKYDPSIITMVGGTQSFLNP
FT                   EAFFTETIDHVMKYTNTENMTTLFGYLQRGEQPPIIHGICSGVNDFKTTDKCGMNQYVH
FT                   PNRKATAKYRRQYSYFGYRPCAIMGTSQGCSKTCSFCLRWRIEGATERYLPMDFVKEEI
FT                   RSIEEDNIMVFDNDFLHNGDRIEELCNFLQEEGIHKNFICYASVNSILSNKEVIKRFTK
FT                   LGLSTVLVGYETFKEEELKKYQKKSSTDDNLNASQFLKEIGLDVWASFMIHPDWSVADF
FT                   KEFRRYLKKLNPEISTFSPLTPFPNLPLYNEYKDRLLIQKEEYEKWSFGQVTINPSKMS
FT                   LRKYYYEILKTILYVNLVRNNILYMISRFGITSILRLFKGSIKAFIKYIQLMMQ"
FT   gene            635777..637660
FT                   /locus_tag="Amet_0602"
FT   CDS_pept        635777..637660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0602"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; NMT1/THI5 like; KEGG:
FT                   wsu:WS1436 putative two-component sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46829"
FT                   /db_xref="GOA:A6TKW1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW1"
FT                   /protein_id="ABR46829.1"
FT                   /translation="MNKNKTYIVVIIIMILYIFPIDRVQGLDEAVLQLRWDHQFQFAGY
FT                   YTALWNGYYEEEGLEVEIRSAFTEEGDVLQATQEVAEGDADFGVGAVDILIANDEGLDL
FT                   AVLASIFQRSAVEFFMKEETPFSTMADLVNLQVARRKDDLMDIELQAMLMAEGIDPKQL
FT                   KLYEHRGNFAIEDLGDDGFDMVPIYLRNILTYPEEEGVQLKSIRPIDYGIDFYGDSLFT
FT                   RGSLAKENPDKVEAFKRASLKGWEYALENPEEIIEKMVVAFPPQEKTEKEFRAFNVFQA
FT                   REVLELTLHPVVEIGNINPHRWWGTQEVLKKLNLVSGDLDRENFIFSYDRILQQQAERK
FT                   EKFLQIFSLISVVILLIVLIIYLTAKSTIRKLEKMFQREWEENKRKEGIIIYQARLAAM
FT                   GEMIANIAHQWRQPLNNLGLILNNIEDAYHYEELTKKSLEEDIERSRRLIHKMSETIDD
FT                   FRNFSNPNTKKDEFSIHENIMMVLDLMEERIKLHHIEVVFKDISTKKAYGYSNQFAQGI
FT                   FNVISNSIDALIDEKGGKRQIFIGIYEQGNDVITEIEDTGGGISEAIADKVFDLYFTTK
FT                   EDTQGTGLGLYMTKVIIEKNLKGSLHWKNTDRGVKMMIRIPCKGVDGNVTD"
FT   gene            637647..638432
FT                   /locus_tag="Amet_0603"
FT   CDS_pept        637647..638432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0603"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ppd:Ppro_0115 response regulator receiver modulated
FT                   diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46830"
FT                   /db_xref="GOA:A6TKW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW2"
FT                   /protein_id="ABR46830.1"
FT                   /translation="MSQTEKNSVLYHLKVLYVEDEPDTREEMTKFLKRRVGKLYVAKNG
FT                   LEGIAAFDQNQPHIVVTDLKMPVMDGLEMIKAIRNREHQPAIIITSALSDSETILAAVD
FT                   IGIVKYVVKPIHPKELMMSMESIGKEILSHQIDIGDVNHIWLGDKEKKAELEKRIKSEL
FT                   AHFIKKYSGRGPKDLQVFIEGNHIQVNIFESLTAFELQLIANNRNHSLVEYNRKLFYME
FT                   GSSKIEKALTLIIGMPVTLKEVYCDCRKKIDEITFSIST"
FT   gene            638746..640101
FT                   /locus_tag="Amet_0604"
FT   CDS_pept        638746..640101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0604"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: efa:EF2573
FT                   xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46831"
FT                   /db_xref="GOA:A6TKW3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW3"
FT                   /protein_id="ABR46831.1"
FT                   /translation="MVENSSKSRSVFNVDGVPSLGKAAPLGLQHVLAMIVGNVTPAIII
FT                   AGVVGLNSPDRTLLVQMAMFIAGIATLIQLYPIGRVGSRLPIIMGVSFAYVPSMIAIGA
FT                   QHGIAGIFGAQLVGGLVAIVVGIFIKPIRKYFPPLVAGTVVFTIGLSLYPIAINYMAGG
FT                   VGAATYGSFTNWGIALITLTVVLFCNQFAKGYFKLASILVGIIVGYVIAIMIGIVNFTP
FT                   VAEAAWIAIPRPLHFGIEFYPSAIITMVIMYIVNSVQAVGDLSATTMGGMGREVTDEEL
FT                   SGGIIGNGVSSVVASFFGGLPTATYSQNVGIVAMTKVVSRFVLALAAGLILIGGFVPKF
FT                   GAIMTTIPQSVLGGATITVFAIITMTGIKLIIQDELSGRNVTIVGLAVALGMGITTVPQ
FT                   SLELFPDWVMMVFGSSPVVIATVVVFTLNIILPKKSLADEKAEREEMEMKEG"
FT   gene            640104..640907
FT                   /locus_tag="Amet_0605"
FT   CDS_pept        640104..640907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0605"
FT                   /product="molybdopterin dehydrogenase, FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG: dps:DP3068
FT                   similar to 4-hydroxybenzoyl-CoA reductase (HcrB)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46832"
FT                   /db_xref="GOA:A6TKW4"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW4"
FT                   /protein_id="ABR46832.1"
FT                   /translation="MIDIKNYVVPKSIDEAYEVLASNRLAMLLGGGAFIRMGNKRTNYM
FT                   IDLSKCNIEGIIETETDIEIGAMTTFGEMERSDVLKKHFNDLLACSVKEIVGVQLRNIV
FT                   TVGGTVYSRYGFSDLITGLLALDTYVNLHKGGLIPLETFLIKGPESKDILKSVLIKKDN
FT                   RKAAFKAMRNSKGDYAILNAAVSKVGNDIKIAVGARPGRATLAYETMAYLKENGISTES
FT                   LPHALDLLTKEMNFGTNGRGSQAYREKICRVLVKNGLEEVGFHED"
FT   gene            640897..641364
FT                   /locus_tag="Amet_0606"
FT   CDS_pept        640897..641364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0606"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: dps:DP3067 4-hydroxybenzoyl-CoA reductase (HcrC)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46833"
FT                   /db_xref="GOA:A6TKW5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW5"
FT                   /protein_id="ABR46833.1"
FT                   /translation="MKINVKINDENTSFEISPDEYLVETLRKNGYIGVRQGCDTGTCGV
FT                   CTIHVDGKAVLSCVLLSAKVDGSEITTIEGVQEKAKVIGKHLVDEGVDQCGYCSSGTIM
FT                   SILYLEKCIENPTDEEILHYLNGNLCRCTGYVGQLRAIKKYFGGRLHENRK"
FT   gene            641348..643642
FT                   /locus_tag="Amet_0607"
FT   CDS_pept        641348..643642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0607"
FT                   /product="Xanthine dehydrogenase"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: dps:DP3066
FT                   similar to 4-Hydroxybenzoyl-CoA reductase (HcrA)"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46834"
FT                   /db_xref="GOA:A6TKW6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW6"
FT                   /protein_id="ABR46834.1"
FT                   /translation="MKIVNSSIPKIDGMSLVTGKPAYTDDLAPKDALVVKVLRSPHAFA
FT                   KITDINTAIAEKVPGVACIFTYKNVIRKAFTRAGQCYPELAPYDKFLLDEYVRHVGDDV
FT                   AIIAAKDEKTATKAMKLIKVKYDVLQPILNLEKAEESAPVHPEEDIYTNLEVGFDREKN
FT                   TVAKVAFELGDLENALEESDVIIERTYRTQAQAQGMMESQASYSYLDNYNRLVVVSSTQ
FT                   IPFHVRRILAQALDIPASKIRVVKPRIGGGFGSKQTAQSEFYPALVTLKTGKPAKIVYS
FT                   RREVFRGTNSRHAMTFTIKIGASQSGKIKAIDMNGLWDTGAYGEHALTTLGSAGKKVLT
FT                   LYNKVDACRFSGKAFYTNHVPGGAFRGFGVTQGIFVLESAVNELAHELKMDPVKLREIN
FT                   MIKKGETTRLYNMVTKGAGDAPMYMDSCLLEECVTRGKQLIDWDHKYPRTERSATKVRG
FT                   VGMAISQQGSGLPNIDMAAATLKLNDDGFFTLFLGASDIGTGSDTILTQIAAEALGVDM
FT                   DKIVTYTSDTDLTPFDSGAYASSTTYTTGNAIIDAAEKMIQLIIATGAKYFETQEENIL
FT                   FDGTKITCQDSGEEITLASFSQKITYSMIHEQLSVTGSYVPKKAAPPYMAGFAEVEVDL
FT                   ETGKVEVIDFVGVVDCGTPINPNLARIQVEGGIVQGIGFALYEEVNYTKEGRLMNDTFM
FT                   EYKMPTRRDIQNIQVELVAGYDETGPYGAKSIGEVVINTVAPAITDAIYNACGVRIKEL
FT                   PATPEKVLMQL"
FT   gene            644177..645730
FT                   /locus_tag="Amet_0608"
FT   CDS_pept        644177..645730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0608"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="TIGRFAM: flagellar M-ring protein FliF; PFAM:
FT                   secretory protein YscJ/FliF family protein; Flagellar
FT                   M-ring C-terminal domain protein; KEGG: tte:TTE1442
FT                   flagellar biosynthesis/type III secretory pathway
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46835"
FT                   /db_xref="GOA:A6TKW7"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW7"
FT                   /protein_id="ABR46835.1"
FT                   /translation="MSEVVEQIRNQLNEYIQGLDKNKKIKIGLSALFILISLTGIIYFF
FT                   SRPDYVVLYNNLNPEESGSVMETLQGSNIRADFGDTSGTILVRKQDEKRAQVVVATQGL
FT                   PTARFSYEDAFSGNSWMMTSEERAQRILIAQQNYLASTMEEIPGVSKAVVNLTIPERTG
FT                   FMMADNNANAKASVWLDISSNANLESGSIKGIAILVSNAVQGLEPENVTIHGPDGRVLN
FT                   QEAGSDSSLLGASDQMNLQQAVQKDLEKSITDFLSSVYGHGNVVVMAGVRLGFDSNVTE
FT                   LVEFAPPIEGQETGIIRSMHELTHTAIDGPGGGIPGVDPNVGDIPQNVEDDEYLSRYDE
FT                   ASQTINYEINELRQKIVKAHGQVHDISVAVYVNKSTLADGDLSDQERRELINIVSAAAG
FT                   LDTRVVQVGVQEFNDSLADQWQLAMDGNLAAGEGGQPWWLIGLLATLILGAAYIVINKV
FT                   RKNRSQEEEILVQDVMIPDELEEINLDLSGSQVKQQIEKLVNKKPDAVAQMLKNWINEE
FT                   "
FT   gene            645741..646760
FT                   /locus_tag="Amet_0609"
FT   CDS_pept        645741..646760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0609"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="PFAM: flagellar motor switch protein FliG; KEGG:
FT                   cth:Cthe_0466 flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46836"
FT                   /db_xref="GOA:A6TKW8"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW8"
FT                   /protein_id="ABR46836.1"
FT                   /translation="MSKRAGKGELTGREKAAILLISLGPEYSAQIFKHLTDEEIEELTL
FT                   EIANMRRVSPLEKEKVLAEFHEVCIAQEYISEGGINYAKDVLEKALGSQKAMDIINKLT
FT                   ASLQVKPFDFARKADPNQLLSFIQNEHPQTIALILAYLSSTQSAQILSALPQAKQSEVA
FT                   RRIATMDRTSPDIIKEVEMVLERKLSSLVNQDYTSTGGIQAIVDILNSVDRGTEKNIMD
FT                   TLEMQDAELAEEIRKRMFVFEDIISLDSTSIQRFIREIDNKELAIALKGATEEVSDVIY
FT                   GNMSKRMAEMIKEDMEFMGPVRLRDVEEAQQKIVNIIRKLEEAGEIIIARGGGDEVIV"
FT   gene            646756..646929
FT                   /pseudo
FT                   /locus_tag="Amet_0610"
FT   gene            646954..647370
FT                   /locus_tag="Amet_0611"
FT   CDS_pept        646954..647370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0611"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: tte:TTE1431 flagellar basal body-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46837"
FT                   /db_xref="GOA:A6TKW9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKW9"
FT                   /protein_id="ABR46837.1"
FT                   /translation="METKKVIIYALIALVLSTVVFGGILYFTIFRTPDEMPAEVKVYEY
FT                   NLGGFSTNLSTVRSYFKGEMVIETTEKALLSVFVEKNAELRDQIIKVFIGKESVDILDP
FT                   DGQQQLREELIRVISNVTKSDKITNLYFVDYIIQ"
FT   sig_peptide     646954..647022
FT                   /locus_tag="Amet_0611"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.959 at
FT                   residue 23"
FT   gene            647383..648378
FT                   /locus_tag="Amet_0612"
FT   CDS_pept        647383..648378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0612"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; flagellar motor switch protein FliM; KEGG:
FT                   cth:Cthe_0477 flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46838"
FT                   /db_xref="GOA:A6TKX0"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX0"
FT                   /protein_id="ABR46838.1"
FT                   /translation="MSDVLSQNEIDDLFQALNSGEVEIDEMKDEKIEKKIKSYDFKSPK
FT                   KLAKDQLRTLQIIHDNFSGMLNTFLAGYLRTYVQAEVLTVEELSYYEFSNSVVNPAVLS
FT                   IINFTPLEGQIIVDISPSISFTLIERILGGMGKETEEIRPFTEIETTLIKNLMRQVINL
FT                   MIDPWENVIELQPKLDKIETNSQFAQIVSPNDTVALITLNLKIGDVEGMMNICIPHIVI
FT                   EPILDKLSTKLWFSNSSKPVTERDKKALQKRVEKSAVDITAQLGSTCVTVKDFLELQMG
FT                   DVIMLDNPVDKELQILVGDKIRYRGLPGTSKNKLAVKVTGIDQKGDEIYE"
FT   gene            648371..648802
FT                   /locus_tag="Amet_0613"
FT   CDS_pept        648371..648802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0613"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   tte:TTE1429 chemotaxis protein CheC, inhibitor of MCP
FT                   methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46839"
FT                   /db_xref="GOA:A6TKX1"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX1"
FT                   /protein_id="ABR46839.1"
FT                   /translation="MNDDMISQEEIDALLKGSTNISSDNDRIDEVQPSTKQSKVSVQPI
FT                   QFQAFEQVSSKGVPENISTIQDVPLSVTVELGRTVKKISEVLEFGPGTIIEVEKLVGEH
FT                   VDILVNGQYVAKGEVVVIDENYGTRITEIAKVGNRLSKI"
FT   gene            648936..649298
FT                   /locus_tag="Amet_0614"
FT   CDS_pept        648936..649298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0614"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   cth:Cthe_0479 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46840"
FT                   /db_xref="GOA:A6TKX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX2"
FT                   /protein_id="ABR46840.1"
FT                   /translation="MSNRVLIVDDAGFMRMTIKDVLTKNGYEVVGEAENGLKAVEKFKE
FT                   LEPTLTIMDITMPEMNGIEAVKEIKKIDANAKVIMCSAMGQKSMVIEAIKAGAKDFIVK
FT                   PFQEDGVIQAVQKVLG"
FT   gene            649363..651390
FT                   /locus_tag="Amet_0615"
FT   CDS_pept        649363..651390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0615"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: cth:Cthe_0485
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46841"
FT                   /db_xref="GOA:A6TKX3"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX3"
FT                   /protein_id="ABR46841.1"
FT                   /translation="MKFGDIIVAVAVIAIVIIIIIPIPLAAVDVLLSFNISLALLILLI
FT                   AMYTKEALEFSIFPSILLLTTLLRLSLNITTTRYILSTGNAGSLIDTFGNFVIGGDAIV
FT                   GFIVFLIIVIVQFLVITKGSERVAEVAARFTLDAMPGKQMAIDADLNAGLIDDHQARDR
FT                   RKKIQREADFYGAMDGASKFVKGDAIAGIIITMINIVAGFAIGSMGGLSMGEAMRTYTL
FT                   LTVGDGLVSQIPALLISTATGIVVTRAASEDNLGSDVISQLFKQPKIMFIISGFLMAFA
FT                   FATPMPVFPFFSLGTLFLYIGMNLRKKFRESEIETQPDEIQEAADEKRKPENVMPLLNV
FT                   DPIELEFGYGIIPLADSNQGGDLFDRLVMIRRQCAMELGVIVPMIRLRDNIQLEPNQYV
FT                   IKIKGVEITSGEIVFDHYLAMNPGLAEGELEGIDTVEPAFGLPAKWINEEERENAEMYG
FT                   YTVVDPPSIIATHLTEVIKKHSHELLGRQEVKKLIDNVKETNSVLVEELIPSQLSLGEV
FT                   QKVLANLLKEGVSIRNMVTILETLADHASMTRDVDMLTEYVRQGLGRAITKQFITTQPA
FT                   KVITLEQSLEQKIMDSLQQTERGTFISIDPEIVQVILRNLSKQVQNMMSLGEQPIVITA
FT                   PIVRLYFKRLSEQLTSDLVVLSYNEVDPSVEMESVGAVSV"
FT   sig_peptide     649363..649446
FT                   /locus_tag="Amet_0615"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.745) with cleavage site probability 0.447 at
FT                   residue 28"
FT   gene            complement(651485..652816)
FT                   /locus_tag="Amet_0616"
FT   CDS_pept        complement(651485..652816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0616"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: bha:BH4045
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46842"
FT                   /db_xref="GOA:A6TKX4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX4"
FT                   /protein_id="ABR46842.1"
FT                   /translation="MENSIAKEYNLVSLLKFALPTIVMMVFMSIYSIIDGIFVARFVSI
FT                   NALSAVNIVYPILSTILAMGLMLATGGSAIIAKKIGEEKLEEARKNFTLIILVGTAIGL
FT                   GIMLLGLLFIKPILSILGANKELFYLSHEYATTFLFFTPLAILQMLFLNFFITAGRPKI
FT                   GLALTVIGGCANIVLDYYFIVTLGMGLMGAALATGIGMAIPAVIGLFYFSFYRKGILYL
FT                   VRPQFDTKVLVQTCINGSSEMVTNLSLAIVTLLYNLIMMKYLGIDGVAAITVLLYTQFL
FT                   LTAIFLGFSMGVAPIISYNYGSQNIIQIKRIFKYSMIFTFAGSLAAFVNSLLFAPFLIQ
FT                   IFAQKASNVYTIALDGFTIFSISFLFSGFNIFSSAMFTAFSNGKVSAIISFMRTFVFIA
FT                   IGLLLLPLIMGVTGAWWAITLAEFLSMLMCLLYLIKYKKRYSYM"
FT   gene            652904..653725
FT                   /locus_tag="Amet_0617"
FT   CDS_pept        652904..653725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0617"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: bsu:BG10904
FT                   transcriptional regulator of the bltD operon"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46843"
FT                   /db_xref="GOA:A6TKX5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX5"
FT                   /protein_id="ABR46843.1"
FT                   /translation="MKKKSHIYFTTGEFANLVGVSKDTLFHYDKIGVFSPEIKGNNHYR
FT                   YYSVYQAEVFNVIATLKEVNMPLKEIKAYLNKRTPDEYILLLEKEEASLDTKIRELQKM
FT                   KGLISQKISITKSAVGINTSEILLEEKIKDEFLVITKTVPFTGEKSIAASIKKHYEYLN
FT                   EHNIISPYSLGCMVDSEKVFDDLDSYDYFFTKVSKTSDSYNFIREKGSYLTAYHTKGYL
FT                   NIKDTYDRILEFAKNEGLKPEGYFYEDVLLDELSVKEYDQYLIQISIKILK"
FT   gene            654230..654958
FT                   /locus_tag="Amet_0618"
FT   CDS_pept        654230..654958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0618"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: fnu:FN0219 autolysin response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46844"
FT                   /db_xref="GOA:A6TKX6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX6"
FT                   /protein_id="ABR46844.1"
FT                   /translation="MKLNIAICDDDTYHVESIKEFLCQLTKEHDTVIIEAYSGEELLDK
FT                   AQNKSINIAFLDIDMAGMNGIEVGKEIRKMFPEAIIVFLTGYKHYALEAFNLESFQYII
FT                   KPITHSKFQSLVEKIMIRLKEKESYKEQSRYFIIKNQKDVIKLEHNKIYFFERQGKKVL
FT                   VFSDQGSYEFRDTLKSVLISLDNALFVRCHHGFIVNTQKILKVQGDMIMFNDIDKNIPI
FT                   SRRYKPLILEHLQNNIFREK"
FT   gene            654968..656290
FT                   /locus_tag="Amet_0619"
FT   CDS_pept        654968..656290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0619"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   KEGG: cpf:CPF_0499 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46845"
FT                   /db_xref="GOA:A6TKX7"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX7"
FT                   /protein_id="ABR46845.1"
FT                   /translation="MNIIANLITNTIDIFLLYLFISYTVNNMKFRPIEPKDMYKLLFLI
FT                   AFNTTINQFLGLANLVGYILVLFTMSYTLSLIFNRSYLNIALIFLYGLALLFLSELIVV
FT                   YGIALIFNVDPSEMLMLNTYRILAIILAKFISFMVIHKWTERMPLLESIKNKKQLPLVL
FT                   MFLFNTIIIYLVFVFYRYLEGSLAISKILLFSVICAVLLFNWLSYILTRKVVYQEQQEE
FT                   LMKLKVREYENQSLYLKNAEELIEGIRSQRHDLNNYIGTLYGLLSLNKIETAKQYIESI
FT                   EEEFSSVNEIIDIGHPIIMVLVDLKREKARREKISFDIDIDVPRNLTIDDIDLSIVLSN
FT                   VLDNAIEACISSNSFNMTIDLKMYVNEGYLIIKIVNTKSPSYSINEESIEQSFTTKPDK
FT                   SNHGIGLRNIKKVIVQNNGYIKLNDKGTVMEIQIALPQIER"
FT   gene            656410..656991
FT                   /locus_tag="Amet_0620"
FT   CDS_pept        656410..656991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0620"
FT                   /product="Accessory gene regulator B"
FT                   /note="PFAM: Accessory gene regulator B; KEGG: dsy:DSY2528
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46846"
FT                   /db_xref="GOA:A6TKX8"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX8"
FT                   /protein_id="ABR46846.1"
FT                   /translation="MINKLACYTANKMVQTNAITRQDIDSYIFGTEMLIITLAKGIGLF
FT                   VIACFFGLLIEATIFILAFSSLRMQAGGFHARSFLKCFFITDIITFTSIYIAYIIPTDF
FT                   ILISQIAFLIWTIQLILQFAPIETPNKPLTSHEKRLYKTRSYIVVIIGTILALALSWTS
FT                   PHHSIYGLIFSLGFFCEGITLVPLFSKKAL"
FT   gene            657304..658134
FT                   /locus_tag="Amet_0621"
FT   CDS_pept        657304..658134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46847"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKX9"
FT                   /protein_id="ABR46847.1"
FT                   /translation="MKKTLNFTSILIIMIMLLTTIVPSFALESNDSPYVYTRDGVEHTV
FT                   KVIVDNNKERVVERTDSDGNTFITTYDKINNMIIREEKANGLNAQSVSEPVIMDLNVYN
FT                   SNHTVSPRHIEDDVEVIYRGTIFKDHYYRRRDIVTSVSHSVWYNLTIDDDSIATPALNP
FT                   SNSSDATTIRRATYFRDDIEMLDSRGSSFAGGIVVEVLTMDLSTAKSFVVGTSLSLSNS
FT                   YQSTRSGDYEDAVFDALYAFTNVIFPFSIIIDGALSCAAAQNAKNSFNLIKQSL"
FT   sig_peptide     657304..657384
FT                   /locus_tag="Amet_0621"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 27"
FT   gene            658891..660129
FT                   /locus_tag="Amet_0622"
FT   CDS_pept        658891..660129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0622"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron, maturase-specific domain
FT                   protein; KEGG: mac:MA4183 reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46848"
FT                   /db_xref="GOA:A6TKY0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY0"
FT                   /protein_id="ABR46848.1"
FT                   /translation="MKKEKPFQITKRAVFEAFKKVEANKGAPGIDEVTLQEYENNLEDN
FT                   LYKLWNSMSSGSYFPQAVRGVEIPKKNGGVRVLGVPSIDDRIAQNVMVSELNPKVEPIF
FT                   YEDSYGYRENKSAIDAIEVTRKRCWEYDWLIEFDIVGLFDNINHDLLMKAVKQHTNEKW
FT                   VILYIERTLKVPMVMSDGIHVERTKGTPQGGVISAVLANLFMHYAFDHWMTRKHSNNPW
FT                   VRYADDGLIHSHSLKEAEVLLLKLGERFKDCHLEIHPNKTKIIYCKDDNRKQNHIHTNF
FT                   DFLGYTFRARTVKTKKGNYFTGFTPAVSKIAIKSFMDKIKKLRKNSYLSLTELAEKMNP
FT                   IIRGWANYFDKFTASKVHAILSCVNLSLARWMMKKSKRYKNKFMAALRRLSSIAEETPS
FT                   LFVHWKMGICPKN"
FT   gene            complement(660216..661823)
FT                   /locus_tag="Amet_0623"
FT   CDS_pept        complement(660216..661823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0623"
FT                   /product="transposase, IS4"
FT                   /note="KEGG: mhu:Mhun_1523 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46849"
FT                   /db_xref="GOA:A6TKY1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY1"
FT                   /protein_id="ABR46849.1"
FT                   /translation="MGIVYQINKKTGITYAYQNESYWDKEKQQSRARRKLLGKIDPVTG
FT                   NIVSTRNYQKKEQQEELAPAKPGPVAITNYQRCFFGATYLFDQIGKTVGITADLKACFP
FT                   EDYKKILSIAYYLILEESNALSRFPHWQKLHIHPYGEDIPSQRSSELFQSIDEESRMRF
FT                   FEKQGKRRIEKEYWAFDITSISSYSETLSQVKKGRNKEHDRLPQINLALLFGEESGLPF
FT                   YYRKLAGNITDVKTVKQLMTEFDVMGYKKVRVVLDRGFYSKKNIDMLYKNHQKFLIGIK
FT                   LGLNYVKSVMEEKRANLKLWSNFETQFATYGICRTIDWDYEQERPYKGDTIKETRRAYL
FT                   LLFYNPEKVAKDQADMNDYLTSLYNDLKDNSRKDYRLKDYDKYFTVTETPKRGRKIVPN
FT                   EEAMSEAAKNYGYFALLSNEVNKPFEALSVYRSKDIVEKGFGNLKERLNFRRMQVSSEL
FT                   CLNGKLFIEFIALIYLSYVKKRMQDADLFDKWTLQGLLDELDVIESFEAPGHGRILGEV
FT                   TDKQKKLYEALEVEPPSL"
FT   gene            662490..662654
FT                   /locus_tag="Amet_0624"
FT   CDS_pept        662490..662654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46850"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY2"
FT                   /protein_id="ABR46850.1"
FT                   /translation="MRTFPVGNASFSDDGFVLVQEENGLGIIDLQEKYVIPPTIEGILL
FT                   DGYVVDVYY"
FT   gene            662790..663101
FT                   /locus_tag="Amet_0625"
FT   CDS_pept        662790..663101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46851"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY3"
FT                   /protein_id="ABR46851.1"
FT                   /translation="MLILGGFIAVVETYEYIKKQRVEKNAIYLNLRGKFIEWEVINRPY
FT                   TVYYRHVCNVRNLYILVYYIENSHGEIFRVNMAQSEYYNGVDRTQDLNKGDKVHIKYI"
FT   gene            663255..663413
FT                   /locus_tag="Amet_0626"
FT   CDS_pept        663255..663413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46852"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY4"
FT                   /protein_id="ABR46852.1"
FT                   /translation="MKMPRNAREKSQTGMNHVMMRGIDKRNIFVAEDNYDKFLHLIEKE
FT                   TRDRRQY"
FT   gene            663437..663565
FT                   /locus_tag="Amet_0627"
FT   CDS_pept        663437..663565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46853"
FT                   /db_xref="GOA:A6TKY5"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY5"
FT                   /protein_id="ABR46853.1"
FT                   /translation="MVGVLFKKLWTVGTVLVGVFAEVGGSINCIGFLYQPKYPGKK"
FT   gene            663599..664483
FT                   /locus_tag="Amet_0628"
FT   CDS_pept        663599..664483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46854"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY6"
FT                   /protein_id="ABR46854.1"
FT                   /translation="MKKIISLVLVFCMSFVFTVSAQSNFNHLEINSEVQKYMSNLSKVE
FT                   RDMLEERLHKPGLTNLSELSVEEQKIADENVKELNNLLWAMVHEGKPVLIYSTSNDDVY
FT                   VSVTDGHVEVISYEKENIMTVNGREIAYEQEVSYQQEKVVSFNGQDVIYAEDELEQDLV
FT                   GDDIIAPMSSYVTIPNPGGSWTYITTRVVDNTWMESIIDIGAGALVTFILARLAGLLPP
FT                   EADYAGVFASTILASGIAAQTNTLRFTQQKFEHQTHFKTYAYNERALGLDMQGNYVPAG
FT                   DWFDRYVAWAPNL"
FT   sig_peptide     663599..663664
FT                   /locus_tag="Amet_0628"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 22"
FT   gene            664839..665570
FT                   /locus_tag="Amet_0629"
FT   CDS_pept        664839..665570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46855"
FT                   /db_xref="GOA:A6TKY7"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY7"
FT                   /protein_id="ABR46855.1"
FT                   /translation="MDKKRYFLALIITITLFLTSCNNDGIDSINIFELPWESLTLKNFL
FT                   QVPIIIAIIHIPLGLRVIYREIFFSQWAGKKIMKVKLKKINYSLWIVLIALLGLIGFIY
FT                   ISANNYVQFLMESSLSQEIIEGMILMRLLRYIAVLYVFLQLGLLLVLRLLRQLEIRENG
FT                   INHGIGFIPWENIVLAEWKEAGTLEIHYYWTSKPFLLFFWKKNKKEIQEKANCCLKINI
FT                   EEKARINRHLERFIPDRIIAR"
FT   sig_peptide     664839..664910
FT                   /locus_tag="Amet_0629"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.581 at
FT                   residue 24"
FT   gene            665839..666024
FT                   /locus_tag="Amet_0630"
FT   CDS_pept        665839..666024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46856"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY8"
FT                   /protein_id="ABR46856.1"
FT                   /translation="MPREARERIKEMDNPKSISDLQKLEKDKRNKILGKAKEIEGISIL
FT                   QISRITGITRQVIKKT"
FT   gene            666043..666534
FT                   /locus_tag="Amet_0631"
FT   CDS_pept        666043..666534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0631"
FT                   /product="ATP-binding region, ATPase domain protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   KEGG: cpf:CPF_0499 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46857"
FT                   /db_xref="GOA:A6TKY9"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKY9"
FT                   /protein_id="ABR46857.1"
FT                   /translation="MHCIEEEFSSVNEIIDIGHPIIMVLVDIKREKARREKISFDIEID
FT                   VPRNLTIDDIDLSIVLSNVLDNAIEACISSNSVNMTIDLKMYVNEGYLIIKIVNTKSPS
FT                   YFIDEESIEQSFTTKPDKSNHGIGLRNIKKVIVQNNGYIKLNDKGTVMEIQIALPQIER
FT                   "
FT   gene            666880..667380
FT                   /locus_tag="Amet_0632"
FT   CDS_pept        666880..667380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46858"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKZ0"
FT                   /protein_id="ABR46858.1"
FT                   /translation="MVFAENNSLSSDEKNISHTNKVDLSVELKEVDVFTETVDNFPRDV
FT                   FEEVFTKEGIEFLREYFNADIIYTEDYVSVKIKTRILPSAEQGLVFYADGIPVNVSPEG
FT                   TTRVAKDTKVISRTDAEHEHNIISHSNHDDAKIIEDFFTASIEKTSSNKSEVVFRTSAG
FT                   ELI"
FT   gene            667384..667740
FT                   /locus_tag="Amet_0633"
FT   CDS_pept        667384..667740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L5_0002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46859"
FT                   /db_xref="UniProtKB/TrEMBL:A6TKZ1"
FT                   /protein_id="ABR46859.1"
FT                   /translation="MAEKEDESINISSKGYGDIYYPGDWVHCNRFNGQLTDDIHYDWRN
FT                   GTALERAAALRNFYSSDCHIAIVQAGSRCTGIGSCNCNTNEGPAYCSGFTKDKDSGVHC
FT                   PYTYHKHSGLVVPR"
FT   gene            667748..668221
FT                   /locus_tag="Amet_0634"
FT   CDS_pept        667748..668221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amet_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amet_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABR46860"
FT                   /db_xref="GOA:A6TKZ2"
FT                   /db