(data stored in ACNUC7421 zone)

EMBL: CP000744

ID   CP000744; SV 1; circular; genomic DNA; STD; PRO; 6588339 BP.
XX
AC   CP000744; AAQE01000000-AAQE01000147;
XX
PR   Project:PRJNA16720;
XX
DT   06-JUL-2007 (Rel. 92, Created)
DT   17-APR-2019 (Rel. 140, Last updated, Version 7)
XX
DE   Pseudomonas aeruginosa PA7, complete genome.
XX
KW   .
XX
OS   Pseudomonas aeruginosa PA7
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-6588339
RX   DOI; 10.1371/journal.pone.0008842.
RX   PUBMED; 20107499.
RA   Roy P.H., Tetu S.G., Larouche A., Elbourne L., Tremblay S., Ren Q.,
RA   Dodson R., Harkins D., Shay R., Watkins K., Mahamoud Y., Paulsen I.T.;
RT   "Complete genome sequence of the multiresistant taxonomic outlier
RT   Pseudomonas aeruginosa PA7";
RL   PLoS One 5(1):E8842-E8842(2010).
XX
RN   [2]
RP   1-6588339
RA   Dodson R.J., Harkins D., Paulsen I.T.;
RT   ;
RL   Submitted (22-JUN-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-6588339
RA   Roy P.H., Tetu S.G., Larouche A., Elbourne L., Tremblay S., Ren Q.,
RA   Dodson R., Harkins D., Shay R., Watkins K., Mahamoud Y., Paulsen I.T.;
RT   ;
RL   Submitted (04-APR-2019) to the INSDC.
RL   Infectious Diseases Res. Ctr., Universite Laval, 2705 boul. Laurier, suite
RL   R-0709, Quebec City, QC G1V 4G2, Canada
XX
DR   MD5; 976a1cbc0c0cd9eeb422a46211f9a936.
DR   BioSample; SAMN02603435.
DR   EnsemblGenomes-Gn; EBG00001086237.
DR   EnsemblGenomes-Gn; EBG00001086239.
DR   EnsemblGenomes-Gn; EBG00001086241.
DR   EnsemblGenomes-Gn; EBG00001086243.
DR   EnsemblGenomes-Gn; EBG00001086245.
DR   EnsemblGenomes-Gn; EBG00001086247.
DR   EnsemblGenomes-Gn; EBG00001086249.
DR   EnsemblGenomes-Gn; EBG00001086251.
DR   EnsemblGenomes-Gn; EBG00001086253.
DR   EnsemblGenomes-Gn; EBG00001086255.
DR   EnsemblGenomes-Gn; EBG00001086257.
DR   EnsemblGenomes-Gn; EBG00001086258.
DR   EnsemblGenomes-Gn; EBG00001086259.
DR   EnsemblGenomes-Gn; EBG00001086260.
DR   EnsemblGenomes-Gn; EBG00001086261.
DR   EnsemblGenomes-Gn; EBG00001086262.
DR   EnsemblGenomes-Gn; EBG00001086263.
DR   EnsemblGenomes-Gn; EBG00001086264.
DR   EnsemblGenomes-Gn; EBG00001086265.
DR   EnsemblGenomes-Gn; EBG00001086266.
DR   EnsemblGenomes-Gn; EBG00001086267.
DR   EnsemblGenomes-Gn; EBG00001086268.
DR   EnsemblGenomes-Gn; EBG00001086269.
DR   EnsemblGenomes-Gn; EBG00001086270.
DR   EnsemblGenomes-Gn; EBG00001086271.
DR   EnsemblGenomes-Gn; EBG00001086272.
DR   EnsemblGenomes-Gn; EBG00001086273.
DR   EnsemblGenomes-Gn; EBG00001086274.
DR   EnsemblGenomes-Gn; EBG00001086275.
DR   EnsemblGenomes-Gn; EBG00001086276.
DR   EnsemblGenomes-Gn; EBG00001086277.
DR   EnsemblGenomes-Gn; EBG00001086278.
DR   EnsemblGenomes-Gn; EBG00001086279.
DR   EnsemblGenomes-Gn; EBG00001086280.
DR   EnsemblGenomes-Gn; EBG00001086281.
DR   EnsemblGenomes-Gn; EBG00001086282.
DR   EnsemblGenomes-Gn; EBG00001086283.
DR   EnsemblGenomes-Gn; EBG00001086284.
DR   EnsemblGenomes-Gn; EBG00001086285.
DR   EnsemblGenomes-Gn; EBG00001086286.
DR   EnsemblGenomes-Gn; EBG00001086287.
DR   EnsemblGenomes-Gn; EBG00001086288.
DR   EnsemblGenomes-Gn; EBG00001086289.
DR   EnsemblGenomes-Gn; EBG00001086290.
DR   EnsemblGenomes-Gn; EBG00001086291.
DR   EnsemblGenomes-Gn; EBG00001086292.
DR   EnsemblGenomes-Gn; EBG00001086293.
DR   EnsemblGenomes-Gn; EBG00001086294.
DR   EnsemblGenomes-Gn; EBG00001086295.
DR   EnsemblGenomes-Gn; EBG00001086296.
DR   EnsemblGenomes-Gn; EBG00001086297.
DR   EnsemblGenomes-Gn; EBG00001086298.
DR   EnsemblGenomes-Gn; EBG00001086299.
DR   EnsemblGenomes-Gn; EBG00001086300.
DR   EnsemblGenomes-Gn; EBG00001086301.
DR   EnsemblGenomes-Gn; EBG00001086302.
DR   EnsemblGenomes-Gn; EBG00001086303.
DR   EnsemblGenomes-Gn; EBG00001086304.
DR   EnsemblGenomes-Gn; EBG00001086305.
DR   EnsemblGenomes-Gn; EBG00001086306.
DR   EnsemblGenomes-Gn; EBG00001086307.
DR   EnsemblGenomes-Gn; EBG00001086308.
DR   EnsemblGenomes-Gn; EBG00001086309.
DR   EnsemblGenomes-Gn; EBG00001086310.
DR   EnsemblGenomes-Gn; EBG00001086311.
DR   EnsemblGenomes-Gn; EBG00001086312.
DR   EnsemblGenomes-Gn; EBG00001086313.
DR   EnsemblGenomes-Gn; EBG00001086314.
DR   EnsemblGenomes-Gn; EBG00001086315.
DR   EnsemblGenomes-Gn; EBG00001086316.
DR   EnsemblGenomes-Gn; EBG00001086317.
DR   EnsemblGenomes-Gn; EBG00001086318.
DR   EnsemblGenomes-Gn; EBG00001086319.
DR   EnsemblGenomes-Gn; EBG00001086320.
DR   EnsemblGenomes-Gn; EBG00001086321.
DR   EnsemblGenomes-Gn; EBG00001086322.
DR   EnsemblGenomes-Gn; EBG00001086323.
DR   EnsemblGenomes-Gn; EBG00001086324.
DR   EnsemblGenomes-Gn; EBG00001086325.
DR   EnsemblGenomes-Gn; EBG00001086326.
DR   EnsemblGenomes-Gn; EBG00001086327.
DR   EnsemblGenomes-Gn; EBG00001086328.
DR   EnsemblGenomes-Gn; EBG00001086329.
DR   EnsemblGenomes-Gn; EBG00001086330.
DR   EnsemblGenomes-Gn; EBG00001086331.
DR   EnsemblGenomes-Gn; EBG00001086332.
DR   EnsemblGenomes-Gn; EBG00001086333.
DR   EnsemblGenomes-Gn; EBG00001086334.
DR   EnsemblGenomes-Gn; EBG00001086335.
DR   EnsemblGenomes-Gn; EBG00001086336.
DR   EnsemblGenomes-Gn; EBG00001086337.
DR   EnsemblGenomes-Gn; EBG00001086338.
DR   EnsemblGenomes-Gn; EBG00001086339.
DR   EnsemblGenomes-Gn; EBG00001086340.
DR   EnsemblGenomes-Gn; EBG00001086341.
DR   EnsemblGenomes-Gn; EBG00001086342.
DR   EnsemblGenomes-Gn; EBG00001086343.
DR   EnsemblGenomes-Gn; EBG00001086344.
DR   EnsemblGenomes-Gn; EBG00001086345.
DR   EnsemblGenomes-Gn; EBG00001086346.
DR   EnsemblGenomes-Gn; EBG00001086347.
DR   EnsemblGenomes-Gn; EBG00001086348.
DR   EnsemblGenomes-Gn; EBG00001086349.
DR   EnsemblGenomes-Gn; EBG00001086350.
DR   EnsemblGenomes-Gn; EBG00001086351.
DR   EnsemblGenomes-Gn; EBG00001086352.
DR   EnsemblGenomes-Gn; EBG00001086353.
DR   EnsemblGenomes-Gn; EBG00001086354.
DR   EnsemblGenomes-Gn; EBG00001086355.
DR   EnsemblGenomes-Gn; EBG00001086356.
DR   EnsemblGenomes-Gn; EBG00001086357.
DR   EnsemblGenomes-Gn; EBG00001086358.
DR   EnsemblGenomes-Gn; EBG00001086359.
DR   EnsemblGenomes-Gn; EBG00001086360.
DR   EnsemblGenomes-Gn; EBG00001086361.
DR   EnsemblGenomes-Gn; EBG00001086362.
DR   EnsemblGenomes-Gn; EBG00001086363.
DR   EnsemblGenomes-Gn; EBG00001086364.
DR   EnsemblGenomes-Gn; EBG00001086365.
DR   EnsemblGenomes-Gn; EBG00001086366.
DR   EnsemblGenomes-Gn; EBG00001086367.
DR   EnsemblGenomes-Gn; EBG00001086368.
DR   EnsemblGenomes-Gn; EBG00001086369.
DR   EnsemblGenomes-Gn; EBG00001086370.
DR   EnsemblGenomes-Gn; EBG00001086371.
DR   EnsemblGenomes-Gn; EBG00001086372.
DR   EnsemblGenomes-Gn; EBG00001086373.
DR   EnsemblGenomes-Gn; EBG00001086374.
DR   EnsemblGenomes-Gn; EBG00001086375.
DR   EnsemblGenomes-Gn; EBG00001086376.
DR   EnsemblGenomes-Gn; EBG00001086377.
DR   EnsemblGenomes-Gn; EBG00001086378.
DR   EnsemblGenomes-Gn; EBG00001086379.
DR   EnsemblGenomes-Gn; EBG00001086380.
DR   EnsemblGenomes-Gn; EBG00001086381.
DR   EnsemblGenomes-Gn; EBG00001086382.
DR   EnsemblGenomes-Gn; EBG00001086383.
DR   EnsemblGenomes-Gn; EBG00001086384.
DR   EnsemblGenomes-Gn; EBG00001086385.
DR   EnsemblGenomes-Gn; EBG00001086386.
DR   EnsemblGenomes-Gn; PSPA7_0340.
DR   EnsemblGenomes-Gn; PSPA7_0811.
DR   EnsemblGenomes-Gn; PSPA7_0812.
DR   EnsemblGenomes-Gn; PSPA7_0813.
DR   EnsemblGenomes-Gn; PSPA7_0814.
DR   EnsemblGenomes-Gn; PSPA7_0815.
DR   EnsemblGenomes-Gn; PSPA7_0819.
DR   EnsemblGenomes-Gn; PSPA7_0820.
DR   EnsemblGenomes-Gn; PSPA7_0821.
DR   EnsemblGenomes-Gn; PSPA7_0823.
DR   EnsemblGenomes-Gn; PSPA7_1288.
DR   EnsemblGenomes-Gn; PSPA7_1762.
DR   EnsemblGenomes-Gn; PSPA7_1859.
DR   EnsemblGenomes-Gn; PSPA7_1860.
DR   EnsemblGenomes-Gn; PSPA7_1988.
DR   EnsemblGenomes-Gn; PSPA7_1995.
DR   EnsemblGenomes-Gn; PSPA7_1996.
DR   EnsemblGenomes-Gn; PSPA7_1997.
DR   EnsemblGenomes-Gn; PSPA7_1998.
DR   EnsemblGenomes-Gn; PSPA7_2039.
DR   EnsemblGenomes-Gn; PSPA7_2040.
DR   EnsemblGenomes-Gn; PSPA7_2041.
DR   EnsemblGenomes-Gn; PSPA7_2126.
DR   EnsemblGenomes-Gn; PSPA7_2302.
DR   EnsemblGenomes-Gn; PSPA7_2336.
DR   EnsemblGenomes-Gn; PSPA7_2337.
DR   EnsemblGenomes-Gn; PSPA7_2338.
DR   EnsemblGenomes-Gn; PSPA7_2457.
DR   EnsemblGenomes-Gn; PSPA7_2512.
DR   EnsemblGenomes-Gn; PSPA7_2605.
DR   EnsemblGenomes-Gn; PSPA7_2616.
DR   EnsemblGenomes-Gn; PSPA7_2631.
DR   EnsemblGenomes-Gn; PSPA7_2647.
DR   EnsemblGenomes-Gn; PSPA7_3492.
DR   EnsemblGenomes-Gn; PSPA7_3503.
DR   EnsemblGenomes-Gn; PSPA7_3504.
DR   EnsemblGenomes-Gn; PSPA7_3505.
DR   EnsemblGenomes-Gn; PSPA7_3506.
DR   EnsemblGenomes-Gn; PSPA7_4383.
DR   EnsemblGenomes-Gn; PSPA7_4436.
DR   EnsemblGenomes-Gn; PSPA7_4531.
DR   EnsemblGenomes-Gn; PSPA7_4588.
DR   EnsemblGenomes-Gn; PSPA7_4607.
DR   EnsemblGenomes-Gn; PSPA7_4608.
DR   EnsemblGenomes-Gn; PSPA7_4609.
DR   EnsemblGenomes-Gn; PSPA7_4696.
DR   EnsemblGenomes-Gn; PSPA7_4794.
DR   EnsemblGenomes-Gn; PSPA7_4842.
DR   EnsemblGenomes-Gn; PSPA7_4843.
DR   EnsemblGenomes-Gn; PSPA7_4844.
DR   EnsemblGenomes-Gn; PSPA7_4845.
DR   EnsemblGenomes-Gn; PSPA7_4846.
DR   EnsemblGenomes-Gn; PSPA7_5158.
DR   EnsemblGenomes-Gn; PSPA7_5178.
DR   EnsemblGenomes-Gn; PSPA7_5179.
DR   EnsemblGenomes-Gn; PSPA7_5180.
DR   EnsemblGenomes-Gn; PSPA7_5319.
DR   EnsemblGenomes-Gn; PSPA7_5361.
DR   EnsemblGenomes-Gn; PSPA7_5399.
DR   EnsemblGenomes-Gn; PSPA7_5400.
DR   EnsemblGenomes-Gn; PSPA7_5401.
DR   EnsemblGenomes-Gn; PSPA7_5402.
DR   EnsemblGenomes-Gn; PSPA7_5403.
DR   EnsemblGenomes-Gn; PSPA7_5465.
DR   EnsemblGenomes-Gn; PSPA7_5466.
DR   EnsemblGenomes-Gn; PSPA7_5525.
DR   EnsemblGenomes-Gn; PSPA7_5665.
DR   EnsemblGenomes-Gn; PSPA7_5666.
DR   EnsemblGenomes-Gn; PSPA7_5887.
DR   EnsemblGenomes-Gn; PSPA7_5899.
DR   EnsemblGenomes-Gn; PSPA7_6149.
DR   EnsemblGenomes-Gn; PSPA7_6150.
DR   EnsemblGenomes-Gn; PSPA7_6151.
DR   EnsemblGenomes-Gn; PSPA7_6152.
DR   EnsemblGenomes-Gn; PSPA7_6153.
DR   EnsemblGenomes-Tr; EBT00001688632.
DR   EnsemblGenomes-Tr; EBT00001688633.
DR   EnsemblGenomes-Tr; EBT00001688634.
DR   EnsemblGenomes-Tr; EBT00001688635.
DR   EnsemblGenomes-Tr; EBT00001688636.
DR   EnsemblGenomes-Tr; EBT00001688637.
DR   EnsemblGenomes-Tr; EBT00001688638.
DR   EnsemblGenomes-Tr; EBT00001688639.
DR   EnsemblGenomes-Tr; EBT00001688640.
DR   EnsemblGenomes-Tr; EBT00001688641.
DR   EnsemblGenomes-Tr; EBT00001688642.
DR   EnsemblGenomes-Tr; EBT00001688643.
DR   EnsemblGenomes-Tr; EBT00001688644.
DR   EnsemblGenomes-Tr; EBT00001688645.
DR   EnsemblGenomes-Tr; EBT00001688646.
DR   EnsemblGenomes-Tr; EBT00001688647.
DR   EnsemblGenomes-Tr; EBT00001688648.
DR   EnsemblGenomes-Tr; EBT00001688649.
DR   EnsemblGenomes-Tr; EBT00001688650.
DR   EnsemblGenomes-Tr; EBT00001688651.
DR   EnsemblGenomes-Tr; EBT00001688652.
DR   EnsemblGenomes-Tr; EBT00001688653.
DR   EnsemblGenomes-Tr; EBT00001688654.
DR   EnsemblGenomes-Tr; EBT00001688655.
DR   EnsemblGenomes-Tr; EBT00001688656.
DR   EnsemblGenomes-Tr; EBT00001688657.
DR   EnsemblGenomes-Tr; EBT00001688658.
DR   EnsemblGenomes-Tr; EBT00001688659.
DR   EnsemblGenomes-Tr; EBT00001688660.
DR   EnsemblGenomes-Tr; EBT00001688661.
DR   EnsemblGenomes-Tr; EBT00001688662.
DR   EnsemblGenomes-Tr; EBT00001688663.
DR   EnsemblGenomes-Tr; EBT00001688664.
DR   EnsemblGenomes-Tr; EBT00001688665.
DR   EnsemblGenomes-Tr; EBT00001688666.
DR   EnsemblGenomes-Tr; EBT00001688667.
DR   EnsemblGenomes-Tr; EBT00001688668.
DR   EnsemblGenomes-Tr; EBT00001688669.
DR   EnsemblGenomes-Tr; EBT00001688670.
DR   EnsemblGenomes-Tr; EBT00001688671.
DR   EnsemblGenomes-Tr; EBT00001688672.
DR   EnsemblGenomes-Tr; EBT00001688673.
DR   EnsemblGenomes-Tr; EBT00001688674.
DR   EnsemblGenomes-Tr; EBT00001688675.
DR   EnsemblGenomes-Tr; EBT00001688676.
DR   EnsemblGenomes-Tr; EBT00001688677.
DR   EnsemblGenomes-Tr; EBT00001688678.
DR   EnsemblGenomes-Tr; EBT00001688679.
DR   EnsemblGenomes-Tr; EBT00001688680.
DR   EnsemblGenomes-Tr; EBT00001688681.
DR   EnsemblGenomes-Tr; EBT00001688682.
DR   EnsemblGenomes-Tr; EBT00001688683.
DR   EnsemblGenomes-Tr; EBT00001688684.
DR   EnsemblGenomes-Tr; EBT00001688685.
DR   EnsemblGenomes-Tr; EBT00001688686.
DR   EnsemblGenomes-Tr; EBT00001688687.
DR   EnsemblGenomes-Tr; EBT00001688688.
DR   EnsemblGenomes-Tr; EBT00001688689.
DR   EnsemblGenomes-Tr; EBT00001688690.
DR   EnsemblGenomes-Tr; EBT00001688691.
DR   EnsemblGenomes-Tr; EBT00001688692.
DR   EnsemblGenomes-Tr; EBT00001688693.
DR   EnsemblGenomes-Tr; EBT00001688694.
DR   EnsemblGenomes-Tr; EBT00001688695.
DR   EnsemblGenomes-Tr; EBT00001688696.
DR   EnsemblGenomes-Tr; EBT00001688697.
DR   EnsemblGenomes-Tr; EBT00001688698.
DR   EnsemblGenomes-Tr; EBT00001688699.
DR   EnsemblGenomes-Tr; EBT00001688700.
DR   EnsemblGenomes-Tr; EBT00001688701.
DR   EnsemblGenomes-Tr; EBT00001688702.
DR   EnsemblGenomes-Tr; EBT00001688703.
DR   EnsemblGenomes-Tr; EBT00001688704.
DR   EnsemblGenomes-Tr; EBT00001688705.
DR   EnsemblGenomes-Tr; EBT00001688706.
DR   EnsemblGenomes-Tr; EBT00001688707.
DR   EnsemblGenomes-Tr; EBT00001688708.
DR   EnsemblGenomes-Tr; EBT00001688709.
DR   EnsemblGenomes-Tr; EBT00001688710.
DR   EnsemblGenomes-Tr; EBT00001688711.
DR   EnsemblGenomes-Tr; EBT00001688712.
DR   EnsemblGenomes-Tr; EBT00001688713.
DR   EnsemblGenomes-Tr; EBT00001688714.
DR   EnsemblGenomes-Tr; EBT00001688715.
DR   EnsemblGenomes-Tr; EBT00001688716.
DR   EnsemblGenomes-Tr; EBT00001688717.
DR   EnsemblGenomes-Tr; EBT00001688718.
DR   EnsemblGenomes-Tr; EBT00001688719.
DR   EnsemblGenomes-Tr; EBT00001688720.
DR   EnsemblGenomes-Tr; EBT00001688721.
DR   EnsemblGenomes-Tr; EBT00001688722.
DR   EnsemblGenomes-Tr; EBT00001688723.
DR   EnsemblGenomes-Tr; EBT00001688724.
DR   EnsemblGenomes-Tr; EBT00001688725.
DR   EnsemblGenomes-Tr; EBT00001688726.
DR   EnsemblGenomes-Tr; EBT00001688727.
DR   EnsemblGenomes-Tr; EBT00001688728.
DR   EnsemblGenomes-Tr; EBT00001688729.
DR   EnsemblGenomes-Tr; EBT00001688730.
DR   EnsemblGenomes-Tr; EBT00001688731.
DR   EnsemblGenomes-Tr; EBT00001688732.
DR   EnsemblGenomes-Tr; EBT00001688733.
DR   EnsemblGenomes-Tr; EBT00001688734.
DR   EnsemblGenomes-Tr; EBT00001688735.
DR   EnsemblGenomes-Tr; EBT00001688736.
DR   EnsemblGenomes-Tr; EBT00001688737.
DR   EnsemblGenomes-Tr; EBT00001688738.
DR   EnsemblGenomes-Tr; EBT00001688739.
DR   EnsemblGenomes-Tr; EBT00001688740.
DR   EnsemblGenomes-Tr; EBT00001688741.
DR   EnsemblGenomes-Tr; EBT00001688742.
DR   EnsemblGenomes-Tr; EBT00001688743.
DR   EnsemblGenomes-Tr; EBT00001688744.
DR   EnsemblGenomes-Tr; EBT00001688745.
DR   EnsemblGenomes-Tr; EBT00001688746.
DR   EnsemblGenomes-Tr; EBT00001688747.
DR   EnsemblGenomes-Tr; EBT00001688748.
DR   EnsemblGenomes-Tr; EBT00001688749.
DR   EnsemblGenomes-Tr; EBT00001688750.
DR   EnsemblGenomes-Tr; EBT00001688751.
DR   EnsemblGenomes-Tr; EBT00001688752.
DR   EnsemblGenomes-Tr; EBT00001688753.
DR   EnsemblGenomes-Tr; EBT00001688754.
DR   EnsemblGenomes-Tr; EBT00001688755.
DR   EnsemblGenomes-Tr; EBT00001688756.
DR   EnsemblGenomes-Tr; EBT00001688757.
DR   EnsemblGenomes-Tr; EBT00001688758.
DR   EnsemblGenomes-Tr; EBT00001688759.
DR   EnsemblGenomes-Tr; EBT00001688760.
DR   EnsemblGenomes-Tr; EBT00001688761.
DR   EnsemblGenomes-Tr; EBT00001688762.
DR   EnsemblGenomes-Tr; EBT00001688763.
DR   EnsemblGenomes-Tr; EBT00001688764.
DR   EnsemblGenomes-Tr; EBT00001688765.
DR   EnsemblGenomes-Tr; EBT00001688766.
DR   EnsemblGenomes-Tr; EBT00001688767.
DR   EnsemblGenomes-Tr; EBT00001688768.
DR   EnsemblGenomes-Tr; EBT00001688769.
DR   EnsemblGenomes-Tr; EBT00001688770.
DR   EnsemblGenomes-Tr; EBT00001688771.
DR   EnsemblGenomes-Tr; PSPA7_0340-1.
DR   EnsemblGenomes-Tr; PSPA7_0811-1.
DR   EnsemblGenomes-Tr; PSPA7_0812-1.
DR   EnsemblGenomes-Tr; PSPA7_0813-1.
DR   EnsemblGenomes-Tr; PSPA7_0814-1.
DR   EnsemblGenomes-Tr; PSPA7_0815-1.
DR   EnsemblGenomes-Tr; PSPA7_0819-1.
DR   EnsemblGenomes-Tr; PSPA7_0820-1.
DR   EnsemblGenomes-Tr; PSPA7_0821-1.
DR   EnsemblGenomes-Tr; PSPA7_0823-1.
DR   EnsemblGenomes-Tr; PSPA7_1288-1.
DR   EnsemblGenomes-Tr; PSPA7_1762-1.
DR   EnsemblGenomes-Tr; PSPA7_1859-1.
DR   EnsemblGenomes-Tr; PSPA7_1860-1.
DR   EnsemblGenomes-Tr; PSPA7_1988-1.
DR   EnsemblGenomes-Tr; PSPA7_1995-1.
DR   EnsemblGenomes-Tr; PSPA7_1996-1.
DR   EnsemblGenomes-Tr; PSPA7_1997-1.
DR   EnsemblGenomes-Tr; PSPA7_1998-1.
DR   EnsemblGenomes-Tr; PSPA7_2039-1.
DR   EnsemblGenomes-Tr; PSPA7_2040-1.
DR   EnsemblGenomes-Tr; PSPA7_2041-1.
DR   EnsemblGenomes-Tr; PSPA7_2126-1.
DR   EnsemblGenomes-Tr; PSPA7_2302-1.
DR   EnsemblGenomes-Tr; PSPA7_2336-1.
DR   EnsemblGenomes-Tr; PSPA7_2337-1.
DR   EnsemblGenomes-Tr; PSPA7_2338-1.
DR   EnsemblGenomes-Tr; PSPA7_2457-1.
DR   EnsemblGenomes-Tr; PSPA7_2512-1.
DR   EnsemblGenomes-Tr; PSPA7_2605-1.
DR   EnsemblGenomes-Tr; PSPA7_2616-1.
DR   EnsemblGenomes-Tr; PSPA7_2631-1.
DR   EnsemblGenomes-Tr; PSPA7_2647-1.
DR   EnsemblGenomes-Tr; PSPA7_3492-1.
DR   EnsemblGenomes-Tr; PSPA7_3503-1.
DR   EnsemblGenomes-Tr; PSPA7_3504-1.
DR   EnsemblGenomes-Tr; PSPA7_3505-1.
DR   EnsemblGenomes-Tr; PSPA7_3506-1.
DR   EnsemblGenomes-Tr; PSPA7_4383-1.
DR   EnsemblGenomes-Tr; PSPA7_4436-1.
DR   EnsemblGenomes-Tr; PSPA7_4531-1.
DR   EnsemblGenomes-Tr; PSPA7_4588-1.
DR   EnsemblGenomes-Tr; PSPA7_4607-1.
DR   EnsemblGenomes-Tr; PSPA7_4608-1.
DR   EnsemblGenomes-Tr; PSPA7_4609-1.
DR   EnsemblGenomes-Tr; PSPA7_4696-1.
DR   EnsemblGenomes-Tr; PSPA7_4794-1.
DR   EnsemblGenomes-Tr; PSPA7_4842-1.
DR   EnsemblGenomes-Tr; PSPA7_4843-1.
DR   EnsemblGenomes-Tr; PSPA7_4844-1.
DR   EnsemblGenomes-Tr; PSPA7_4845-1.
DR   EnsemblGenomes-Tr; PSPA7_4846-1.
DR   EnsemblGenomes-Tr; PSPA7_5158-1.
DR   EnsemblGenomes-Tr; PSPA7_5178-1.
DR   EnsemblGenomes-Tr; PSPA7_5179-1.
DR   EnsemblGenomes-Tr; PSPA7_5180-1.
DR   EnsemblGenomes-Tr; PSPA7_5319-1.
DR   EnsemblGenomes-Tr; PSPA7_5361-1.
DR   EnsemblGenomes-Tr; PSPA7_5399-1.
DR   EnsemblGenomes-Tr; PSPA7_5400-1.
DR   EnsemblGenomes-Tr; PSPA7_5401-1.
DR   EnsemblGenomes-Tr; PSPA7_5402-1.
DR   EnsemblGenomes-Tr; PSPA7_5403-1.
DR   EnsemblGenomes-Tr; PSPA7_5465-1.
DR   EnsemblGenomes-Tr; PSPA7_5466-1.
DR   EnsemblGenomes-Tr; PSPA7_5525-1.
DR   EnsemblGenomes-Tr; PSPA7_5665-1.
DR   EnsemblGenomes-Tr; PSPA7_5666-1.
DR   EnsemblGenomes-Tr; PSPA7_5887-1.
DR   EnsemblGenomes-Tr; PSPA7_5899-1.
DR   EnsemblGenomes-Tr; PSPA7_6149-1.
DR   EnsemblGenomes-Tr; PSPA7_6150-1.
DR   EnsemblGenomes-Tr; PSPA7_6151-1.
DR   EnsemblGenomes-Tr; PSPA7_6152-1.
DR   EnsemblGenomes-Tr; PSPA7_6153-1.
DR   EuropePMC; PMC2647930; 19144133.
DR   EuropePMC; PMC2701924; 19523196.
DR   EuropePMC; PMC2788362; 19958473.
DR   EuropePMC; PMC2809737; 20107499.
DR   EuropePMC; PMC2813009; 20008172.
DR   EuropePMC; PMC3067716; 21227987.
DR   EuropePMC; PMC3737579; 22850694.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC4155085; 25168460.
DR   EuropePMC; PMC4542609; 24286439.
DR   EuropePMC; PMC4702634; 26452553.
DR   EuropePMC; PMC4739549; 26841043.
DR   EuropePMC; PMC5551671; 28642945.
DR   EuropePMC; PMC5910555; 29678129.
DR   EuropePMC; PMC6505155; 30910818.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01665; P13.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01670; P17.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01672; P2.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01677; P35.
DR   RFAM; RF01678; P37.
DR   RFAM; RF01679; P36.
DR   RFAM; RF01680; P5.
DR   RFAM; RF01681; P4.
DR   RFAM; RF01682; P8.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000744.
DR   SILVA-SSU; CP000744.
XX
CC   Bacterial strain PA7 was obtained from Paul Roy, University of
CC   Laval, Quebec, Canada.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6588339
FT                   /organism="Pseudomonas aeruginosa PA7"
FT                   /strain="PA7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:381754"
FT   gene            482..2026
FT                   /gene="dnaA"
FT                   /locus_tag="PSPA7_0001"
FT   CDS_pept        482..2026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PSPA7_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86781"
FT                   /db_xref="GOA:A6UX62"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX62"
FT                   /protein_id="ABR86781.2"
FT                   /translation="MSVELWQQCVDLLRDELPSQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGERGEGQLPALSLLIGSKRSRTPRAAIVPSQSHVAPPPPVA
FT                   PPPAPVQPVSAAPVVVPREELPPVAAVSSVTADSYEAEEPSIDPLAVAMPAGAAPAIRT
FT                   ERNVQVEGALKHTSYLNRTFTFENFVEGKSNQLARAAAWQVADNLKHGYNPLFLYGGVG
FT                   LGKTHLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLI
FT                   DDIQFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVA
FT                   VEPPELETRVAILMKKAEQAKIELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGR
FT                   PITIELIRESLKDLLALQDKLVSIDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
FT                   ALSKELTNHSLPEIGVAFGGRDHTTVLHACRKIAQLRESDADIREDYKNLLRTLTT"
FT   gene            2055..3158
FT                   /gene="dnaN"
FT                   /locus_tag="PSPA7_0002"
FT   CDS_pept        2055..3158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PSPA7_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00712; match to protein family HMM PF02767; match to
FT                   protein family HMM PF02768; match to protein family HMM
FT                   TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85088"
FT                   /db_xref="GOA:A6UX63"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX63"
FT                   /protein_id="ABR85088.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPSDVLIDIRVEEQKLLVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVN
FT                   GGALRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVIGDRQQLREAFSRTAILSNEKYRG
FT                   IRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFI
FT                   LSDSNSSALVHEADNDDSAYVVMPMRL"
FT   gene            3168..4277
FT                   /gene="recF"
FT                   /locus_tag="PSPA7_0003"
FT   CDS_pept        3168..4277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PSPA7_0003"
FT                   /product="RecF protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02463; match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82369"
FT                   /db_xref="GOA:A6UX64"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UX64"
FT                   /protein_id="ABR82369.1"
FT                   /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHL
FT                   LGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQNAR
FT                   SAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRN
FT                   SWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSY
FT                   YRGWDKDRDLQDVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQKLVVC
FT                   ALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLLK
FT                   DGWRTDTPVAMFHVEHGKVSQTTTIGSEA"
FT   gene            4274..6694
FT                   /gene="gyrB"
FT                   /locus_tag="PSPA7_0004"
FT   CDS_pept        4274..6694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PSPA7_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00204; match to protein family HMM PF00986; match to
FT                   protein family HMM PF01751; match to protein family HMM
FT                   PF02518; match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81251"
FT                   /db_xref="GOA:A6UX65"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX65"
FT                   /protein_id="ABR81251.1"
FT                   /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVGETD
FT                   GSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFKYEGG
FT                   LKAFVEYLNTNKSAVNQVFHFNVQREEDGVGVEVALQWNDSFNENILCFTNNIPQRDGG
FT                   THLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQMPELIERGYVYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDASLHVNEHAPG
FT                   LAGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLANESVMQGWLEKF
FT                   QARLSAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRDFFASNDYRSVSL
FT                   LGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQRYKGLGEMNPEQLW
FT                   ETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALAVSNLDV"
FT   gene            complement(7025..7798)
FT                   /locus_tag="PSPA7_0005"
FT   CDS_pept        complement(7025..7798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0005"
FT                   /product="putative acyltransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81214"
FT                   /db_xref="GOA:A6UX66"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX66"
FT                   /protein_id="ABR81214.1"
FT                   /translation="MSTVQAIRTVLFYLLLSSSAFVWGTLSFFIAPFLPFRARYRFVVR
FT                   SWCRFAIWLTRVVAGIRYEVRGLENVPEQPCVILSKHQSTWETFFLSGFFEPLSQVLKR
FT                   ELLYVPFFGWALALLKPIAIDRSQPKLALKQLAKQGDECLKKGAWVLIFPEGTRIPVGQ
FT                   MGKFSRGGTALAVNAGLPVLPIAHNAGQFWPKAGWAKYPGTIQVVIGPAMHAEGEGPRA
FT                   IAELNQRAEAWVSETMAEISPTQQRVSHPEPSVVS"
FT   gene            complement(7810..8346)
FT                   /locus_tag="PSPA7_0006"
FT   CDS_pept        complement(7810..8346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0006"
FT                   /product="D-glycero-beta-D-manno-heptose-1,7-bisphosphate
FT                   7-phosphatase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84984"
FT                   /db_xref="GOA:A6UX67"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX67"
FT                   /protein_id="ABR84984.2"
FT                   /translation="MSRSLLILDRDGVINLDSDDYIKTLDEWIPIPSSIEAIARLSKAG
FT                   WTVAVATNQSGIARGYYELAVLEAMHARLRELVAKQGGELGLIVYCPHGPDDGCDCRKP
FT                   KPGMLRQIGEHYGVDLSGIWFVGDSIGDLEAARAVDCQPVLVKTGKGVRTLGKPLPEGT
FT                   LIFDDLAAVASALLQ"
FT   gene            complement(8691..10748)
FT                   /gene="glyS"
FT                   /locus_tag="PSPA7_0008"
FT   CDS_pept        complement(8691..10748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="PSPA7_0008"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02092; match to protein family HMM PF05746; match to
FT                   protein family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86654"
FT                   /db_xref="GOA:A6UX69"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX69"
FT                   /protein_id="ABR86654.1"
FT                   /translation="MMSAKDFLVELGTEELPPKALNSLGEAFLNGIEKGLKAAGLSYSA
FT                   ARFYAAPRRLAVLIEQLAVQQPDRTVNLDGPPLQAAFDASGKPTQAALGFAKKCGVDLE
FT                   QIDKSGPKLRFSQTIAGQPAAGLLPGIVETSLNELPIPKRMRWAARRDEFVRPTQWLVM
FT                   LFGDEVVDCEILAQKAGRESRGHRFHNPDNVRISSPAAYLEDLRGAHVLADFAERRELI
FT                   AKRVAELAAEQQGSAIVPPSLLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQ
FT                   KYFCLLDANGKLLPRFITVANVESKAPENIVSGNEKVVRPRLTDAEFFFKQDKKQPLES
FT                   FNERLQNVVFQAQLGTVFDKARRVSGLAAYIAERIGGDAQNAARAGILSKCDLATEMVG
FT                   EFPEMQGIAGYYYATHGGEPEDVALALNEQYMPRGAGAELPSTLTGAAVAVADKLDTLV
FT                   GIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLVAAVHAAVEQYGDKVKAAGLA
FT                   EQVLDFVFDRLRARYEDEGVDVAVYQSVRALKPSSPLDFDQRVQAVQAFRQLPEAEALA
FT                   AANKRVSNILAKSEDEVPASVDASLLVEAAEKALGSAVANAESEVAPLAAARDYRAALA
FT                   RLAALREPVDAFFADVMVNVDDSSVRANRYALLAKLRGLFLGVADISLLG"
FT   gene            complement(10745..11692)
FT                   /gene="glyQ"
FT                   /locus_tag="PSPA7_0009"
FT   CDS_pept        complement(10745..11692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="PSPA7_0009"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02091; match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85958"
FT                   /db_xref="GOA:A6UX70"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UX70"
FT                   /protein_id="ABR85958.1"
FT                   /translation="MSQTTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSL
FT                   KAIGIDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLIWTDGPFGKVTYGDVFHQNEVEQSTFNFEHANVPKLF
FT                   ELFDFYESEANRLIELELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLAR
FT                   AVAQSYLQARARLGFPMATPELRDEVLAKLKEAE"
FT   gene            11797..12348
FT                   /gene="tag"
FT                   /locus_tag="PSPA7_0010"
FT   CDS_pept        11797..12348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="PSPA7_0010"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03352; match to protein family HMM TIGR00624"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83450"
FT                   /db_xref="GOA:A6UX71"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX71"
FT                   /protein_id="ABR83450.1"
FT                   /translation="MPRCFWCNDDPLYMAYHDEEWGVPQRDPDALFELLLLEGFQAGLS
FT                   WITVLKKRERYREVLFGFDVQRVAQMSDAEIDELMLDPGIIRNRSKLNAARQNAQAWLE
FT                   LDDPAGFLWSFVGGQPKINHFAGRAEVPAITPEAEAMSKALRKAGFNFVGPTICYAFMQ
FT                   ASGMVMDHTRDCDRYAQLAG"
FT   gene            12625..13512
FT                   /locus_tag="PSPA7_0011"
FT   CDS_pept        12625..13512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0011"
FT                   /product="putative 2-OH-lauroyltransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82820"
FT                   /db_xref="GOA:A6UX72"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX72"
FT                   /protein_id="ABR82820.1"
FT                   /translation="MEKFKGALVVGALRLFALLPWRAVQGVGAGIGWLMWKLPNRSREV
FT                   VRINLSKCFPELSEAELEKLVGQSLMDIGKTLTESACAWIWPPEKSLKYIREVEGMEVL
FT                   EEALASGDGLVGITSHLGNWEVLNHFYCSYAKPIIFYRPPKLKAVDELLKKQRVQLGNR
FT                   VAPSTPEGILSVIKEVKRGGCVGIPADPEPARTAGLFVPYLGTTALISKFVPQLLSRGK
FT                   ARGVFFHAVRLPDGSGYKVILEAAPADMYDKDLDVSVAAMSRELAKYVRAYPSQYMWSM
FT                   KRFKNRPDGEKKWY"
FT   gene            13589..13855
FT                   /locus_tag="PSPA7_0012"
FT   CDS_pept        13589..13855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0012"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84781"
FT                   /db_xref="GOA:A6UX73"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX73"
FT                   /protein_id="ABR84781.1"
FT                   /translation="MDNQRQHPRTPIKCRIRISHPQLGELMAQTRDLSDTGVYVKHPDL
FT                   LRLDVGSIVTGQVQDLPIEAPVLRMEVVRIDAEGVGLRFLADQ"
FT   gene            13999..14655
FT                   /locus_tag="PSPA7_0013"
FT   CDS_pept        13999..14655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0013"
FT                   /product="inner membrane protein YhhQ"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02592; match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84027"
FT                   /db_xref="GOA:A6UX74"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX74"
FT                   /protein_id="ABR84027.1"
FT                   /translation="MSASSPTAWRGTLAGLIVFHIFIIIASNYLVQLPVTLFGWHTTWG
FT                   AFSFPFIFLATDLTVRLMGKGPARLVIARVMLPALIASYLVSVLFQEAAFRGLSALLEF
FT                   NTFVARISLASFLAYVLGQVLDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFFVAF
FT                   WRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPRTDDA"
FT   gene            complement(14713..14982)
FT                   /locus_tag="PSPA7_0014"
FT   CDS_pept        complement(14713..14982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0014"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84672"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX75"
FT                   /protein_id="ABR84672.1"
FT                   /translation="MSKHTRYAPPQLHFEPDQALLYIYRNASSDALFETAQERLKGLVG
FT                   LLQALERFRTRTGGDLSIGRATDILHTLASDALTLHMAARNVAP"
FT   gene            complement(15288..15602)
FT                   /locus_tag="PSPA7_0015"
FT   CDS_pept        complement(15288..15602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0015"
FT                   /product="TPR domain protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82265"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX76"
FT                   /protein_id="ABR82265.1"
FT                   /translation="MIEGLEKMLAKGVDNALLRFGLGKGYLDAGNAERAAEHLQSCVEQ
FT                   DPGYSAGWKLLGKARQAGGDLDGARRAWEQGLKAATAHGDKQAEKEMAVFLRKLDKAKP
FT                   "
FT   gene            complement(15657..17108)
FT                   /gene="trkH2"
FT                   /locus_tag="PSPA7_0016"
FT   CDS_pept        complement(15657..17108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH2"
FT                   /locus_tag="PSPA7_0016"
FT                   /product="potassium uptake protein TrkH"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02386; match to protein family HMM TIGR00933"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84180"
FT                   /db_xref="GOA:A6UX77"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX77"
FT                   /protein_id="ABR84180.1"
FT                   /translation="MHYASIFRILGVLLMLFSSAQIPPLLVALFYAEPVWQPFLLAFVI
FT                   TLATGACIWWPVRGVQEELRIREGYLITALFWVVLGSFGAIPFMFSETPHMSLTDALFE
FT                   AISGISTTGATVLTGLDRLPRAILYYRQQLQWFGGMGIVVLAVAIMPMLGIGGMQLYRA
FT                   EMPGPLKEQKLSPRIADTAKTLWLIYCGLTLACALAYWAAGMSLFDAVGHSFSTIAIGG
FT                   FSTHDASIGYFDSPLIEAICMFFLVVSGINFGLHFLAWRRRSLAHYLRDPECRAYLSIL
FT                   LAVFLVTALALVAQRHYEQPLQAIRYAAFMVVSIGTTTGFGLADFATWPTFLPHLLLYT
FT                   TFIGACAGSTGGGMKVMRILLVYRQGMREFMRLLHPSGVFLVKLGRRPIPDRVVESVWG
FT                   FCSIYLVTFVVLMLVLLALGVDLLTAFSSLSSCLNNLGPALGEAAAHYGGLPDSAKLVL
FT                   AFAMMLGRLEVFSLLILFTPAFWRY"
FT   gene            complement(17245..18618)
FT                   /gene="trkA"
FT                   /locus_tag="PSPA7_0017"
FT   CDS_pept        complement(17245..18618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PSPA7_0017"
FT                   /product="potassium uptake protein TrkA"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02080; match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86083"
FT                   /db_xref="GOA:A6UX78"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX78"
FT                   /protein_id="ABR86083.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREPAY
FT                   LTRTGLFDNDAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAYYGG
FT                   PLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIRAVMG
FT                   EMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDSTIVLNG
FT                   SASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSKVIGRSIN
FT                   EIKLPPGTTIGALVRDEEVLIAHGDTRIESDDHVLLFLVDKKYIRDVERLFQAGLTFF"
FT   gene            complement(18646..19950)
FT                   /gene="sun"
FT                   /locus_tag="PSPA7_0018"
FT   CDS_pept        complement(18646..19950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="PSPA7_0018"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01029; match to protein family HMM PF01189; match to
FT                   protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82765"
FT                   /db_xref="GOA:A6UX79"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX79"
FT                   /protein_id="ABR82765.1"
FT                   /translation="MNPRLAACQALAAVLAGRASLSGALPAQLDKVAPRDRGLTQELAF
FT                   GAARWQPRLQALAARLLQKPFKAADNDIHALLLIGLYQLLYTRVPPHAAIGETVGCADK
FT                   LKKGWAKGVLNAVLRRAQREGETLLAEVDRDPSARLGHPRWLLKALQQAWPEQLEALCA
FT                   ANNAHPPMTLRVNRRHGERDTYLAELAEAGIEARACDYSRDGIQLAAPRDVRELPGFAE
FT                   GRVSVQDEAAQLAAELLESAPGQRVLDACCAPGGKTCHLLEIQPELGEVVAVDLEQSRL
FT                   LRVRENLQRLGLEARLVAADARATGEWWDGQPFQRILLDAPCSATGVIRRHPDIKLARK
FT                   PDDIAALAQLQGELLDALWPTLEVGGVLVYATCSVMPSENSDGIAAFLARTPGARELDL
FT                   PGPWGMKQAHGRQLLPQVDGHDGFYYAKLIKISAR"
FT   gene            complement(19947..20891)
FT                   /gene="fmt"
FT                   /locus_tag="PSPA7_0019"
FT   CDS_pept        complement(19947..20891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PSPA7_0019"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86249"
FT                   /db_xref="GOA:A6UX80"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UX80"
FT                   /protein_id="ABR86249.2"
FT                   /translation="MSQALRIVFAGTPEFAAEHLKALLDTPHQLVAVYTQPDRPAGRGQ
FT                   KLMPSAVKSLALEHGLPVIQPPSLRSADAQAELAALRPDLMVVVAYGLILPQAVLDIPR
FT                   LGCINSHASLLPRWRGAAPIQRAVEAGDAQSGVTVMQMEAGLDTGPMLLKVATPIAADD
FT                   SGGSLHDRLAALGPKAVVEAIAGLAAGTLRGEVQDDALATYAHKLNKDEARLDWSRPAV
FT                   ELERQVRAFTPWPVCHSSLAGASLKVLGASLGHGSGTPGSILEASRDGLLVACGEGALR
FT                   LTRLQLPGGKPLAFADLYNSRREQFAAGQVLGQ"
FT   gene            complement(20944..21450)
FT                   /gene="def2"
FT                   /locus_tag="PSPA7_0020"
FT   CDS_pept        complement(20944..21450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def2"
FT                   /locus_tag="PSPA7_0020"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85836"
FT                   /db_xref="GOA:A6UX81"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX81"
FT                   /protein_id="ABR85836.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRIKALDRDGKPFEEVAEGLLAVCIQHECDHLNGRLFVDYLSTLKRDRIRKKLEKQ
FT                   HRQQA"
FT   gene            21589..22614
FT                   /locus_tag="PSPA7_0021"
FT   CDS_pept        21589..22614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0021"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82249"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX82"
FT                   /protein_id="ABR82249.1"
FT                   /translation="MRKSLVALLLLAASGLAQAQVDLREGHPDRYTVVRGDTLWDISGK
FT                   FLRQPWKWPQLWHANPQIQNPHLIYPGDTLSLVYIDGQPRLVLNRGESRGTIKLSPKIR
FT                   STPIAEAIPTIPLDKINSFLLANRIVDDEKTFTAAPYIVAGNAERIVSGTGDRVYARGK
FT                   FADGQPAYGIFRQGKVYVDPKTKEVLGINADDIGGGEVVATEGDVATLALTRTTQEVRL
FT                   GDRLFPTEERAVNSTFMPGEPSREVKGEIIDVPRGVTQIGQFDVVTLNRGLRDGLAEGN
FT                   VLAIYKVGETVRDRVTGESVKIPDERAGLLMVFRTYQKLSYALVLMASRPLSVTDRVQN
FT                   P"
FT   gene            22749..23837
FT                   /locus_tag="PSPA7_0022"
FT   CDS_pept        22749..23837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0022"
FT                   /product="protein smf (DNA-processing chain A)"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02481; match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86700"
FT                   /db_xref="GOA:A6UX83"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX83"
FT                   /protein_id="ABR86700.1"
FT                   /translation="MNNLSHAELDARLRLHGLPELGPIRFLRLIEAFGSASSALAAPAG
FT                   AWHTLGLPAEAAAARRSAEVRERAADALRWLEAPRRHLLMWDDPAYPALLGEVSDAPPL
FT                   LFVEGAPTALERPQLAMVGSRRASPAGLGCARSFARSLARGGFAITSGLALGIDGAAHE
FT                   GALEVGGVTLAVLGTGLRTLYPRRHAALARRIVEGGGALVSELPLDSPPLPANFPRRNR
FT                   IISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIRDGALL
FT                   VESVEHVLEALRGWTQAGPAEAPVASLDHPLLELLRVAPYSSEGLAAASGWALPEVLAA
FT                   LTELELDGRVACEAGTWVHRSG"
FT   gene            23877..24434
FT                   /locus_tag="PSPA7_0023"
FT   CDS_pept        23877..24434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0023"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01300"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85187"
FT                   /db_xref="GOA:A6UX84"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UX84"
FT                   /protein_id="ABR85187.1"
FT                   /translation="MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLA
FT                   LKARPVEKGLIVVAAHIHQLDFLLEDLPDVWLERLAGTWPGPNTWLVPHQDRLPEWVTG
FT                   VHDSVAVRVTDHPLVQELCYLTGPLISTSANPAGRPAARTRLRVEQYFHDELDGVLGGA
FT                   LGGRRNPSLIRDLVTGQVIRPA"
FT   gene            complement(24445..25422)
FT                   /gene="qor"
FT                   /locus_tag="PSPA7_0024"
FT   CDS_pept        complement(24445..25422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="PSPA7_0024"
FT                   /product="quinone oxidoreductase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00107; match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84557"
FT                   /db_xref="GOA:A6UX85"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX85"
FT                   /protein_id="ABR84557.1"
FT                   /translation="MAKRVQFAAYGSPEVLEYRDYQPAEPGPREVRVRNRAIGLNFIDT
FT                   YYRSGLYPAPGLPSGLGSEGAGEVEAVGSAVTRFQVGDRVAYATGPLGAYSELHVLAED
FT                   NLVRLPEAIDFEQAAAMMLKGLTTQYLLRQTYELQSGETILFHAAAGGVGLFACQWAKA
FT                   LGVKLIGTVSSPEKARLARQHGAWETIDYSHENVAKRVLELTDGKKCPVVYDSVGKDTW
FT                   ETSLDCVAPRGLLVSFGNASGPVTGVNLGVLSQKGSLYVTRPTLGSYANTPEKLQAMAD
FT                   ELFGLVERGAIRIEINQRFALVDAAQAHTELAARRTTGSTVLLP"
FT   gene            25614..26531
FT                   /gene="hemF"
FT                   /locus_tag="PSPA7_0025"
FT   CDS_pept        25614..26531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="PSPA7_0025"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81171"
FT                   /db_xref="GOA:A6UX86"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UX86"
FT                   /protein_id="ABR81171.1"
FT                   /translation="MTDRIAAVKTYLLDLQDRICAALEAEDGKARFAEDAWERPAGGGG
FT                   RTRVIGDGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPHVP
FT                   TSHANVRFFCAEKAGEEPVWWFGGGFDLTPYYASEEDCVHWHRVARDACAPFGADVYPR
FT                   YKEWCDRYFHLKHRNEPRGIGGLFFDDLNQWDFDTCFAFIRAIGDAYIDAYLPIVQRRK
FT                   HTPFDERQREFQAYRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKP
FT                   EPGSEEARLTEYFLTDRDWLAGQP"
FT   gene            26589..27413
FT                   /gene="aroE"
FT                   /locus_tag="PSPA7_0026"
FT   CDS_pept        26589..27413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PSPA7_0026"
FT                   /product="shikimate dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01488; match to protein family HMM PF08501; match to
FT                   protein family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81362"
FT                   /db_xref="GOA:A6UX87"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UX87"
FT                   /protein_id="ABR81362.1"
FT                   /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGQALAYEAQLAPLDDFAG
FT                   FARRFFEQGKGANVTVPFKEEAYRLVDELSERATRAGAVNTLVRLDGGRLRGDNTDGAG
FT                   LLRDLTVNAGVQLRDRRVLLLGAGGAVRGVLAPFLGERPAQLLVANRTAEKAVALAGEF
FT                   ADLGAVRGCGFADVEGPFDLIVNGTSASLAGDVPPLAESVIERGRTVCYDMMYAKEATA
FT                   FNRWAAERGAARTLDGLGMLVEQAAEAFFLWRGVRPASAPVLETLRRQLATG"
FT   gene            27525..28511
FT                   /locus_tag="PSPA7_0027"
FT   CDS_pept        27525..28511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0027"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83360"
FT                   /db_xref="GOA:A6UX88"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX88"
FT                   /protein_id="ABR83360.1"
FT                   /translation="MKTLTRLAAGLCICAIAGQANAWSQPTHKNIVKDALAFMNSSYAT
FT                   EEMRQAYQFYVSAAGGEAQAGEILGQAAFDVDDFKDTRLGGWWVGYEHAPLWGAASGIV
FT                   NYTSYWHFLNLARDGDSHGNPHGGYDYRYHKVDGGIADVDWYAMVYLYNRELKREDFDT
FT                   TEAHYRQGTRSDWQEHYGDFQTAAFQPIDNLASYWFDQFRAAPSLQTIGYALHATGDVA
FT                   QPHHVWITSANGHSSWEGWVDDHYASEKLNDPAAVANLVGRYDPSKSIRDLLTQTGQVA
FT                   YAHPEPLYDTSYETRLRVAKELIPESIALTVTVLTKGANSFNAQTAL"
FT   gene            28492..29778
FT                   /locus_tag="PSPA7_0028"
FT   CDS_pept        28492..29778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0028"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85223"
FT                   /db_xref="GOA:A6UX89"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX89"
FT                   /protein_id="ABR85223.1"
FT                   /translation="MRKPLSDRRPGWRRAICGVALALLACAAQAVPGEVPRDLTIDGEV
FT                   LPGKSIDLLERALSRVKFNTDPRQLRRGLVENRLLAREVEGQLTAQNRADLDASVEIEA
FT                   GNLLEQLYGKRYREDLGPFLRQPQPLSAERLRQVLAPASRGLVENSLVLGEAQRREAAG
FT                   VELIGWQFPGQPARTLDLLSLYEGDNVQGQVELQQGNLAYLARQVQTRLRRDYLWYRLA
FT                   RDGFGPAEQRGLKTLVRDRLVRQRYLHQIGLYSDFHHESDVLRQLAAKVSDQDAEAYYR
FT                   RNLERYRNVAQVQAVHIRLADQASADRVYAELQKGLAFDEAVRRHSLADDRDRDPPGDL
FT                   GLIRPQDGQLDLLRKTALIQKADTLSQPMRIDGAFEIVRVRSREDRQLPLSDRSVRFEV
FT                   NQAVARERLAAQFETQLRGLLAGARVEGL"
FT   gene            29775..30377
FT                   /locus_tag="PSPA7_0029"
FT   CDS_pept        29775..30377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0029"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80983"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX90"
FT                   /protein_id="ABR80983.1"
FT                   /translation="MKRWLGVALGCSGLAMALACAGVLWMPSAETVASPSAPPTAGTAM
FT                   AAAAVEDPPPVERARTPAAVRHVVGQPSAPGLDREQAILFMQMLRDEGDPRSPPLGGLQ
FT                   PRQGASAEALADPKRYQAFEERQTRELVQAYTSGVQQIPEIRARIEAAEQGGERSAEDI
FT                   DEARAALGQLEMMRDKLQRESPQLLPGDSAPPAPAVP"
FT   gene            complement(30381..31934)
FT                   /locus_tag="PSPA7_0030"
FT   CDS_pept        complement(30381..31934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0030"
FT                   /product="putative sulfate transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00916; match to protein family HMM PF01740"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85270"
FT                   /db_xref="GOA:A6UX91"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX91"
FT                   /protein_id="ABR85270.1"
FT                   /translation="MRSRLLPFLAWLPGLRRGDLGREAWVGLNGAVLALPQSMAYALIA
FT                   GLPAAYGLYAAMLPVAIACLWGSSRYLVSGPTAAISVLLFSSVAPLAPVGSAEYIQAVL
FT                   LLTFLAGAFQCLLGLLRIGSLVNFVSHSVMLGFTLGAALLIVLGQLPYLFGLPANGEGA
FT                   VPGNGWRLLRRVAEIDGPSLLVGGFSFALSLLVRRLRPRWPALPLGLLGGATLVWALPA
FT                   TFASVAHVQALSSALPAWSPPVFEARAILDLLPAAVACGMLGLVTSLSIARALAARQGD
FT                   AFDANQEVRAQGLSNLFGPWLSASLSAGSFTRSGLNLEAGARSPLAGVFSALWVALLAV
FT                   LGARLIEHLPLPAMAAGILLIAWGLVDRPALRALYRSGRGECLVAGLTSLATLLLPLQN
FT                   AIYAGVLASLFFYLRRTSTPRVLRQRNDEEEVLRIEGSIFFGACDYLQRLMRQSDKPRL
FT                   VLDARQVNFIDFAGAVLLQQEARRLHAEGRRLVLRHARPQVREALGRQADEDSRLHYEG
FT                   "
FT   gene            complement(31939..32862)
FT                   /locus_tag="PSPA7_0031"
FT   CDS_pept        complement(31939..32862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0031"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85750"
FT                   /db_xref="GOA:A6UX92"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX92"
FT                   /protein_id="ABR85750.1"
FT                   /translation="MNRLPTRLLAATLLLGSTPLHAEDAACAHVRLADPGWSDIAVTNA
FT                   SAAFLLESLGYRVKIETLSVPIIYGGLRDGQVDAFLGGWMPAHQDYHERFVASGQVERL
FT                   GRNLDGTRFTLAVPRYVWDAGIHRFEDLARQAQRFDRKLYGIGSGAPANQSIQKMIDAN
FT                   RFGLGDWKLVASSEQAMLAELARAEKRQRWLVFLGWTPHPMNLRHELRYLDGGEQYFGE
FT                   RGQVYTLARKGYAAQCPNPARLLANLRFALDMENQMMSDALQGSATPATAARAWLKAHP
FT                   QVLDAWLRGVTARDGGDALAAVRDRL"
FT   gene            complement(32880..34391)
FT                   /gene="betC"
FT                   /locus_tag="PSPA7_0032"
FT   CDS_pept        complement(32880..34391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="PSPA7_0032"
FT                   /product="choline-sulfatase"
FT                   /EC_number="3.1.6.6"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00884; match to protein family HMM TIGR03417"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86445"
FT                   /db_xref="GOA:A6UX93"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX93"
FT                   /protein_id="ABR86445.1"
FT                   /translation="MKTPPNILFIMADQMAAPLLPFHDPRSVLRMPNLSRLAERAVVFD
FT                   SAYCNSPLCAPSRFTLVSGRLPSRIGAWDNAADFAADTPTYAHYLRRLGYRTALSGKMH
FT                   FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPEVRPSWYHNMSSVLQAGPCVRTNQLDF
FT                   DEEAVFKARQYLYDHVRQHAGQPFCLTVSMTHPHDPYCIPASYWNLYRDEDIPLPRQSF
FT                   AQEEQDPHSQRLLKVIDLWDKPLPEERIRAARRAYFGACSYVDAQVGALLATLEECGLA
FT                   DDTILVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPGRFAARRIGASVSTVDLLP
FT                   TLVELAGGQVDARLPLDGRSLLPHLRDGSGHDEVIGEYTAEGTLGPLMMIRRGDYKFIY
FT                   SEQDPCLLYDLRNDPQERENLAASPAHRGAFEAFLDEARRRWDIPALTRAVLDSQRRRR
FT                   LVAEALTRGRLTSWDHQPWVDASQQYMRNHIDLDDLERRARFPQP"
FT   gene            34520..35419
FT                   /locus_tag="PSPA7_0033"
FT   CDS_pept        34520..35419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0033"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466; match to
FT                   protein family HMM TIGR03418"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85610"
FT                   /db_xref="GOA:A6UX94"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX94"
FT                   /protein_id="ABR85610.1"
FT                   /translation="MPLSLDLLRVFESAARQLSFTAAAEELGSTQPAVSQQIKRLEQEL
FT                   QTELFQRVHRGILLTDAGLLLLRHVAPALESVEAGIAALGARQRHEVLQVATDYAFAAY
FT                   WLMPRLPRFHLAHPHLDVSLVTSERGLAGPRGDIDVAILFGDGRSKHGETHRLFREEVF
FT                   PVCSPRLLEGLPLPLAKEHLARLPMLHLKPAQHSRWFDWPALFEALAIDRQPIPAVLSF
FT                   DNYTLLIQAAIAGQGVAIGWRHLVDDLLEQGLLCRPISESCLSRYGYYALLPERKRRQR
FT                   LVDAFVGWLRAELQAGGA"
FT   gene            35430..35807
FT                   /locus_tag="PSPA7_0035"
FT   CDS_pept        35430..35807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0035"
FT                   /product="dopa 4,5-dioxygenase"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF08883"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83482"
FT                   /db_xref="GOA:A6UX95"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX95"
FT                   /protein_id="ABR83482.1"
FT                   /translation="MNEFSTPRIQGFHAHVYFDAQSIERARALCEEAARRFPLKMGRVH
FT                   QRPVGPHPDWSCQLAFTPELFGELIPWLAIHRQDLVVFVHPVTGNDLVDHRDRAMWMGA
FT                   IRPLDLSILDEGAESYDFRAP"
FT   gene            complement(35786..36151)
FT                   /locus_tag="PSPA7_0034"
FT   CDS_pept        complement(35786..36151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0034"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82649"
FT                   /db_xref="GOA:A6UX96"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX96"
FT                   /protein_id="ABR82649.1"
FT                   /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNSEDTRKLRRAQERE
FT                   QIQELNELAHRLAGMASLIHAHAVERACHHLEIACGETSVSNLADAVDELVTALGDLQC
FT                   ELHDWMTLTEPQGARKS"
FT   gene            complement(36159..36782)
FT                   /locus_tag="PSPA7_0036"
FT   CDS_pept        complement(36159..36782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0036"
FT                   /product="putative two-component response regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00072; match to protein family HMM PF00196; match to
FT                   protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83170"
FT                   /db_xref="GOA:A6UX97"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX97"
FT                   /protein_id="ABR83170.1"
FT                   /translation="MSKVLIVDDHPAIRLAVRLLFERDGFTIVGEADNGAEALQVARKK
FT                   SPDLAILDIGIPKIDGLEVIARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVSKR
FT                   ENLSELLLAAKAVLAGYIHFPTGALRSINQQSRDNEARMLESLSDREMTVLQYLANGNT
FT                   NKAIAQQLFLSEKTVSTYKSRIMLKLNAHSLAGLIDFARRHELI"
FT   gene            complement(36967..37773)
FT                   /gene="trpA"
FT                   /locus_tag="PSPA7_0037"
FT   CDS_pept        complement(36967..37773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="PSPA7_0037"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00290; match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80868"
FT                   /db_xref="GOA:A6UX98"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UX98"
FT                   /protein_id="ABR80868.1"
FT                   /translation="MSRLQTRFAQLKQDNRAALVTFVTAGDPDYDASLEILKGLPAAGA
FT                   DVIELGMPFTDPMADGPAIQLANIRALQGGQTLAKTLRMVREFRAGDSDTPLVLMGYFN
FT                   PIHHYGVERFVTEAKEAGVDGLIVVDLPPEHNEDLCHPAQAAGIDFIRLTTPTTGDERL
FT                   PTVLEGSSGFVYYVSVAGVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAA
FT                   VARLADGVVVGSALIERIAKAGDTARAVKDVLALCGELAEGVRNAR"
FT   gene            complement(37770..38978)
FT                   /gene="trpB"
FT                   /locus_tag="PSPA7_0038"
FT   CDS_pept        complement(37770..38978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="PSPA7_0038"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00291; match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85655"
FT                   /db_xref="GOA:A6UX99"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6UX99"
FT                   /protein_id="ABR85655.1"
FT                   /translation="MTAYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPA
FT                   FQEELAYFQRDYVGRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLA
FT                   RRMGKKRIIAETGAGMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVI
FT                   PVTAGTGTLKDAMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQL
FT                   AEKEGRLPDSLVACIGGGSNAMGLFHPFLDDAGVRIVGVEAAGHGIDTGKHAASLNGGV
FT                   PGVLHGNRTFLLQDADGQIIDAHSISAGLDYPGIGPEHAWLHDVGRVEYTSITDDEALD
FT                   AFHTCCRLEGIIPALESSHALAEAFKRAPGLPGDHIMVVNLSGRGDKDMQTVMHHMQQE
FT                   HKA"
FT   gene            39076..39969
FT                   /gene="trpI"
FT                   /locus_tag="PSPA7_0039"
FT   CDS_pept        39076..39969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpI"
FT                   /locus_tag="PSPA7_0039"
FT                   /product="transcriptional regulator TrpI"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466; match to
FT                   protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82873"
FT                   /db_xref="GOA:A6UXA0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA0"
FT                   /protein_id="ABR82873.1"
FT                   /translation="MAMSRELPSLNALRAFEAAARLHSISLAAEELHVTHGAVSRQVRL
FT                   LEEALGVPLFGKEGRGIKLTDAGLRLRDACGDAFERLRGVCAELRRQTAEAPFVLGVPG
FT                   SLLARWFIPRLDRLNRALPDLRLQLSTSEGELDPQRPGLDALLWFAAPPWPADMQVFEL
FT                   APERMGPVLSPRLARETGLAEAPAARLLEEPLLHTASRPQAWPAWAVSQGLAPEALRYG
FT                   QGFEHLYYLLEAAVAGLGVAIAPEALVRDDLAAGRLVAPWGFIETDARLALWVPARLHD
FT                   PRAERLAQWLRECLAD"
FT   gene            40071..40286
FT                   /locus_tag="PSPA7_0040"
FT   CDS_pept        40071..40286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0040"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF07311"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84826"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA1"
FT                   /protein_id="ABR84826.1"
FT                   /translation="MSNHHTYKKIELVGSSRTSIEDAINNALAEAAKSIQHLEWFEVVD
FT                   TRGHIENGAVGHYQVTLKVGFRIADS"
FT   gene            40398..40625
FT                   /locus_tag="PSPA7_0041"
FT   CDS_pept        40398..40625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0041"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82372"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA2"
FT                   /protein_id="ABR82372.1"
FT                   /translation="MFMKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAYT
FT                   LEIVDKGSVTDKKVVGSCDGGTKEIVYQRG"
FT   gene            40918..42606
FT                   /locus_tag="PSPA7_0042"
FT   CDS_pept        40918..42606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0042"
FT                   /product="ShlB family hemolysin secretion/activation
FT                   protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86143"
FT                   /db_xref="GOA:A6UXA3"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA3"
FT                   /protein_id="ABR86143.1"
FT                   /translation="MAIPRLALVLLCLPLMASAAPFTSPGDRDLIRERQQRLLDEQRKR
FT                   LEELQQLPGNEAPSTPGGSAGDGRCFDIRRIELEGAEHLAQGARDELLAPYQGKCLGVG
FT                   QLNALLKAVTDHYLDRGYVTTRAYLPQQDLASGTLRVIVVEGRLEGLDSSALASPRELA
FT                   MSFPGKTGELLDLRELEQLVDQLGRLPSRQAQLELVPGSQVGGSRVRLKGERDKPWRVS
FT                   ATRNNDGDVSTGEQQMGLGLDWDSPLGLADQLSLRANQDAVSDRWRHSDSQSLFYSLPW
FT                   GWWTFTYGYSQSDYRTRNETSGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMSLGLSHQ
FT                   RTNNYIEDTRLEDQSTRITETQLGFNHGRRIGSGFVNLDLGWQQGIGALGAQGRGQPRG
FT                   GDAHARYDKYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLGGNSSVRGF
FT                   KDQTLTGDSGGYWRNQLRWRRAVQWAPLRPWLQEYGVAFAYDVGVIRHDRYNDGASGRM
FT                   SGNAIELDARGRYFAASVGFARSLERPSVIERREHPIYFRVDAFF"
FT   gene            42719..53214
FT                   /pseudo
FT                   /locus_tag="PSPA7_0043"
FT                   /note="filamentous haemagglutinin, frameshifted"
FT   gene            53224..53757
FT                   /locus_tag="PSPA7_0045"
FT   CDS_pept        53224..53757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0045"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81236"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA6"
FT                   /protein_id="ABR81236.2"
FT                   /translation="MNSSCQHVLYDLVDFSKKLPDNVVKVKKGMTFFVERSALYSLSIL
FT                   KLLFFVSVNSGAKKIFFCFLVAQKNKFEISSVYEVDLLEVNFTEIENRLCSLYEEHVLV
FT                   GEVGRIVAFSDMVSWVLYEEVLEEIGVLVMLDETKSVYSNFDFGEFVSRDFMMEQADLG
FT                   LYRKEYVDKLISNY"
FT   gene            53972..54355
FT                   /locus_tag="PSPA7_0046"
FT   CDS_pept        53972..54355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0046"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83576"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA7"
FT                   /protein_id="ABR83576.1"
FT                   /translation="MTLFEECKEALRADFNIVEGQAQQDAIDILYKYPLEKGNILWSEM
FT                   EYSDYENIDALLDVNSIKNADVFVFADDVNIPIFRTNLKLIAENIYDVIALSPKLFIFN
FT                   NNMILETLFPTEMFRLGIKAINP"
FT   gene            55569..56261
FT                   /locus_tag="PSPA7_6372"
FT   CDS_pept        55569..56261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6372"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4D6FUW3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FUW3"
FT                   /protein_id="QCB64546.1"
FT                   /translation="MPRQGRVVLPNYPLHVVQRGHNRQVVFAEDEDYQRYLSDLRDLKD
FT                   AFGIKVYAFCLMTNHVHLLLAPGDSLSGLAQLMKTLAARTTRYRNRLEGRSGTLWESRY
FT                   KSSVVQSDAYLLACCRYIELNPVRARMVDDVAAYPWSSYGLRANWLKEPNWLDMDPCFI
FT                   GLGQTAEERYRRYVTFVKEAIPAEELKLIREAVQRGQLTGNQRFVDEIERVAGVRIERR
FT                   GQGRPRLE"
FT   gene            56384..56701
FT                   /locus_tag="PSPA7_6373"
FT   CDS_pept        56384..56701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6373"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A4D6FV30"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FV30"
FT                   /protein_id="QCB64547.1"
FT                   /translation="MSSRPTLEEWNFQVLMLIQALVGAISANFRMIVLLWDGDEWVLRF
FT                   YLEESSEEDVEEIEDVVCQYTAYQGSSLRCRSELIVGHERLPGLSEVGRVVYRRRESFD
FT                   I"
FT   gene            complement(57148..58401)
FT                   /locus_tag="PSPA7_0047"
FT   CDS_pept        complement(57148..58401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0047"
FT                   /product="membrane protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85458"
FT                   /db_xref="GOA:A6UXA8"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA8"
FT                   /protein_id="ABR85458.1"
FT                   /translation="MTLSLELLLSLCTALAIGLLIGAERGWQARDREDTRQIAGIRTFS
FT                   LVGLLGGFATLLAGELGSAVWVALLLALAALVVAGYVSDVRRGGDQGMTTEIALLTTFL
FT                   LGSLALTEQRLMAAAGGIVLTLLLSLKDKLHAVLKRLTAEELSGTLKLLFISVVLLPVL
FT                   PDRGYGPWAFFNPYLTWWMVVLIAALGFSAYLAIRLVGSRKGLLLTAVLGGLVSSTVMT
FT                   LTLARLRQRMPDALLACGLLATSALMFPRILVEIGALHPALLKELALPFAATTLVYLGG
FT                   TLFHALRGGRASQEAPDEPGLRNPFELLPALRFAALLSAILLLVEAGRRLFGDAGIYAV
FT                   ALLSGLADVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLVVLVGGKRLALL
FT                   TLPFSLAGLLVGALLILL"
FT   gene            58884..59570
FT                   /locus_tag="PSPA7_0048"
FT   CDS_pept        58884..59570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0048"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03783"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85675"
FT                   /db_xref="GOA:A6UXA9"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXA9"
FT                   /protein_id="ABR85675.1"
FT                   /translation="MSHRAKKALLPLLAAATLAGLAGCATETSTALPVQQVESVNRPYS
FT                   GVRSPIAVGKFDNRSSYMRGIFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMSEIQ
FT                   QEAAIKGQAQRLKGADYVVTGDVTEFGRKEVGDRQLFGILGRGKSQIAYAKVALNIVNI
FT                   STSEVVYSTQGAGEYALSNREVIGFGGTASYDSTLNGKVLDLAMREAVNKLVNAVDSGA
FT                   WKPQNQ"
FT   gene            59601..59954
FT                   /locus_tag="PSPA7_0049"
FT   CDS_pept        59601..59954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0049"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82263"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB0"
FT                   /protein_id="ABR82263.1"
FT                   /translation="MSKTITWTAALLGSMALAGCSGPKTLYQWEGYQAQVHEYFKGESK
FT                   EAQAQALEADLEKIRAKNGAVPPGYHAQLGLLYSSLGKDDQMVREFKTEKALFPESATY
FT                   MDFLLNNARGGAR"
FT   gene            59951..60616
FT                   /locus_tag="PSPA7_0050"
FT   CDS_pept        59951..60616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0050"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF05643"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81499"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB1"
FT                   /protein_id="ABR81499.1"
FT                   /translation="MKLARLSGLVAGFTLLALLGGCAPTKSVDYSAFKQAKPRSILVLP
FT                   PLNESPDVKATYSMLSQVTFPLAEAGYYVVPVALADETFRQNGLTSAGDVHQVSPAKLR
FT                   EIYGADAALYVTVSDYGTRYMVISSATIVTASARLVDLRSGTTLWTGTATASSEENNGG
FT                   NNGGLVGMLITAAVKQIINSSVEDAGYPIAGMTSARLLSAGQPGGLLYGPRSPKYGSD"
FT   gene            complement(60631..61047)
FT                   /locus_tag="PSPA7_0051"
FT   CDS_pept        complement(60631..61047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0051"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82210"
FT                   /db_xref="GOA:A6UXB2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB2"
FT                   /protein_id="ABR82210.1"
FT                   /translation="MSFSQNVLRLRRQNALTQRQMAERLGVTLSQFRHFETKGGQPSLA
FT                   VLKTFAGRFGVSLDWLICDRGERRALQADLQLQFEAIGRLRLDERRAIRALLDELIRQY
FT                   MAKRNLPAKPRPAPGAPPPPVRPANRAEATDAPP"
FT   gene            complement(61423..63084)
FT                   /locus_tag="PSPA7_0052"
FT   CDS_pept        complement(61423..63084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0052"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84815"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB3"
FT                   /protein_id="ABR84815.1"
FT                   /translation="MRYARFASRHSLLALAVAAALLPGASWAASGERAAARKPPSAACA
FT                   WNRDVPLSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFARRLCADNG
FT                   RTPVTSYAKALKLVTEEGRALWRAAVDRVQGRRAIPAGALPASDDRMLYWTRTYMTRTL
FT                   RQWAPSFRLSQAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVFTLGA
FT                   PGTPNTGLRNGNPSGATALALDGREIRLSDGSLLRIEAYLLPVSYDPFNRGMQEDTLGP
FT                   WFRPGPRRVDASITISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADKALPNYVLPLG
FT                   SVTNPGSAPISLPGSGCNINPPRRWLGYDSASHWRRNLPAQFSRASLPVRQLLAADTWR
FT                   GIERPPGATSQAAEGFDVTWHTNYAFFPDCAKPQTESVPSNGVMNAMPDPALVLPPNRR
FT                   ICARNGGGGDYLSNESAYRNTVLRDTFGLDIPAGHIHVPVMNNYYTGSPASGGSARNDN
FT                   AISDARYEAYRSAIVAQTRALLVGVGNALAQGAKAD"
FT   gene            complement(63619..64047)
FT                   /locus_tag="PSPA7_0053"
FT   CDS_pept        complement(63619..64047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0053"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84482"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB4"
FT                   /protein_id="ABR84482.1"
FT                   /translation="MDLRPSHVHVFPPSRDLPAETHPHRETLLRSGCAWNGSLYLGYPL
FT                   GQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGCLM
FT                   NIIHRLVAGAEPVEALLFHAGVEGMPVGLGDRGETPAG"
FT   gene            complement(64300..64848)
FT                   /locus_tag="PSPA7_0054"
FT   CDS_pept        complement(64300..64848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0054"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01885"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83060"
FT                   /db_xref="GOA:A6UXB5"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UXB5"
FT                   /protein_id="ABR83060.1"
FT                   /translation="MDRKTLDDTSRFLSHVLRHQPEAIGLTLDGEGWADIDALIAGAAR
FT                   DGRALDRALLGAVLRSNDKQRFAFSADGQRIRAVQGHSHAAVAIAYAPAVPPAVLYHGT
FT                   ARRFLDSIREHGLVPGSRHHVHLSARRATALEVGRRYGSPVLLEVDARDMHLAGHLFHQ
FT                   AENGVWLAGQVPVRFIREA"
FT   gene            complement(64887..65393)
FT                   /locus_tag="PSPA7_0055"
FT   CDS_pept        complement(64887..65393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0055"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85393"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB6"
FT                   /protein_id="ABR85393.1"
FT                   /translation="MSLSIYQASIPTFLRTLGNLSAILKKAAAHAEAKNIDPRIFIDAR
FT                   LAPDMFPLARQVQIASDAAKGAGARLAGLEVPSYADTETTFDELQARIARTVEFLEGIR
FT                   EEQLDGAEERNVTLKVRGQEISFNGRDYLFGFALPNFFFHVTTAYAILRHNGVELGKMD
FT                   FLGGA"
FT   gene            complement(65459..66379)
FT                   /locus_tag="PSPA7_0056"
FT   CDS_pept        complement(65459..66379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0056"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83691"
FT                   /db_xref="GOA:A6UXB7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB7"
FT                   /protein_id="ABR83691.1"
FT                   /translation="MDRLTATRVFVEVIDSGSQTAAAERLDMSRAMVSRYLAELEEWVG
FT                   ARLLHRSTRRLSLTDAGAELLPQCREMLAVADSMQATGQTRRDSPRGTLRITSSLSFAQ
FT                   AWLTRAAAAFVERFPGTAIDLQVNSQVINLVEERIDLALRITNQLDPNLIARRLGECRS
FT                   VICAAPDYLRRHGTPRRPEDLALHNCLTYSYFGRSLWQFERDGEPTSVPVGGSLSANES
FT                   TVLLEAAAAGAGISQQPLYSAAPLIRSGRLVALLPEWSPQVLGIHAVYASRRQMPPALR
FT                   ALLDFLVERMAADPHWDEAGPLALA"
FT   gene            66487..67374
FT                   /locus_tag="PSPA7_0057"
FT   CDS_pept        66487..67374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0057"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80972"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB8"
FT                   /protein_id="ABR80972.1"
FT                   /translation="MSRHGLLRSLFAAAALLGAAGVFAASAEPLRLEVYNPGEKAIFAV
FT                   SSELLVGQREAMLIDAQFSRADAEQLVKRIQASGKPLSTIYISHGDPDFYFGLDVLKAA
FT                   FPEAKILATAQTVAHIQATKDAKLAYWGPILKDNAPTSLVVPEPLKGDQLKLEGHALKV
FT                   VDLKGPSPNRTVLWIPSLKTVVGGVLVESGSHVWTADTQTKASRQAWVAMLERIEALQP
FT                   RRVVPGHFTGEEPKGLDGVRFTRDYLKALEAELPKARDSAALVEAMKRRYPNLPGEEGL
FT                   ELSAKVLKGEMQWP"
FT   gene            67437..68138
FT                   /locus_tag="PSPA7_0058"
FT   CDS_pept        67437..68138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0058"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81424"
FT                   /db_xref="GOA:A6UXB9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXB9"
FT                   /protein_id="ABR81424.1"
FT                   /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMTD
FT                   ANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTGAVFDSAPPTAAVLAAEA
FT                   LGGLGAAMLARIQRAHYVEGRRIAERPVLFGLAAELGLGQGFAEAFDACSGEPLRVHFA
FT                   DSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDEWRAFLETQKDIANSTLTSGV
FT                   PAPFCGIDGCP"
FT   gene            68252..68677
FT                   /gene="osmC"
FT                   /locus_tag="PSPA7_0059"
FT   CDS_pept        68252..68677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PSPA7_0059"
FT                   /product="osmotically inducible protein OsmC"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82933"
FT                   /db_xref="GOA:A6UXC0"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC0"
FT                   /protein_id="ABR82933.1"
FT                   /translation="MKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFNTRFEGAPGTN
FT                   PEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAITAVHLVLRARV
FT                   PGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
FT   gene            68788..69021
FT                   /locus_tag="PSPA7_0060"
FT   CDS_pept        68788..69021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0060"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF06649"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83396"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC1"
FT                   /protein_id="ABR83396.1"
FT                   /translation="MKTIGLGIAALLFSATALAAPKPCEELKAEIETKIQSAGVISYTL
FT                   EIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
FT   gene            complement(69034..69471)
FT                   /locus_tag="PSPA7_0061"
FT   CDS_pept        complement(69034..69471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0061"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83025"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC2"
FT                   /protein_id="ABR83025.1"
FT                   /translation="MRPFTRLVPLALLLLAGCAGPLPQPDPKMAWVELRSAPANTLLAE
FT                   RLDGERLSDGRYFQVTPGRHVLEVRFQYELYGGSGGGGGGFGEPVQINCYQQVVYDGFE
FT                   AGRRYRLEVRPQLRRALALLSDERGAVVARSNFQTSRCPPY"
FT   gene            complement(69528..69944)
FT                   /locus_tag="PSPA7_0062"
FT   CDS_pept        complement(69528..69944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0062"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86342"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC3"
FT                   /protein_id="ABR86342.1"
FT                   /translation="MRTLLLAGGLLVLSGCSLLMPTPDPNRAWVDLATQPDADLAAVEV
FT                   DDKTWDRTRYFEVDPGTRELTVRYQFTVDPTNIGPVDSPLWRDCQLNLKFKDFSAGQRY
FT                   RLEAGHIGFRPWAKLYDQDNRELARGREGRCAKV"
FT   gene            70036..71163
FT                   /locus_tag="PSPA7_0063"
FT   CDS_pept        70036..71163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81999"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC4"
FT                   /protein_id="ABR81999.2"
FT                   /translation="MLVGRRAVRVLCYVPPMPRRLRHPLADLRLPRWVPCLALLALSGC
FT                   STVSYYGQLASGQFALLRAREPAAAVIADPQRDARLRERLARAEKARQFASERLDLPDN
FT                   RSYRLYADIGRPYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYSEAAARAEAARQRA
FT                   LGDDVYVGGVQAYSTLGWFDDPILSSMLRWDDERLATLIFHELAHQKFYLRDDTAFNES
FT                   FATFVEQEGTRQWREYRGLPPADGREEKRREQFTALVLASRARLEALYAGPLDDAAKRA
FT                   GKAAEFQRLRREYAALSQREWGGESPFKAWIDSPFNNAKLLPFGLYDQWVPAFAVLFRQ
FT                   VGSNWPAFYARVRALGQLPLAERQAALQRLAAAAP"
FT   gene            complement(71173..72159)
FT                   /locus_tag="PSPA7_0064"
FT   CDS_pept        complement(71173..72159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0064"
FT                   /product="membrane protein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86349"
FT                   /db_xref="GOA:A6UXC5"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC5"
FT                   /protein_id="ABR86349.1"
FT                   /translation="MTDNPFATPSAPVQPPTREVPATTQPYAFIAVLALVTCLSFALSL
FT                   GIQWYNDIGEVRQRFSEHLQLTAPHWFTGLVFYAAANLLALHAYREQRRLVEFRPLALL
FT                   LIGYGLLNLVCGMLAGIGLTPLTLPFYQWATVQASYTAWLLAFNEAMSWVYLLLGSLLP
FT                   LGLVLLGSRVNSPRLAEGEEAGVGAWQVALAAALCFATLCFKLLQFLPYALLRYDEPWL
FT                   YGLYLSGVALPAALLFGAICTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVGGGLAL
FT                   LMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLAARWCYADQLATA"
FT   gene            complement(72192..72857)
FT                   /locus_tag="PSPA7_0065"
FT   CDS_pept        complement(72192..72857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0065"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83005"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC6"
FT                   /protein_id="ABR83005.1"
FT                   /translation="MRDAALRYPHILFDLDGTLTDPREGITRSVQFALARLGIDEPDLA
FT                   RLEHFIGPPLLQCFMQTYGFDEARAWEAVNHYRERFRVTGLYENRVFDGIPELLEALVG
FT                   RGHTLYVATSKPGVFAREIARHFAFDRHFKAIYGSELDGTRTHKDELIRHLLDSEGLAA
FT                   EQCLMIGDRMHDLLGASRNGVACIGVGYGFGSEDELRAHQPTHYCADLAALRQVLESH"
FT   gene            complement(72850..73392)
FT                   /locus_tag="PSPA7_0066"
FT   CDS_pept        complement(72850..73392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0066"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82823"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC7"
FT                   /protein_id="ABR82823.1"
FT                   /translation="MTIRSYQGKTPLLGERVFVDPSAVLVGDIEIGADSSVWPLVVIRG
FT                   DMHRIRIGQRSSIQDGSVLHITHAGPFNPDGFPLSIGDEVTVGHKVLLHGCSIGNQVLV
FT                   GMGSIVMDGAVIEDEVILGAGSLVPPGKVLESGFLYVGSPAKKARPLSDKERGFFAYTA
FT                   GNYVKLKDQHIAEGYHA"
FT   gene            73470..75515
FT                   /gene="prlC"
FT                   /locus_tag="PSPA7_0067"
FT   CDS_pept        73470..75515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PSPA7_0067"
FT                   /product="oligopeptidase A"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86103"
FT                   /db_xref="GOA:A6UXC8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC8"
FT                   /protein_id="ABR86103.1"
FT                   /translation="MSANPLLQAYDLPPFSSIRPEHVKPAIERILADNRAAIARLLETQ
FT                   REQPTWKGLVLAMDELNERLGAAWSPVSHLNAVCNSAELREAYEACLPELSAYSTELGQ
FT                   NRALFEAYEALAKSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQKRYAEVQSRLSE
FT                   LGSRFSNQLLDATQAWTKQVTDEAALAGLTDSAKAQMKQAAEAKGLDGWLISLEFPSYY
FT                   AVMTYADDRALREEVYAAYCTRASDQGPNAGQNDNGPVMEEILDLRQELAGLLGFANYA
FT                   ELSLATKMAESSDQVLSFLRDLAVRSKPFAARDLEQLRAYAAEQGCAELQSWDAGYYAE
FT                   KLREARYSVSQEALRAYFPVDKVLSGLFAIVERLYGIQIRELHDFERWHADVRLFEILE
FT                   NGEHVGRFYFDLYARANKRGGAWMDGARDRRRDARGRLIDPVAYLVCNFTPAVNGKPAL
FT                   LTHDEVTTLFHEFGHGLHHLLTRVEHAAASGINGVAWDAVELPSQFMENWCWEPEGLAL
FT                   ISAHYETGEALPQDLLEKMLAAKNFQSGMMMVRQLEFSLFDFELHATHGDGRSVLQVLE
FT                   GIRDEVAVMRPPAYNRFANSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEDGVFNPD
FT                   TGRAFREAILARGGSQEPMLLFVDFRGREPSIDALLRHSGLVGEAA"
FT   gene            75512..75787
FT                   /locus_tag="PSPA7_0068"
FT   CDS_pept        75512..75787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0068"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86311"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXC9"
FT                   /protein_id="ABR86311.1"
FT                   /translation="MSPVVTRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYAD
FT                   TLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
FT   gene            75876..76139
FT                   /pseudo
FT                   /locus_tag="PSPA7_0069"
FT                   /note="DNA repair photolyase SplB, C-terminal truncated by
FT                   genomic island insertion"
FT   gene            76186..78540
FT                   /locus_tag="PSPA7_0070"
FT   CDS_pept        76186..78540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0070"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83349"
FT                   /db_xref="GOA:A6UXD1"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD1"
FT                   /protein_id="ABR83349.1"
FT                   /translation="MPRKPFSKSALESRERPTLQRKLPENTPQAIQERSTARGQVDVSA
FT                   QGLLVRNKTTGTREYVRDFTDLVTEYPHHKLIVQQLLIGAQLHSAKRLITYQSHQDIYY
FT                   SIQEFVLFLNSAEPINKSVKGVADVDGQVCANFRSFLIRSYPGRTVNRKRYGALKNIFL
FT                   SLKNKYKGQGWVGKGFEWPTGPGMNEQITEGYSREIHNKLVEGCLIDIKFIMKWMESYN
FT                   SVVEGEKPILAYDLSLENLMFDLVVKEQTKRSNGSIKATHIKGFEWVIRSTGDVKEYIR
FT                   ANGISIERFLGIYRARAHELAAKGRPVVGTEVSERGMVYGCDREESGRIATANVGRLYP
FT                   DWPMQVSFEEAGHLFSTEWSKNTAHGTNKKYSTLEKRLRSALMYMKVGPEHLPYEVGQM
FT                   AYFSRVAFTMGTIFPFFLFVMLQTGWNFEVVVSISDNLDDHIEEDLLDDDYVIIYGYKG
FT                   RSNKSQMHRSNKRDKFGTYQILRFVAAEVTKHFSSPHYLKGKLFQCVISKNLWNKFGRL
FT                   CTPVTTTNFGHASTEFLHRHRIKLDTDTKSPRIETKRLRTTYETRRREQGLDIDEVSTM
FT                   MGHSDIDTTVNHYDSDWGSAEILNGRLRKIQRKHEEDFRRYSANLLTDVSLVELREATL
FT                   RCGSKEKLRSVVAPLVGRLNSSEDSVIQLLSPEGQTFIASCLNSRRPDWPGAESFLRTD
FT                   TPCNYFNRCPLCSQCVIFKEALPFIARRISDLDGLRERLNPLEWEKSYRAEYLAWKGVL
FT                   EGWGDPIEVAEAIDRSVHNDFALPLTMIGLS"
FT   gene            78537..80639
FT                   /locus_tag="PSPA7_0071"
FT   CDS_pept        78537..80639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0071"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80786"
FT                   /db_xref="GOA:A6UXD2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD2"
FT                   /protein_id="ABR80786.1"
FT                   /translation="MTTPTRDQIKAVLEEIRNGLGCHEEESEPIATEEDDEILSGDSSL
FT                   GIICDSINLLNLSRIDKNEWSYIRVSPRSSFGDPVWDFGDYPSPNGFPIRINFDYVNMY
FT                   GVNVCGVGHEHWVNIARALLFYRVPHFGIHGRINAYTSLESDKTKVLRLVGLFQAEGLY
FT                   LGSENSPDFRTVNDLAKSSVEHYIESLPTSGIKWEFCYLMSFWQGVSSMGMLPSEYSLY
FT                   DSYVTKELVAKYRREYDESSRPFEPIPLDDYAEIFRYCVGFVENYSDDVLWLYKNFAPT
FT                   IVGAFENPGKLAAMNIGVSTASVEGVKRFRAYKPKLLDSGIPWWGIEIKERTHENDEGE
FT                   YINQTAVISVVVSLIDACIVLLLCLTGMRRSEVIGLKVDCLSFKSEGYWLTYTVFKTSI
FT                   SSQGDIKTIPIPKIAADAIEVIIEIGRDARAYGNHDYLFVKIPKLSFGNTPQSTVVERA
FT                   CNRVANNLGIDYRVHPHRFRKSLALYIIHQDSRNLEIIKRLFSHRSLKMTLRYILSLPG
FT                   MNDEVKATLIEENTEILVEVLQGVISGQIGGIGGKRLAKTANSSPILRAKLQNAGKESL
FT                   SQYVASLLDEGVKLLHRTNLAICMRTPGLSSESPCDAKNDSPGSRLHPNLFACDPYNCR
FT                   YAAFVEANAPSLKNEIIFHDNMIKHRYCGATQKEYSQRRIAEAFKRLHEVVGDEAHNFL
FT                   KQVAHG"
FT   gene            80632..81576
FT                   /locus_tag="PSPA7_0072"
FT   CDS_pept        80632..81576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0072"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81475"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD3"
FT                   /protein_id="ABR81475.2"
FT                   /translation="MAKQDLLNRVYATISALQSDGRKKLSVMEVSKLSGVGRATINQKH
FT                   DPDWVKVREVIKGTTHSGVYTKDSSEDVKKPLKNTQEIHHRLKELEEQLALLRERASTT
FT                   YNQLIDRVQYYFALASEKPAKQVEKAKLLQELTHQKNQNAILRADLKAALAESLTPAVS
FT                   GFITSKIILEVPNAGSDSEAILSFLEKLDSLSSQNRSSLVTAVYIMCGLPMCGKSSWID
FT                   NHKPPTPGVSLYVSGASDTVSTRNLLVSRVRKEFNAPVHCVRFSLGLDACISRAEKQFN
FT                   GAALELNISSIKVVAARFEEIQFSENFDSIILA"
FT   gene            81962..83269
FT                   /locus_tag="PSPA7_0074"
FT   CDS_pept        81962..83269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0074"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86635"
FT                   /db_xref="GOA:A6UXD5"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD5"
FT                   /protein_id="ABR86635.2"
FT                   /translation="MCILHFGNGLASHSGYMRERVGIYFDDNHNVLEAPTMWAMAVSKI
FT                   RSRSDETTRNYANILRRFLQWLDDSPIEGAEVVFGAQNWQLVDEDVFDAFLVHIASPTD
FT                   ALPDGPSHKTMYHIAARVWSFYQWAEKQGYKHYLDISRTDIRYMLKDQKLLAHINPVVK
FT                   VTTLGFNLPSGRPAMHQREMQKFVRQTDYEIALSVLNDPVYQIIAAIIRITGLRPIDLF
FT                   QLPYRGRNENYGFIPYDEGEYPEGLDNGAIYYYFRSKGKWRSIDFPGKLWRVICEYYLP
FT                   LRRQRAKLYEAKHGIPPRNSDLFLSARGDVVTHGMLGYNFSKVVSAAKNSESATDFKAI
FT                   RFNARMLRHTCATYFVYEALKAQNRLGRSFVYDAALDEDLRKMLGHTDVRTTLEYYVHL
FT                   VNRYVHDNLLTDLHRSRVDAGLSAILDRHNYSEIVV"
FT   gene            83497..85473
FT                   /locus_tag="PSPA7_0075"
FT   CDS_pept        83497..85473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0075"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85981"
FT                   /db_xref="GOA:A6UXD6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD6"
FT                   /protein_id="ABR85981.1"
FT                   /translation="MNTENHSQTAAFLWSIADLLRGDFKQSQYGRIILPFTLLRRMECV
FT                   LEPTREAVIRESYAQEGRPDLVRERLLLRAAGQQFFNASKLTLGTLSDTQTAADLMSYV
FT                   QSFSKDAREIFEHFHFEDFVQQLSAANLLYQVVQRFAATDLSPERISNFGMGIIFEELI
FT                   RKFAESSNETAGEHFTPRDIVHLTTSLVITGQDDKLKPNSIVTIYDPTAGTGGFLSEGD
FT                   EYIQSISQQVTVSLHGQELNPESYAICKADMLIKGQDVTSIKLGNTLSDDQLADSRFDF
FT                   MLSNPPFGVEWKKVQKQITDEHSEKGFNGRFGPGLPRVSDGSLLFLLHLVSKMRDPREG
FT                   GSRIGIILNGSPLFTGGAGSGESEIRRYLLQNDLVEAIIALPTDMFYNTGIATYVWVLS
FT                   NHKAAARQGKVQLIDGSQHFAKMRKSLGSKRQYLTEEQIDALVRLYGRFEETAQSKIFP
FT                   VEAFGYRRITVERPLRLNFQVSSQRIEKVLEEKAIEKLEAPARQRLIEALQAMDASVVH
FT                   RNREQFSKLLKKTLSAHDVSPSTPELKAILSGLSERDSEADICMVKGQPEADAGLRDNE
FT                   NVPLGESVYDYFEREVKPHVADAWIDESKRDEQDGEVGIVGFEIPFNRHFYVFQPPRPL
FT                   EEIDRDLKGCTDRIKQMIEGLSA"
FT   gene            85470..86864
FT                   /locus_tag="PSPA7_0076"
FT   CDS_pept        85470..86864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0076"
FT                   /product="type I restriction-modification system, S
FT                   subunit"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82006"
FT                   /db_xref="GOA:A6UXD7"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD7"
FT                   /protein_id="ABR82006.1"
FT                   /translation="MTFPCYPKYRASGVEWLDQVPDHWSSVPIKYMALERNSLFLDGDW
FT                   IESKDISSDGIRYITTGNVGEGAYKEQGAGFISEETFHALRCTEVYEGDVLVSRLNNPI
FT                   GRACVVPNLGGRVVTSVDNVIFRPDLKFYKKFIVYLFSSEEYFKHTSNLARGATMQRIS
FT                   RGLLGNIRVVTPSLEEQTQIARFLDHETARIDALIEEQQRLIELLKEKRQAVISHAVTK
FT                   GLDPTVPMKDSGVEWLGEVPAHWEVRSISSISKKITNGYVGPTRDILVDEPGVRYLQSL
FT                   HIKSNKIKFEVPYFVSEQWSAEHAKSILASGDVLIVQTGDIGQVAVVTEEHAGCNCHAL
FT                   IIVSPVREVVLGEWVSWVLNSTYGYHSLLSIQTGAMHPHLNCGNVKFLNLPIPPLEEQA
FT                   RIVSFIESGELEMDSLMSETKRSLLLLQERRTALISAAVTGKIDVRGWQPPASTQAPEP
FT                   AVAEAD"
FT   gene            86865..90068
FT                   /locus_tag="PSPA7_0077"
FT   CDS_pept        86865..90068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0077"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86301"
FT                   /db_xref="GOA:A6UXD8"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD8"
FT                   /protein_id="ABR86301.1"
FT                   /translation="MADSKEAQFQQDIITAMVAQGWLTGPASGYDRRTALYTEDFLGYF
FT                   KDAWPERWDKFAKANPNNPESVLVQKLVRELEQDGTLDVLRHGFKLPGVKIEACSFKPD
FT                   HGMNPDTLKRYQCNRLRVVQEVSYSPHCREGEYNPRLDLVLFVNGIPVATLELKSEFKQ
FT                   SVENAKRQYRYDRPVKDPLTRKPEPLLTFKRGALVHFAVSQDEVAMTTQLAGKETFFLP
FT                   FNLGSLDGGAGNPPAPDDSQYATGYLWQRLFQPDAWLKVLGRFLHLQKSVKEDADGKRV
FT                   TKETLIFPRYHQWEVVNRLIETTRNEGPGKRYLIQHSAGSGKSNSIAWTAHQLASLYDA
FT                   EGQRLFNSVIVITDRTVLDKQLQDTIYQFEHAQGVVKCITRDIGSQSKSEQLAEALAEQ
FT                   TRIIIVTIQTFPALFDALDKYPKLASGHYAVIADEAHSSQTGSSASKLKQILGSDAVLG
FT                   KEGDAEEISAEELLDAAVAARAPNERISYYAFTATPKAKTLELFGRVPDPTLPASADNK
FT                   PEAFHLYSMRQAIEEGFILDVLQNYTTYSTAWKIAHPDGDDEEVDSKKARMKLARWVRL
FT                   HPYNINQKVEVIVGHFRANIRHLLGGQAKAMVVTSSRQEAVRYQLAVQAYVKQMGYTDV
FT                   HPLVAFSGSVLPDGVIPEEVTESSSLLNPGLNGRDLAEAFDTQDFNVMIAANKYQTGFD
FT                   QPKLCAMYVDKKLQGVDCVQTLSRLNRTFGDSKPTFILDFFNDPQDILDAFLPYYTKAE
FT                   LTDVTDPQLIYDLQKKLDAEGIYHWEEVAAFALAFFDPKAAASKLSYYCAPAKERFAKR
FT                   YKLAQESRQHALDFKRTAEQNGDSAGVKKAEAAVKEAGEQVDQLDLFKKNLQSFVRLYE
FT                   FLSQIIPYEDRELEQLCVYAKHLHPLLRVDRLDQEDVDVGELQLTHYRLTKRAEHQLRL
FT                   SEEQGDYGLKPPTGLGSGKPHDPEKKRLSEIIEALNDIFGAEVSDEDQLQFLTGIANRI
FT                   SRQEDVMAQVNNHSVEQVMHGLFPKRVLDTVLDAMTDNEKMSLEVLDNETKSRAFALVI
FT                   LKMLTAAGGLGQGISGAAV"
FT   gene            complement(90100..90321)
FT                   /locus_tag="PSPA7_0078"
FT   CDS_pept        complement(90100..90321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0078"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86871"
FT                   /db_xref="GOA:A6UXD9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXD9"
FT                   /protein_id="ABR86871.1"
FT                   /translation="MDKLAKALGERIRMQRKACRISQDALALACSLDRSYVGRIERGEV
FT                   NITVEKLYRIAGELACDPSSLLPKPSEI"
FT   gene            90423..91013
FT                   /locus_tag="PSPA7_0079"
FT   CDS_pept        90423..91013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0079"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84957"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXE0"
FT                   /protein_id="ABR84957.2"
FT                   /translation="MKSASYIFDRRLYELLQEPGRTSFTTRELRDAYAARLSGTQFRIA
FT                   DVRRYVYEQIRRLVRAGWVSPDEDRRVRGQVYHLQPIPTHLQLELIDNGFENSLMAAGM
FT                   PEPGTAVRDAEALPLESSANTDLQLEALHKEIRLDFLTSMGEAERFKLLLDEMPHLRDK
FT                   LEGDYLEARDRSSRLLGHLRAIEKTLKTLAAPR"
FT   gene            91010..92410
FT                   /locus_tag="PSPA7_0080"
FT   CDS_pept        91010..92410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0080"
FT                   /product="helicase domain protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83416"
FT                   /db_xref="GOA:A6UXE1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXE1"
FT                   /protein_id="ABR83416.1"
FT                   /translation="MSSSLRSWQNSCITRALEHFTVTPHFFCQATPGAGKTRMAAELAI
FT                   RLLEQDRIDLVLCFAPSCQVVEGFRSTFAAVLGRRLDGQIGAVGAAYTYQAMEYRDEGF
FT                   WQLLDDYRVFVVFDEIHHCAGHDPLLSNAWGQQILHRIQDRAAFTLALSGTPWRSDDKA
FT                   IALARYSSPEGHLICDYRYGLKDAIADDVCRSPRIVLLDNQKVKLTEELGADSSVRLFP
FT                   SIAKLLGESPVTYEELLRHDEVINPILDLGCSKLNELRQIKPDAAGLVVATDIEHAQQV
FT                   VLALEAMGEECRIVTNKTPDAQQVINAFRSSACRWIVAVGMISEGTDIPRLQVCCYLSR
FT                   IRTELHYRQVLGRVLRRTGESDDQAWLFMLAEPTLQSFAERIADDLPDDLAVLNEVQMP
FT                   ASTSGSKAGLIGAAGNIDGLDDSMKIGVEQVIGADTANIVSLGGGAAGPSYQVSFSQHY
FT                   RQQLLACF"
FT   gene            92565..92828
FT                   /locus_tag="PSPA7_0081"
FT   CDS_pept        92565..92828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0081"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80947"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXE2"
FT                   /protein_id="ABR80947.1"
FT                   /translation="MTLPRERTRSVIKTEEFLRELSRNTELPQDIRSYAKSLLRHYPSA
FT                   DQIYSLGRLEECLVGDAPDDVYRRRVIALHWPLFSSSLDFIE"
FT   gene            92831..93445
FT                   /locus_tag="PSPA7_0082"
FT   CDS_pept        92831..93445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0082"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84329"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXE3"
FT                   /protein_id="ABR84329.2"
FT                   /translation="MNAAMSCTDSAQPVSTRIAQRVMRLPKGQPFSTRRFAALGTRSAV
FT                   SKAIARLVSRGELERVHRGVYMRPKSSRYVARVRPNAWEVVSLIARQSRQALQIHGANA
FT                   VRRFGLSTQMPLISIYYTSGSSRSLFIGKAEVRLVHAAPMVMQQAGTEVGMAISALFYL
FT                   GKDGSTPECIAAIKKVLRPEDLTTLMACKMPKWMRMALELT"
FT   gene            93900..94133
FT                   /locus_tag="PSPA7_0085"
FT   CDS_pept        93900..94133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0085"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82281"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXE6"
FT                   /protein_id="ABR82281.2"
FT                   /translation="MGISYYLACLETRQYVWVGRLDPQGEVPVTDVEGSIAMFALVNRN
FT                   KPLIVVSESHPILEEGMEWSPPATQETCSGQP"
FT   gene            complement(95398..96480)
FT                   /pseudo
FT                   /locus_tag="PSPA7_0086"
FT                   /note="DNA polymerase V subunit UmuC, N-terminal truncated"
FT   gene            96930..97292
FT                   /locus_tag="PSPA7_6374"
FT   CDS_pept        96930..97292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6374"
FT                   /product="cupin domain protein"
FT                   /note="manually annotated"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FSR8"
FT                   /protein_id="QCB64548.1"
FT                   /translation="MKAETESRIFSVDEYVRPSNGEPIRSVVLETNDSVVVVWHAYPRQ
FT                   EIAAHVHPHGQDTWTVISGEAKYYQGNGVEIHLKAGDIAIAKPGQVHGAVNSGPGPFIF
FT                   VSVVAPGSAGFALSEK"
FT   gene            97316..97879
FT                   /locus_tag="PSPA7_6375"
FT   CDS_pept        97316..97879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6375"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FRZ6"
FT                   /protein_id="QCB64549.1"
FT                   /translation="MNTRVFTFAGGETGVWRVVAMNAVAGAPLPGIPRLNVAAGSVSPQ
FT                   PPGTKWLLRGITSNERYVVREEKDRLVAKQPSLGRAEATCAALIPIRKNPSWWGLSQDE
FT                   RRKIFEEQSRHIHIGLQYLPAVARRLHHCRDLGENEPFDFLTWFEYSPSDETAFNRLLA
FT                   ELRASVEWQYVDREIDIRLVHEPA"
FT   gene            complement(98024..100189)
FT                   /locus_tag="PSPA7_0087"
FT   CDS_pept        complement(98024..100189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0087"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80879"
FT                   /db_xref="GOA:A6UXE8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXE8"
FT                   /protein_id="ABR80879.1"
FT                   /translation="MSTPSVTPYVPFDASKYVRQSDLSKIELSILSNRSHRSDWGYLQS
FT                   EIPELMRPLADIAAHSGVSQRLAISSVAVILWNVSKTGKPYWCWSESQWLTLLSNRAGS
FT                   RPYLASVAYHLGDFRTPQRIAKFRQPAIYASFIFGHAVFRHEHVRLSQALRSLGYAARH
FT                   LEQFLSNVLGALMLENGDPRLETFTEELLLKGQQHRSEGVARSVGKVSHGLAAMGILAK
FT                   PLRMRGYTCWRAKSIEGIDPTWAMWCRRWRDTSTLRPRTRESNYSFILRTGVWLAREQS
FT                   GMAAPTDWSMSTCAAFIAAVDRMTVGEWALESAKGTQLKGLGQPIAANSKRGFLHALRR
FT                   FFTDFELWGWGRLKFSPRHHLATPRSVTFNSGINPRVIDDSTWLKLIWASLNLERSDLL
FT                   SEIHYPLSMVQAIAVVWTHAGLRSNEIMRLDKRCAHPQTNDVVHEDGTIVPAKTLCYLD
FT                   IPASKTFKAFVKPVAVVVKERIDAWLEDRPANQAALLDERTGEKVSYLFQFRGKRIGSS
FT                   VINGTIIPMLCAKAGVPLEDSRGRITSHRGRASAVTALASVPQGMSLIELMQWSGHSSP
FT                   NSTLHYIRIRPTKLAASFVKADQMAHMVSVLIDHDVIVRHSDAPYTFYDLGDSYCSNPF
FT                   WSSCPHRMACAGCDFNLPKASARAQALESKSSIGRYLEAVPLTPDERAIAEGDLEKLES
FT                   LIRKLDNVPALDGRMPRRSMRERGGYK"
FT   gene            complement(100186..101205)
FT                   /locus_tag="PSPA7_6376"
FT   CDS_pept        complement(100186..101205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6376"
FT                   /product="integrase"
FT                   /note="manually annotated"
FT                   /db_xref="GOA:A0A4D6FTR0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FTR0"
FT                   /protein_id="QCB64550.1"
FT                   /translation="MTTTPLHKQVLSRYSSVQAWLELLGNLGRAPATLDAYGRALAHYL
FT                   LHCEGSGLKPESATFEQVTLYIRELLPGAKSAVANSTLHQRLTAIRLWYDHLVFQGLCE
FT                   HNPVPRGQHGRLAQVPGHGGFVRGLLPRLIKLPDIPTDEQWRHFLSIAARSSIRDRLML
FT                   SLAYFGALRRAELVALRIEDLDVAHRLISVRAETTKGKRSRVVCYSPDIAPVLIEHLHA
FT                   LRGAGWMRGSLFRSASDRNRGSPLSRWAWSKTVEGWAKEAKLSHLSTHTFRHLRLTHLA
FT                   RAGWKLHELTTYAGHRDPKTTLIYLHLSGADLTAKMAHSVGSLEARMFCELFGSEALL"
FT   gene            complement(101261..101386)
FT                   /pseudo
FT                   /locus_tag="PSPA7_0088"
FT                   /note="DNA polymerase V subunit UmuC, N- and C-terminal
FT                   truncated"
FT   gene            complement(101758..102174)
FT                   /locus_tag="PSPA7_0089"
FT   CDS_pept        complement(101758..102174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0089"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84659"
FT                   /db_xref="GOA:A6UXF0"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF0"
FT                   /protein_id="ABR84659.2"
FT                   /translation="MNIKTNELGRGDSLRQTWQVISFWGLPAVVATLTILLADRHPTLF
FT                   LAASAALAVMGGACLVNAARCRRLHCYLTAPYFLLLALGGLLAYGFDPHGEQFSRLWLL
FT                   LALGAAPLLIWLPERLAGRKYLGAPGCGEGRECR"
FT   gene            complement(102193..103875)
FT                   /gene="merA2"
FT                   /locus_tag="PSPA7_0090"
FT   CDS_pept        complement(102193..103875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA2"
FT                   /locus_tag="PSPA7_0090"
FT                   /product="mercuric reductase"
FT                   /EC_number="1.16.1.1"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00070; match to protein family HMM PF00403; match to
FT                   protein family HMM PF01266; match to protein family HMM
FT                   PF02852; match to protein family HMM PF07992; match to
FT                   protein family HMM TIGR02053"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83086"
FT                   /db_xref="GOA:A6UXF1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF1"
FT                   /protein_id="ABR83086.1"
FT                   /translation="MTELKIIGMTCASCVVHVKEALEKIPGVHRADVSYASGRAELKVD
FT                   EAVSREQMQAAVEALGYRAAFEDITLPTRPGLLDKARGWLSGGTDAGKEGDRLHVAVIG
FT                   SGGAAMAAALKAVERGARVTLIERGIIGGTCVNVGCVPSKIMIRAAHVAHLRRESPFDG
FT                   GLPATPPLVLRERLLAQQQGRVDELRHAKYEGILESTPAITVLRGSARFQDSHTLSVEL
FT                   VEGGERIVTFDRCLIATGASAAVPPIPGLQDTPFWNSEKALASSSIPQRLAVIGSSVVA
FT                   LELAQAFARLGSRVTILARNSLFFREDPAIGAALTAAFRLEGIEVLEQTQASQVAHANG
FT                   EFVLTTKHGEVRVDQLLVATGRTPNTHGLNLEAAGVQLDERGAIQIDQGMRSSKADIYA
FT                   AGDCTNQPQFVYVAAAAGNRAAINMTGGEAMLNLDTMPAVVFTDPQVATVGFSEAEAHQ
FT                   AGLETDSRTLTLDNVPRALANFDTRGFIKLVAETGSGRLLGVQAVTPEAGELIQTAALA
FT                   IRARMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSCCAG"
FT   gene            complement(103908..104342)
FT                   /locus_tag="PSPA7_0091"
FT   CDS_pept        complement(103908..104342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0091"
FT                   /product="mercuric resistance protein MerC"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF03203"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83804"
FT                   /db_xref="GOA:A6UXF2"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF2"
FT                   /protein_id="ABR83804.1"
FT                   /translation="MANSFNLFTRIGDKAGSVGVLVSAIGCASCFPALASLGATIGLGF
FT                   LSQWEGLFITTLLPLFAGVALLVNALGWFSHRQWRRAAPGLIGPALVLVAVFLMLAHGW
FT                   RSGWLLYIGLAVMFGVSIWDFVSPAHRRCSPASCPTPPNQ"
FT   gene            complement(104355..104630)
FT                   /gene="merP3"
FT                   /locus_tag="PSPA7_0092"
FT   CDS_pept        complement(104355..104630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merP3"
FT                   /locus_tag="PSPA7_0092"
FT                   /product="mercuric transport protein periplasmic component"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00403; match to protein family HMM TIGR02052"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81298"
FT                   /db_xref="GOA:A6UXF3"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF3"
FT                   /protein_id="ABR81298.1"
FT                   /translation="MKKLLAALALIAVVSPVWAASQIITLSVPGMTCAACPITVKKALT
FT                   KVEGVTKAEVSYEKREAIVTFDDAKTSAQALTKATEDAGYPSSVKQ"
FT   gene            complement(104644..104994)
FT                   /gene="merT"
FT                   /locus_tag="PSPA7_0093"
FT   CDS_pept        complement(104644..104994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merT"
FT                   /locus_tag="PSPA7_0093"
FT                   /product="mercuric transport protein (Mercury ion transport
FT                   protein)"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82023"
FT                   /db_xref="GOA:A6UXF4"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF4"
FT                   /protein_id="ABR82023.2"
FT                   /translation="MSESRNGRGALLTGGLAAILASTCCLGPLVLIALGFSGAWIGSLT
FT                   VLEPYRPFFIGAALVALFFAYRRIFRPAQVCIPGEVCADPQVSTIYKLVFWVVTALVLV
FT                   ALAFPYILPLFY"
FT   gene            105066..105476
FT                   /gene="merR3"
FT                   /locus_tag="PSPA7_0094"
FT   CDS_pept        105066..105476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR3"
FT                   /locus_tag="PSPA7_0094"
FT                   /product="Hg(II)-responsive transcriptional regulator"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00376; match to protein family HMM PF09278; match to
FT                   protein family HMM TIGR02051"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86667"
FT                   /db_xref="GOA:A6UXF5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF5"
FT                   /protein_id="ABR86667.1"
FT                   /translation="MHNAVESLTIGAFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRR
FT                   YGEADVARVRFVKSAQRLGFSLDEVAGLLRLDDGAHCDEARVLAEQKLEDVREKLADLQ
FT                   RIESVLAQLVDDCCASQGTVSCPLIVSLQASK"
FT   gene            complement(105619..105801)
FT                   /locus_tag="PSPA7_0095"
FT   CDS_pept        complement(105619..105801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0095"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84232"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF6"
FT                   /protein_id="ABR84232.1"
FT                   /translation="MRDKADAILVAETVKKIEQLGATAAGRGEAKRSPAVRLQGRYVLL
FT                   DQMQRGPAPLMHKGK"
FT   gene            complement(106040..106393)
FT                   /locus_tag="PSPA7_0096"
FT   CDS_pept        complement(106040..106393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0096"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84822"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF7"
FT                   /protein_id="ABR84822.2"
FT                   /translation="MLDKVIDGILSTNGKLSISGVAKAAGVTPGLIHNTYPAVAERIRG
FT                   LMGKSVRAQRDSKHQALLKERELNRALRAENAQLSQDLARLASVNQTLILELAQLKGVA
FT                   TGKVVLLSSKPAS"
FT   gene            complement(106465..108318)
FT                   /locus_tag="PSPA7_0097"
FT   CDS_pept        complement(106465..108318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0097"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82411"
FT                   /db_xref="GOA:A6UXF8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF8"
FT                   /protein_id="ABR82411.1"
FT                   /translation="MTLLSANRNSRAALKAYDVLFAQPVTASGLSKAERDAIVISAIVN
FT                   DRGETLVLSRFGDARWDLRPFFDQSNVNEGHKYVSWDFNLPPEMIDDCKAVAYAWFKRG
FT                   LPGSKPPVARGITTLVSASVIPFIRWLSDLELERFSDVRPIHISNYIHHCKSESLRPMP
FT                   LYSRLRIIDFLWIFSAETLSPLQCFPWGDSSLWRVSGIGEARGTSAANKNTGRTDIIPP
FT                   DDQAKIFNYCEQIVHKTKEDLKATGIDTFTRRSPKMIRCRDAVLYIASITSGMRNEEVI
FT                   GIEVGAWRKEVVDGVTYCWVTTTEHKTGKGRVDYLVPELTLDALNLFAMCSTPMRRELE
FT                   AELSDLELSCNSVDSADLLLRLEKARKDSKRLFLCLNGYGNKAERVGHIEVLSAAGSNE
FT                   AFKRVAKAAGSDWPLRTHQCRRTYARCFVESRMGRTSLVFLKWQFKHSSMSMTQLYASN
FT                   PLQDLTLFDEILQQMTEFKIDLIESWLDDQPLAGGAGERIMELRAIPIKDRSALLAQTA
FT                   PHANIRATGHGWCIATERGCGGAGLYEATRCPGCKHSVIDETFATTWQGIYSHQLELME
FT                   IDDAGPAVRQRAKRDMQVAFDVISSLGLSPLDARDSDPTRT"
FT   gene            complement(108299..109915)
FT                   /locus_tag="PSPA7_0098"
FT   CDS_pept        complement(108299..109915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0098"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80851"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXF9"
FT                   /protein_id="ABR80851.1"
FT                   /translation="MARKKNYKAEMQSVTKGFETVENELRIDLPKNPRNVTKIDHSQYI
FT                   GFGFDAWAIQSIHVIRALVNGGNFSLATLVGYSSNGLRYFMAFLKSGTIDSPPSTPNSL
FT                   TKRHLERYVSWLKLKYPNGSTAKNYYTSLKSLIISLIEYGFVEADKDDLLPAVPFPHTA
FT                   KSTNDAKPLSLSEMQGLITALKSDLVAIHKGLFSGNDAEAMTVLLLITAARSGINTTPL
FT                   LEMSRDALQPHPFIPNLWLLNTVKRRGKGAQSKTIRKTELHDGYNPIPLDGVAVVNKAL
FT                   AISEPLVGFAPEKLKSHVWLYRAGQNGHGHRVVALASSTLFQSTKSICARHALKDDQGQ
FT                   PLIVNLSRLRKTMESRLWKLSGGDLLEVSAVMGHSPSVADNHYLKINDEIKVEGATFVG
FT                   EAFTDQLRGINVTPTPPGGCKDSLYGSLAPKDGVTHCSEFIHCLTCPSYAIVGTLGDLY
FT                   RLFSYQQFLHAEMEYFLTDEWAAWRKRQGDFIRLIDEFTSRKFKIELIEAAKAKAKASP
FT                   HPFWGCKIEFMRKVRGDALVG"
FT   gene            complement(109926..111083)
FT                   /locus_tag="PSPA7_6377"
FT   CDS_pept        complement(109926..111083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6377"
FT                   /product="integrase"
FT                   /note="manually annotated"
FT                   /db_xref="GOA:A0A4D6FV03"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FV03"
FT                   /protein_id="QCB64551.1"
FT                   /translation="MRLVFATKDLAVAGRSFEGFPLLVGADGWPVEPAQSFLWHTLVES
FT                   GEALSALTWEAYGRRLFDYFAFLEANGLAWNEESQADGLSVLSRYRDWSSGELELDPST
FT                   LNKRLNLIVRFYQWAKQRDLIAALPFGERRVRATPHSGFLSHVARPNAESTKPSVMVRE
FT                   RKRLTKFLTKDQAKVCLALDADPSHRILFHLMVRTGLRSCEARTFPFKYVFNPRLKKGL
FT                   RPGQMISVALEPSDMHLKYGRPRTIDVPWSLMEEMWSYTLHEREVRKAAGNGRATALVL
FT                   TREGRQYTKDSIVDVMKAYERKCGFYVRAHMLRHTYGTYTLLALRKSRDFKGEPLLYVR
FT                   DRMGHSDVQTTMVYLHLINQLEAQSVLAHEDEIDMMFMAVSTPSI"
FT   gene            complement(111181..111309)
FT                   /pseudo
FT                   /locus_tag="PSPA7_0099"
FT                   /note="DNA polymerase V subunit UmuC, C-terminal truncated"
FT   gene            complement(111309..111740)
FT                   /locus_tag="PSPA7_0100"
FT   CDS_pept        complement(111309..111740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0100"
FT                   /product="protein MucA"
FT                   /EC_number="3.4.21.-"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84700"
FT                   /db_xref="GOA:A6UXG1"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG1"
FT                   /protein_id="ABR84700.2"
FT                   /translation="MALTVIGRPSRPGLRLPLFLSRVAAGFPSPAEDHIEASLSLDELC
FT                   VVHPAATFFLRVVGDSMTGLGIFDGDILVVDRSITPRAGMVVVAVVNGEFTCKQLAYEH
FT                   GAPVLRAANKAYPDIRLRDGEDLEVFGVVTRCIHKLPGF"
FT   gene            complement(111876..112310)
FT                   /gene="merR2"
FT                   /locus_tag="PSPA7_0101"
FT   CDS_pept        complement(111876..112310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR2"
FT                   /locus_tag="PSPA7_0101"
FT                   /product="Hg(II)-responsive transcriptional regulator"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00376; match to protein family HMM PF09278; match to
FT                   protein family HMM TIGR02051"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83875"
FT                   /db_xref="GOA:A6UXG2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG2"
FT                   /protein_id="ABR83875.1"
FT                   /translation="MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLLEPDKPYGSIRR
FT                   YGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGTHCEEASSLAEHKLKDVREKMADLA
FT                   RMEAVLSELVCACHARRGNVSCPLIASLQGGASLAGSAMP"
FT   gene            112382..112732
FT                   /gene="merT2"
FT                   /locus_tag="PSPA7_0102"
FT   CDS_pept        112382..112732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merT2"
FT                   /locus_tag="PSPA7_0102"
FT                   /product="mercuric transport protein (Mercury ion transport
FT                   protein)"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86537"
FT                   /db_xref="GOA:A6UXG3"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG3"
FT                   /protein_id="ABR86537.2"
FT                   /translation="MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLA
FT                   VLEPYRPIFIGVALVALFFAWRRIYRQAAACKPGEVCAIPQVRATYKLIFWIVAALVLV
FT                   ALGFPYVMPFFY"
FT   gene            112745..113020
FT                   /gene="merP2"
FT                   /locus_tag="PSPA7_0103"
FT   CDS_pept        112745..113020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merP2"
FT                   /locus_tag="PSPA7_0103"
FT                   /product="mercuric transport protein periplasmic component"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00403; match to protein family HMM TIGR02052"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85674"
FT                   /db_xref="GOA:A6UXG4"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG4"
FT                   /protein_id="ABR85674.1"
FT                   /translation="MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAIS
FT                   KVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ"
FT   gene            113092..114777
FT                   /gene="merA1"
FT                   /locus_tag="PSPA7_0104"
FT   CDS_pept        113092..114777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA1"
FT                   /locus_tag="PSPA7_0104"
FT                   /product="mercuric reductase"
FT                   /EC_number="1.16.1.1"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00070; match to protein family HMM PF00403; match to
FT                   protein family HMM PF01266; match to protein family HMM
FT                   PF02852; match to protein family HMM PF07992; match to
FT                   protein family HMM TIGR02053"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80951"
FT                   /db_xref="GOA:A6UXG5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG5"
FT                   /protein_id="ABR80951.1"
FT                   /translation="MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIV
FT                   PGTSPDALTAAVAGLGYKATLADAPLADNRVGLLDKVRGWMAAAEKHSGNEPPVQVAVI
FT                   GSGGAAMAAALKAVEQGAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFD
FT                   GGIAATVPTIDRSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQSLTVR
FT                   LNEGGERVVMFDRCLVATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVV
FT                   ALELAQAFARLGSKVTVLARNTLFFREDPAIGEAVTAAFRAEGIEVLEHTQASQVAHMD
FT                   GEFVLTTTHGELRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIAIDQGMRTSNPNIY
FT                   AAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVGYSEAEAH
FT                   HDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTAAL
FT                   AIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG"
FT   gene            114795..115160
FT                   /gene="merD"
FT                   /locus_tag="PSPA7_0105"
FT   CDS_pept        114795..115160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merD"
FT                   /locus_tag="PSPA7_0105"
FT                   /product="mercuric resistance transcriptional repressor
FT                   protein MerD"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00376; match to protein family HMM TIGR02054"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83586"
FT                   /db_xref="GOA:A6UXG6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011797"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG6"
FT                   /protein_id="ABR83586.1"
FT                   /translation="MNAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDDA
FT                   ALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLALLRQFVERRREALADLEV
FT                   QLATLPTEPAQHAESLP"
FT   gene            115157..115393
FT                   /locus_tag="PSPA7_0106"
FT   CDS_pept        115157..115393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0106"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF05052"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85324"
FT                   /db_xref="GOA:A6UXG7"
FT                   /db_xref="InterPro:IPR007746"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG7"
FT                   /protein_id="ABR85324.1"
FT                   /translation="MNNPERLPSETHKPITGYLWGGLAVLTCPCHLPILAVVLAGTTAG
FT                   AFLGEHWVIAALGLTGLFLLSLSRALRAFRERE"
FT   gene            115390..116391
FT                   /locus_tag="PSPA7_0107"
FT   CDS_pept        115390..116391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0107"
FT                   /product="Urf2"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82705"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR021767"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG8"
FT                   /protein_id="ABR82705.1"
FT                   /translation="MSAFRPDGWTTPELAQAVERGQLELHYQPVVDLRSGGIVGAEALL
FT                   RWRHPTLGLLPPGQFLPVVESSGLMPEIGAWVLGEACRQMRDWRMLAWRPFRLAVNVSA
FT                   SQVGPDFDGWVKGVLADAELPAEYLEIELTESVAFGDPAIFPALDALRQIGVRFAADDF
FT                   GTGYSCLQHLKCCPISTLKIDQSFVAGLANDRRDQTIVHTVIQLAHGLGMDVVAEGVET
FT                   SASLDLLRQADCDTGQGFLFAKPMPAAAFAVFVSQWRGATMNASDSTTTSCCVCCKEIP
FT                   LDAAFTPEGAEYVEHFCGLECYQRFEARAKTGNETDADPNAGFGEQWNQKPT"
FT   gene            complement(116395..117324)
FT                   /locus_tag="PSPA7_0108"
FT   CDS_pept        complement(116395..117324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0108"
FT                   /product="TnpR"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86853"
FT                   /db_xref="GOA:A6UXG9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXG9"
FT                   /protein_id="ABR86853.1"
FT                   /translation="MKIGYARVSTRDQKADLQVDALKQAGCERIYQDIASGAKSARPEL
FT                   DKLLANVRPGDAVVIWKLDRLGRSLKHLVELVGELAERKVGLQSLNDPIDTTHAQGRLV
FT                   FNLFASLAEFERELIRERTQAGLSAARARGRIGGRPKGLPAKAEATAMAAETLYREGRL
FT                   SVSAIGEKLHISKSTLYSYLRHRGVEIGAYQKSARSRDQQPSAASPAEPPAAERVATVT
FT                   LRLAVVNNSKFVRGRKRATENIERYCLEPYGMKRLDAGHYELTIPYRSDDELDKSVHDL
FT                   LTEISQEADMRNCFVEMGAWEEDTEKRW"
FT   gene            117526..117765
FT                   /locus_tag="PSPA7_0109"
FT   CDS_pept        117526..117765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0109"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86398"
FT                   /db_xref="GOA:A6UXH0"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031914"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH0"
FT                   /protein_id="ABR86398.1"
FT                   /translation="MNTIRWNVAVSADTDQSLRMFLASQGGGRKGDLSRFIEEAVRAHI
FT                   LELSAEQAKAANAHLSEAELTNAVDEALDWARKR"
FT   gene            117765..118175
FT                   /locus_tag="PSPA7_0110"
FT   CDS_pept        117765..118175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0110"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01850; match to protein family HMM TIGR00305"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81553"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH1"
FT                   /protein_id="ABR81553.1"
FT                   /translation="MRVVLDTNILFSALISPHGAPDAIYRAWRAARFEVVTSRMQLDEI
FT                   RRASRYPKLQAILQPAKVGAMINNLQRAVVLERLTIEVEADDPDDSFLLAMALAGDADY
FT                   LVTGDRRAGLLQRGHIERTRIVTPAVFCVEVL"
FT   gene            118179..121172
FT                   /locus_tag="PSPA7_0111"
FT   CDS_pept        118179..121172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0111"
FT                   /product="transposase"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85378"
FT                   /db_xref="GOA:A6UXH2"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH2"
FT                   /protein_id="ABR85378.1"
FT                   /translation="MPVGFLTQEQRDGFGRYVDSPSREELERYFHLSDEDREAIQVLRG
FT                   NHNRLGYAVLLTTVRFVGVLPDKPAAVPVEVLQVLCRQLAIPDPDCLQRYSDHRRWIHA
FT                   TDIQNRFGYRHFTDPGIGFRLSRWLYALCWTGTDRPGVLFERATSWLFTQKVLLPGVSQ
FT                   LERFIAQLRSRVEERLWFTLGRSVTEEQRLQLQDLLTVAEGNRSSRLDQLRSGPVMVSG
FT                   PALIRALRRLDDVRGIGITLPAAAHIPPSRIAALARFANTAKVTAINRLPASRRMATLV
FT                   AFALCLEATAHDDALEVLEALLRDLFSNAEKADKKARMRSLKDLDRSAATLAAACKVVL
FT                   DSSISDDNVRARLFNDLPRTTLEKALEEVNALIRPVDDVYFLALEARYRSVRRFLPDLL
FT                   KHIRFGFSPAGKGVAASLEWLQLNLPRRKPEDDAPQEIVAKAWQKHITREDGSLDMGAY
FT                   VFCTLDALRTALRRRDVFVSPSWRYADPRLGLLDGAEWLAARPIICRSLGLTIDAKTTL
FT                   DALSVELDATWLAVAARLPDNPAIQLSENTEGKTELSLGALDKLDEPCSLLQLRAAVSD
FT                   LMPRVDLPEILLEIAARTGFSEAFTHVSERNARADNLVTSLCAVLLGGACNTGLEPLIR
FT                   TDNPALRRDRLSWVSQNYIRDDTLSAANAILVGAQSQLELAQVWGGGEVASADGMRFVV
FT                   PVRTVHAGPNPKYFGTGRGVTWYNLISDQFSGLNAITVPGTLRDSLVLLAVVLEQQTEL
FT                   QPTQIMTDTGAYSDVVFGLFRLLGYHFSPRLADVGGTRFWRTRPDADYGKLNGLARQSV
FT                   KLDLIAEHWDDLLRLAGSLKLGRVPATGIMRTLQTGDRPTRLAQALAEFGRIEKTLHTL
FT                   TYIDDESKRRATLTQLNRGEGRHSLARAVFHGKRGELRQRYREGQEDQLGALGLVVNII
FT                   VLWNTLYMTAAVERLKQHGYPVLEEDLARLSPLIYEHINMLGRYSFAVPEEVARGELRP
FT                   LRNPDDDL"
FT   gene            complement(121185..121397)
FT                   /locus_tag="PSPA7_0112"
FT   CDS_pept        complement(121185..121397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0112"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86144"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH3"
FT                   /protein_id="ABR86144.1"
FT                   /translation="MSAIVLESVLTCPRCGFAKPETMPTDACQFYYECSNCKALLRPNP
FT                   GDCCVFCSFGSVKCPPIQQQLGCCS"
FT   gene            complement(121405..121680)
FT                   /gene="merP1"
FT                   /locus_tag="PSPA7_0113"
FT   CDS_pept        complement(121405..121680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merP1"
FT                   /locus_tag="PSPA7_0113"
FT                   /product="mercuric transport protein periplasmic component"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00403; match to protein family HMM TIGR02052"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86756"
FT                   /db_xref="GOA:A6UXH4"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH4"
FT                   /protein_id="ABR86756.1"
FT                   /translation="MRKLLIAVLFALPFVALAAPPKTVTLDVQNMTCGLCPITVKKSLE
FT                   KVSGVSDVQVNFDQKTATVTYDPDKAQPEALTEATANAGYPSTVQK"
FT   gene            complement(121693..122043)
FT                   /locus_tag="PSPA7_0114"
FT   CDS_pept        complement(121693..122043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0114"
FT                   /product="MerT"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02411"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85066"
FT                   /db_xref="GOA:A6UXH5"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH5"
FT                   /protein_id="ABR85066.1"
FT                   /translation="MGMQLTGKGSLVASSLTAIGASVCCVGPLVLLALGVGGTWVGALT
FT                   MMEPLRPLFIGLTLLFLGLAFRKLYLVPQVCTPGTPCADPRTLVRQRLVFWIVSVLLLG
FT                   LLAVPWLAPLFY"
FT   gene            122118..122516
FT                   /gene="merR1"
FT                   /locus_tag="PSPA7_0115"
FT   CDS_pept        122118..122516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR1"
FT                   /locus_tag="PSPA7_0115"
FT                   /product="Hg(II)-responsive transcriptional regulator"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00376; match to protein family HMM PF09278; match to
FT                   protein family HMM TIGR02051"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82678"
FT                   /db_xref="GOA:A6UXH6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH6"
FT                   /protein_id="ABR82678.1"
FT                   /translation="MATELTIGKLADAAGVNVETIRYYQRRGLLDEPAKPLGGHRRYPV
FT                   DMVKRLRFIKRAQALGFTLSEVGGLLTLDESCACAETRARAARKLALIEQKMADLVVMQ
FT                   QLLGELVQQCDAGDGGTICPIIEALIRE"
FT   gene            122819..123664
FT                   /locus_tag="PSPA7_0117"
FT   CDS_pept        122819..123664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0117"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80864"
FT                   /db_xref="GOA:A6UXH8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH8"
FT                   /protein_id="ABR80864.1"
FT                   /translation="MDRLSNLLSRFGVRANLFYDGDLCGSASYDGAERRGYIHLLQAGS
FT                   VTLLGPDRKDLQLTRPSLIFMPRPAKHQLFAGESDGAKLLCASMEFEGGIDNPLSASLP
FT                   DCLVLALDDLPMLADTLEWMFAEAANVHCGREAALERLFELLIILLLRYLLDHHQLRTG
FT                   MMAGLADMRLARSLLQMHNSPEHAWSIAELASESNMSRAAYAVHFKSVIGQTPADYLLS
FT                   WRVSLAQKLMREGRSITLIAAQVGYESPSALSRAFRRKTGLSPRDWLKDLAGENDGKKA
FT                   "
FT   gene            complement(123694..124212)
FT                   /locus_tag="PSPA7_0118"
FT   CDS_pept        complement(123694..124212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0118"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85698"
FT                   /db_xref="GOA:A6UXH9"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXH9"
FT                   /protein_id="ABR85698.2"
FT                   /translation="MKTIGIENSKSSVQAHLTLGTKTMGLGIYGAYLALAIIYFWFGGM
FT                   KFTHYEAEGLVPLVSNSPLLGWVYSIFSVDMFSSLLGILEISIGTLIAGRMLSPKLSVV
FT                   GGALSAGLFFTTLSFMFSTPGVIEPSLGFPAISVAPGQFLLKDLGLLAVSIFVAGHSLV
FT                   ELEKRKINA"
FT   gene            complement(124955..126019)
FT                   /locus_tag="PSPA7_0119"
FT   CDS_pept        complement(124955..126019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0119"
FT                   /product="ISPa1635 family transposase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81870"
FT                   /db_xref="GOA:A6UXI0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI0"
FT                   /protein_id="ABR81870.2"
FT                   /translation="MVTAQAFCKARKKLNPEVFESLNRLLQQQIDCFGLRQKWRGLRVL
FT                   AVDGSTVHLPLESTMATFFGSHSGFPMARLSTLYEVADGQTLHSLIVPLTVGERDCAHL
FT                   HLEHLPADSLTLFDRGYPGHWLFALFAQQQRHFLMRLPCGYNAQVKAFLHSGQVEDTQL
FT                   FVANHPEARLFCSEAGVDPASQIELRLIRVELANGESEVLLTSLLDREAFPAEVFAELY
FT                   HRRWGIETDFRRLKQTLTLDNFSGRSVTAVKQDFHAAQLLKNLALLMQHLLQPVIEQRH
FT                   KGRKLRWKVNFTQGVSRLKNTLVELLVRHCAQGLSNVLALMAKSLSAVRSGRSFARQRK
FT                   RAASRGCEGYKPTR"
FT   gene            126588..126962
FT                   /gene="sdhC2"
FT                   /locus_tag="PSPA7_6378"
FT   CDS_pept        126588..126962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC2"
FT                   /locus_tag="PSPA7_6378"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="manually annotated"
FT                   /db_xref="GOA:A0A4D6FS23"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FS23"
FT                   /protein_id="QCB64552.1"
FT                   /translation="MNKKRPVNLDIRTIQLPLTALTSILHRISGIMLFIFLGLILYMLS
FT                   KSLESEKGFNEVKEIFSSPFGKVSFWLVYSSFIYHLVAGIRHLVMDVGVGHTLKGSNRA
FT                   STIVLVVSGVLMVAGAVWIW"
FT   gene            complement(127823..128089)
FT                   /locus_tag="PSPA7_6379"
FT   CDS_pept        complement(127823..128089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6379"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FS13"
FT                   /protein_id="QCB64553.1"
FT                   /translation="MEHSEFDAAFAKLAEGYREGTYEGRRFSLIVRRSGDGRRNSLFAR
FT                   ELDGTDIVSFNLFRVTSDRTLLKPCEMSAEKVVAFVLEFRPDT"
FT   gene            complement(128259..128540)
FT                   /locus_tag="PSPA7_6380"
FT   CDS_pept        complement(128259..128540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6380"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FS90"
FT                   /protein_id="QCB64554.1"
FT                   /translation="MVSAIWKDTTIATSDETVIVEGNHYFPPSGVDLSLLEMSPHTSVC
FT                   PIKGAARFFHVRAGDALNVNAAWTYPAPTPDAEGIRDYIAFWKGVDVA"
FT   gene            complement(128608..128880)
FT                   /locus_tag="PSPA7_0120"
FT   CDS_pept        complement(128608..128880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0120"
FT                   /product="glutaredoxin"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83031"
FT                   /db_xref="GOA:A6UXI1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI1"
FT                   /protein_id="ABR83031.1"
FT                   /translation="MTTDVLLYTTNWCPFCRRAKALLKEKGVRWKELDIEADPAHRQAM
FT                   AEASGRSSVPQIFINGTLIGGSDELFALDVRGELDKLLGRNPPAT"
FT   gene            complement(129334..130080)
FT                   /locus_tag="PSPA7_0121"
FT   CDS_pept        complement(129334..130080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0121"
FT                   /product="oxidoreductase FAD-binding region"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00175; match to protein family HMM PF00970"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83699"
FT                   /db_xref="GOA:A6UXI2"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI2"
FT                   /protein_id="ABR83699.1"
FT                   /translation="MTENEAQVRSWQSCVIDDIIQQTPSIKSFFLRLSKPFAHTAGQHV
FT                   DIRLTAPDGYSAMRSYSIASSAVSTPIVEIAIERMPDAEVSPFFHDIAAIGDEIEVRGP
FT                   LGGHFLWPEPAIDPVLLIGGGSGLVPLMAMIRQRRALAQAVPTALLLSARTAEDVLFSE
FT                   ELHCIEISDPAFVLALAITREKPVRASDFARRIDGMMVQEILTRLQGKPTQVFVCGSNG
FT                   FVNIATDSALLAGLDASIIKTERYGG"
FT   gene            complement(130073..130675)
FT                   /locus_tag="PSPA7_0122"
FT   CDS_pept        complement(130073..130675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0122"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81145"
FT                   /db_xref="GOA:A6UXI3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI3"
FT                   /protein_id="ABR81145.2"
FT                   /translation="MVTRGFTGRGSGDQSDRIPPGQHLVEDFPVLSAGPTPRVEPSDWK
FT                   FTVKIGPKPVKTWNWGEFNTLPKTQVTKDIHCVTSWSKLDTVWEGVLIEDILADAELDR
FT                   PTDFVLAHCYDNYSTNVPLTDLLSGKAMVALSYAGKPLSRDHGGPARLLVPHLYFWKSA
FT                   KWVNALQFTTRDEAGFWELHGYHIYGDPWREQRYTHD"
FT   gene            131143..131613
FT                   /locus_tag="PSPA7_0123"
FT   CDS_pept        131143..131613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0123"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81917"
FT                   /db_xref="GOA:A6UXI4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI4"
FT                   /protein_id="ABR81917.2"
FT                   /translation="MNEIERQAPELRVQKWIGKDGESIAPFKLSDIGPGPKILFAFQHW
FT                   CQGCHLHGFPTLQKLHAALSSKDVGFAVIQTVFEGTHENTFEKLRVNQLKYELPIVFGH
FT                   DEQPTGSPFPTFMEDYRTRGTPWFTVIDAGGSIVFSDFHLDAERLVKQLEQG"
FT   gene            complement(131939..132229)
FT                   /locus_tag="PSPA7_6381"
FT   CDS_pept        complement(131939..132229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6381"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FS04"
FT                   /protein_id="QCB64555.1"
FT                   /translation="MEAFVVFTREETSDPHALATYSAGVGPSFDGHDVTFLAAYGAIQH
FT                   LEGPPIEGAVILRFPTMQAARDWYDSPAYQTIAAHRFAGSRYRAFIIEGRR"
FT   gene            complement(132291..132722)
FT                   /locus_tag="PSPA7_0124"
FT   CDS_pept        complement(132291..132722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0124"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF03928"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85722"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI5"
FT                   /protein_id="ABR85722.1"
FT                   /translation="MTKSIATASINRETAVALIDAALAAARAIGIPAAVAVVDATGNLR
FT                   AFERTDDAPFLTVDVAIDKAWSSASFGFPTHVWNDYVTNDPKVAPLAYRPRMVAVGGGY
FT                   PILEDGKLIGGIGISGGNYQQDQDACVEALMKIGFQLPA"
FT   gene            complement(132795..133808)
FT                   /locus_tag="PSPA7_0125"
FT   CDS_pept        complement(132795..133808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0125"
FT                   /product="alcohol dehydrogenase, zinc-binding"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00107; match to protein family HMM PF08240; match to
FT                   protein family HMM TIGR02817"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86367"
FT                   /db_xref="GOA:A6UXI6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI6"
FT                   /protein_id="ABR86367.1"
FT                   /translation="MKAIGYKVPGPIAADAALVDINLPRPVAAGYDILVEVKAVSVNPV
FT                   DYKVRNSTPPADGDWKVLGWDAAGIVREVGPDVTQFELGDEVYYAGSITRPGTNAEFHL
FT                   VDARIVGHKPASLSWAEAAALPLTTLTAWEAMFDRLDVAKPVPGAAEAILIIGGAGGVG
FT                   SIAVQIARQRTDLTVIATASRPETQEWVRGLGAHHVIDHSRPLAPQIAELGIGAPAFVF
FT                   STTHTEQHVADIAELIAPQGRFGLIDDPKAFDIMVFKRKAVSIHHELMFTRSIYGTPDM
FT                   NEQGEILDAMAALVDDGKIRTTLTRRLSPINAANLKTVHALIESGAAKGKIVLEGF"
FT   gene            complement(134256..135224)
FT                   /locus_tag="PSPA7_0126"
FT   CDS_pept        complement(134256..135224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0126"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85283"
FT                   /db_xref="GOA:A6UXI7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI7"
FT                   /protein_id="ABR85283.1"
FT                   /translation="MSIIAAYYYNEGKRVREIALDEHVKLGESRSGFCWIALSEPTPEE
FT                   LLAIQRTYNLHPLAIDNAMHPLCPPKLEVYNDELYVVAQTAELVGDRISYGKMAIFTGH
FT                   NHLITVRHGNAGALGKLREQLEASPTQFGKGVDYVLHAILHRVVDQYLPIFEMIEDDVL
FT                   AMERRSLHDFLGPEEVARIFELRSELTRFQRTLRAMAELVRKLVRGHFPCISAEMTPYF
FT                   HDVADHVHRVQSMVDGLLLVLSTVFEASSLLEAQRIGVVTRQLAAWAAILAVPTAIAGI
FT                   YGMNFKHMPELDTAYGYFVVLGVIAISCVFLFVRFKKAKWL"
FT   gene            complement(135221..135925)
FT                   /locus_tag="PSPA7_0127"
FT   CDS_pept        complement(135221..135925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0127"
FT                   /product="glutathione S-transferase family protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84704"
FT                   /db_xref="GOA:A6UXI8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI8"
FT                   /protein_id="ABR84704.1"
FT                   /translation="MPDLSSFPITQRWPASHPDRLQLYAAPTPNGVKVSIMLEETGLAY
FT                   EPHLIDISNNESKDPAFVSLNPNGRIPAIIDPAGPDGRPIALWESGAILLYLADKTGQF
FT                   ISTEPGQRYETLAWVFFQMSAIGPMFGQLGFFLRFGGKDYEDKRPQQRFIDESTRLLGI
FT                   LDRRLEGRDWIVDDYSIADIATLGWVNALVEFYAAGDILGLSSFSNVRAWLGRGLARPA
FT                   VQRGLHIPARPA"
FT   gene            complement(136066..136605)
FT                   /gene="msrA2"
FT                   /locus_tag="PSPA7_0128"
FT   CDS_pept        complement(136066..136605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA2"
FT                   /locus_tag="PSPA7_0128"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01625; match to protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83591"
FT                   /db_xref="GOA:A6UXI9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXI9"
FT                   /protein_id="ABR83591.1"
FT                   /translation="MHQRAVLAGGCFWGMQDLIRKRPGIISTRVGYTGGDIPNATYRNH
FT                   GTHAEGIEIVFDPTVTSYRNILEFFFQIHDPTTLNRQGNDRGLSYRSGIYYVDEEQKRV
FT                   AEDTIADVDASGLWDGKVVTEVQPVGEFWEAEPDHQDYLEKRPGGYTCHFVRPGWVLPK
FT                   RQKVDDVQPAAGTAAE"
FT   gene            complement(136607..137050)
FT                   /locus_tag="PSPA7_6382"
FT   CDS_pept        complement(136607..137050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6382"
FT                   /product="methionine sulfoxide reductase B"
FT                   /note="manually annotated"
FT                   /db_xref="GOA:A0A4D6FUX0"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FUX0"
FT                   /protein_id="QCB64556.1"
FT                   /translation="MKFEKSQTAIDHLTPEQHRITQEAGTERPFTGEYNDNKEPGIYVD
FT                   IVSGEPLFASTDKFDSGTGWPSFTKPIVSANVNEVRDSAHGMVRTEVRSVHADSHLGHV
FT                   FPDGPSDRGGLRYCINSASLRFIPRDEMESEGYGEYLDQVEEA"
FT   gene            complement(137571..138374)
FT                   /locus_tag="PSPA7_0129"
FT   CDS_pept        complement(137571..138374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0129"
FT                   /product="transposase"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85702"
FT                   /db_xref="GOA:A6UXJ0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ0"
FT                   /protein_id="ABR85702.1"
FT                   /translation="MRDLMAELKELRLHGMATAWAELTAQGESNTASSKWLLEHLLEQE
FT                   HTDRAMRSVSHQMNMAKLPMHRDLASFDFNASSADARLISELASLAFTDTAQNVVLIGG
FT                   PGTGKTHLATALAVSGITRHGKRVRFYSTVDLVNLLEREKHDGKAGRIAQALLRMDLVI
FT                   LDELGYLPFSQAGGALLFHLLSKLYEHTSVVITTNLSFAEWSSVFGDAKMTTALLDRLT
FT                   HHCHIVETGNESYRLQHSSLAAQAKIKSRERKRKGGQEPEDDEPF"
FT   gene            complement(138367..139875)
FT                   /locus_tag="PSPA7_0130"
FT   CDS_pept        complement(138367..139875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0130"
FT                   /product="transposase"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82146"
FT                   /db_xref="GOA:A6UXJ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ1"
FT                   /protein_id="ABR82146.1"
FT                   /translation="MISMEMMGKIRRMYFRDKLSLHEIAKRTGLARNTIRKWVRAPEAK
FT                   PPVYQRRAIFNKLSPFHATLEQALKADSLRPKQQRRSAKALLAQIKAEGYDGGYSQLTA
FT                   FIRAWRGGQGKASQAFVPLTFALGEAFQFDWSEEGLLVGGIYRRMQVAHLKLCASRAFW
FT                   LVAYPSQGHEMLFDAHTRSFGSLGGVPRRGIYDNMKTAVDKVNKGKGRAVNARFAVMCA
FT                   HYLFDPDFCNVAAGWEKGIVEKNVQDSRRRIWLDAQDCQFHSFEELNAWLGQRCRALWN
FT                   ELTHPQYSGLSVAEVLELERAELMPMPAAFDGYVERPARVSSTCLVSVGRNRYSVPCEY
FT                   AGKWVSSRLYPTRIEVVADDALIASHARLLDREQVSYDWQHYIPLIERKPGALRNGAPF
FT                   TDLPAPLRQLKHGLGRHAGGDRIMAQVLAAVPVAGLDAVLVAVELVLESGSLSAEHILN
FT                   VVARLTASEPPPSVETHLSLKEAPVANTARYDRLRGQTKEIGHA"
FT   gene            complement(139970..140125)
FT                   /locus_tag="PSPA7_0131"
FT   CDS_pept        complement(139970..140125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0131"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86672"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ3"
FT                   /protein_id="ABR86672.1"
FT                   /translation="MPMILRYLSVSLASALVAGYVALWLANPVPLEQPHAVVRPPLTIE
FT                   QQGCCR"
FT   gene            141410..141955
FT                   /locus_tag="PSPA7_6383"
FT   CDS_pept        141410..141955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6383"
FT                   /product="DEDDh exonuclease"
FT                   /note="manually annotated"
FT                   /db_xref="GOA:A0A4D6FV43"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FV43"
FT                   /protein_id="QCB64557.1"
FT                   /translation="MSDELYVSVDVETSGPVPGIYSLLSIGACVVSEPAQSIYLELQPD
FT                   GLQHDPEAVAVTGLDLTRLENEGLAPKTAMLKLKQWLNQVCSADQKVVFVGLNAPFDWS
FT                   FINYYFQKYSGTNPFGFTALDIKAYYMGATGCRWGETKSSQMTARFKPQSAPNHNALDD
FT                   ARFQGELFALMLEEARNR"
FT   gene            complement(141952..142443)
FT                   /locus_tag="PSPA7_6384"
FT   CDS_pept        complement(141952..142443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6384"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FST1"
FT                   /protein_id="QCB64558.1"
FT                   /translation="MTAIAWQWTWPGLNTSLLVSQEVASLLESYRQKHFDVERGGQLFV
FT                   DPSGAAGLVLALATPPHKDDRAGRTWLDLNARRCRKEIEQANATGLRLVGYWHTHPQSI
FT                   PMISPTDIGSFSRFAAYYTQQLPHPLAIIVGNSSSHEGIKAWSFRDGRYVEAIRGSWPG
FT                   "
FT   gene            complement(142440..144224)
FT                   /locus_tag="PSPA7_0134"
FT   CDS_pept        complement(142440..144224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0134"
FT                   /product="ThiF family protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00899"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83874"
FT                   /db_xref="GOA:A6UXJ5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ5"
FT                   /protein_id="ABR83874.1"
FT                   /translation="MGVLVDQTDTSLQRGIAALRGALGEDAAHALLQPAVPRTGEAASY
FT                   YFPLPVDYTGTERRLRISFPKNFPRGGLRLTVEPSPWLVWPHAMEVGLCLHGFQERPVM
FT                   GTPEYVVSDSLARLAKIVNLSRMGSCAATRDAEFRREITSYWSRQQGQSLQNLILLDRP
FT                   QAASKLYALSDPRQTLPSGQETVWLAPDLASLKRHYRRTIGRSPRMRAPEAPGFYAKLR
FT                   SYPDLRLPAPELLLTWLLPHLAPNDRTQLVAWFNERGSLPNRWIALELPGDASAPIYCL
FT                   NVRAYGPRLDRGSRFYLRSARRRPAVVVNHPPVLIRATTLDVLDRTEILSRDLSGVAQK
FT                   LEGARVVCVGVGSLGSTVALQLARSGVGHLTLIDPDHLVSANLGRHVLGADDLGLPKAE
FT                   ALQERIRKDLPTTDVAAFATFAEVVMYKNPEVFDKADLVVVTTADWQSEVALWGAKSNG
FT                   TSWGLLQAWSEPHTQVGHVLLAPSGAFDARGLFTDNGDFKHKFTEWPEGGVVALPACGE
FT                   SFIPGGSLGMVNIASMVSQAALRALNGNIGSPSWVSSINRPDDVVTLGGNYLGPELPAG
FT                   MQQALLERDWPEISERSK"
FT   gene            complement(144208..145461)
FT                   /locus_tag="PSPA7_0135"
FT   CDS_pept        complement(144208..145461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0135"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84902"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ6"
FT                   /protein_id="ABR84902.1"
FT                   /translation="MSMSNEQTKRGSWEHFLLRAAKEISLSEAQYEKINDRYSQLEKIL
FT                   NASDNPLLAEAHIFVQGSMRLKTTIKPVSGAPEDLDTIDADAIIWLPHAQDAGAREVLD
FT                   AIEERFKAGSRVQEEIKQLRRGIRIVYADENPGFHIDVTPARAINGNSQGNGEGKLEVP
FT                   DRETGWKASSPIPYSKWLQVASTQTISLAEHMAVAKSQRAFDAATQDPLPQYQDYLDQD
FT                   PLRATIKLLKRHRDEWAIRTKNTDHRPISAVITTLATHAYLDVAKESQSTPLRPLDAIL
FT                   EIVRRMPDHVKYRGNECQVCNPADSGENFAEKWNRPLDGHRYRRAFQEWHENASVSVSL
FT                   GLESFESAEAFAKAVNENFGIGPTFISAVNSEIPPNWTMPGRPDGTTRNATLMGTMFGG
FT                   ASGTASSQEDVKPVGRLG"
FT   gene            complement(145461..146636)
FT                   /locus_tag="PSPA7_0136"
FT   CDS_pept        complement(145461..146636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0136"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82895"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR040836"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ7"
FT                   /protein_id="ABR82895.2"
FT                   /translation="MGKQEKANAATGRYDTDDVTKRVVWTQAAGHCELCGTDLMYDYRA
FT                   GKPMKWGEVAHILPASPKGPRGRSDHDEAKAASLTNDPANLMLLCPGCHDKIDRDAEGY
FT                   PESDLSGLHQAYLERVRLAATTPDGGRAIPVIVQSQHFATNNDIPVRDLLVAMSSEGLT
FT                   AFDHPIKITFPAPSHRGRDAHYWQSIKDNIQHELEQQLKRRGGAYGDVPALAVVGVADI
FT                   PALIMLGQSLGDRSKRLLFSFNREHQLRWPDQSAEPPEFVFTPPSDGEGPLALVLSISA
FT                   QVPTRDVEEALPGARIAELSIPVPSYAMVQNRRVIHAFRDALQTHLSRLEAMTADTIHV
FT                   FAAIPAALAIEFGALLTTQHQHAYLIFDRDKDNQNRFTPTLQLGHQAQEVR"
FT   gene            complement(147202..148725)
FT                   /locus_tag="PSPA7_0137"
FT   CDS_pept        complement(147202..148725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0137"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83766"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ8"
FT                   /protein_id="ABR83766.1"
FT                   /translation="MTKKKKKSRSGKITTPLAGHKRVGKALVPPMLQLEGVSFSSWVND
FT                   RLPEMLWASLVITVIPRDQALEAFRDIAALGLRYRKDEREQATGWTLRHTHLPAQPREL
FT                   FEALVGRVLRCHAGAQALRPLLLLENLPGITWWKAALGSEPIEDDWQTLGQAVQKTFDH
FT                   QSQEATDVRWVSILFKIALGEMLFPAGFEEHLLEIVEYPNRGDMRSVRPSIRAMEMTFT
FT                   HLGQSSWSESFWTDMLQQTGCTPAPLLPREKPSNDLQAVRLGLVEVRKALLEHWFTTLS
FT                   TSGIDPKQDGVFGFGFFALSCFAEMSSGPLNEGIAGRLLLRALTECRISLAFLVRCGDD
FT                   AMWKKFRSYGAGQAKLALLKHEEMTGERPRFVTLETLERLANEDYFQEYVEIDLGHWCG
FT                   KDLRKLAEESGTKEDYDRYYGWASGFVHGQWGAMRDSNFTHCLNPLHRFHRVPLPFHRK
FT                   LEPTLDDGLQLVNSILDDVSTAYPGFNARIKISSDSMERQEDAATVEPT"
FT   gene            complement(148828..150540)
FT                   /locus_tag="PSPA7_0138"
FT   CDS_pept        complement(148828..150540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0138"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82880"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXJ9"
FT                   /protein_id="ABR82880.1"
FT                   /translation="MRRFEAKDLIALATAPMNPDDHWYVDAEQASQYLVANANADEIVI
FT                   YASAPAVLIVGALVPTVNVTPVDGGALQNTSLCTDAAWKIQKSWNAAEGYRVYLEPPFP
FT                   NDRVSALSGGETLVTRRYLSGVHKGPAPIEVSQKLVHCLDIHYIPERNAYCRLDGNGDI
FT                   EDVIRVLTLPIDEQLEGREVVTILRKDLDTYMAVADLALVIKFDFTRTVRGSFSGWNDV
FT                   SRYHRDGEDLFYHGGSAARASFMHGAMVVRSRTTLAEQEEAWRRDFEGAPDREYAVFKI
FT                   YDRKNDRNVETSASPLHIVSYFEQSDLPWQISPAFFRPEVLQRFKADPEKYTLEDRSIS
FT                   CRGAWHIKSYDINEAGQVHVYIGDLAKLPIAEQNYWKAFNEWPKSSISARAHRTDIEGQ
FT                   WCTTYDPLNSLRNKVRALDKACPEWWNRRGDALMDSVLAPATDSPKEWGDEILALDQLL
FT                   VEGFLDKPLRKIAQEKGREIEPVWRSLKLLHEILLGSTLSEEAAKQLLAPMKKLHELRN
FT                   EIRGHATHEKKEVAIREARTTHGNFRAHFFHLAEGCDQALIGVLKALEFEMED"
FT   gene            150805..151089
FT                   /pseudo
FT                   /locus_tag="PSPA7_0139"
FT                   /note="ISPsy6 transposase, C-terminal truncated"
FT   gene            151320..151940
FT                   /pseudo
FT                   /locus_tag="PSPA7_0140"
FT                   /note="DNA repair photolyase SplB, N-terminal truncated by
FT                   genomic island insertion"
FT   gene            complement(152053..152967)
FT                   /locus_tag="PSPA7_0141"
FT   CDS_pept        complement(152053..152967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0141"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83156"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK2"
FT                   /protein_id="ABR83156.1"
FT                   /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAE
FT                   YYPSCYEPVGHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGGAL
FT                   AGGAAGYYMEKQKQISDDRARIGSYGTDVDRSTVEINRSVAYAKSAQSCYQSQFKALLD
FT                   GRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENISNYTQAYEKDLQQVGVPR
FT                   AEVTKVAEAENRASTTKGGNKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASQGQ
FT                   GMIREVCNSPDMGDWAPPSCAKA"
FT   gene            complement(153029..154741)
FT                   /locus_tag="PSPA7_0142"
FT   CDS_pept        complement(153029..154741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0142"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85621"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK3"
FT                   /protein_id="ABR85621.1"
FT                   /translation="MFEKAILPLALGACLGFAAPAWAEGDPPDNPRPLADDVALPLPCG
FT                   GEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLAPA
FT                   WQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDVPSG
FT                   MAARLPKVDLSRFDAERFGAVYSAWLLKNHPDLLPVSGRGKNPEDGGTGFVRLPTEVEW
FT                   EFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLADWAVYNQVAGGTGQAARLLPVGMKR
FT                   PNPLGLYDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTGMRREYP
FT                   LFAADGSEQRNATTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDDAQDPTKQ
FT                   LDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAETINNYNIR
FT                   LTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTRYTDAVIQAQ
FT                   FQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLASSGR"
FT   gene            complement(154734..155933)
FT                   /locus_tag="PSPA7_0143"
FT   CDS_pept        complement(154734..155933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0143"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83927"
FT                   /db_xref="GOA:A6UXK4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK4"
FT                   /protein_id="ABR83927.1"
FT                   /translation="MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYGL
FT                   VGTLTERLERAPSVREIIPVGGARYRAEDIAALAARADVAFAVPRTRQIAASADLSGGG
FT                   ETVLSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGAAEKLGAQPGERIVARIGRRMDGQ
FT                   AQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVPAYGWPGKAGGAPRER
FT                   IYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVAALAIG
FT                   GAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMLLALFSALFGLLLAGLLYAA
FT                   AAGALNHLFDNQSGEFVCRLLPSHFLAALLATLLCSVLAAASGGWRAARIEAAEGLRDV
FT                   "
FT   gene            complement(155933..156652)
FT                   /locus_tag="PSPA7_0144"
FT   CDS_pept        complement(155933..156652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0144"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84055"
FT                   /db_xref="GOA:A6UXK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK5"
FT                   /protein_id="ABR84055.1"
FT                   /translation="MILRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGKS
FT                   TLLDLLALALAPDPGGRFEFLAGERPQDIAALWRDGRQDRLATLRRQHCGYVLQSGGLL
FT                   EFLDVRRNIGLPCALLGAPSAERVQTLAERLEIGDQLDKKPAALSVGQRQRVAIARALV
FT                   HAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERLARAAGLEVLAIR
FT                   WQREADDSVGACLEDAG"
FT   gene            complement(156649..159747)
FT                   /locus_tag="PSPA7_0145"
FT   CDS_pept        complement(156649..159747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0145"
FT                   /product="serine/threonine protein kinase PpkA"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00069; match to protein family HMM PF07714"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81869"
FT                   /db_xref="GOA:A6UXK6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK6"
FT                   /protein_id="ABR81869.1"
FT                   /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAA
FT                   DPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPE
FT                   LGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQV
FT                   GFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEP
FT                   LPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGS
FT                   PRATDPPPAGPAPMPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPP
FT                   LPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLGSGDAPNAADPAPLGQTPTDKPPQ
FT                   QTPMADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYA
FT                   RKQVGGSPWLRVGASSNGAGDGWLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVE
FT                   RLLGDTRAARDTLTQAVDHEGDPQVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPA
FT                   QLLEVASIDPGGSAAAPQAPGQAGQGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVRE
FT                   VIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSS
FT                   QVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNE
FT                   AEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVN
FT                   AFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIGYAMQMEFLGRRDPVR
FT                   APQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLIVDAAKRTQTSPKDFFQ
FT                   EIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWLSLSVAEQQD
FT                   FIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP"
FT   gene            complement(159755..160483)
FT                   /locus_tag="PSPA7_0146"
FT   CDS_pept        complement(159755..160483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0146"
FT                   /product="putative phosphoprotein phosphatase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83475"
FT                   /db_xref="GOA:A6UXK7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK7"
FT                   /protein_id="ABR83475.1"
FT                   /translation="MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMGG
FT                   HAAGDFVSSLIVDTLRRIPAASSLPAYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLV
FT                   LLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSYVQELLDNDLISEDEARHHPRANV
FT                   VTRAVGVHERLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLGHSDPYAVVRSLV
FT                   HLGLTRGAPDNITALVVRAF"
FT   gene            complement(160493..161173)
FT                   /locus_tag="PSPA7_0147"
FT   CDS_pept        complement(160493..161173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0147"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84567"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK8"
FT                   /protein_id="ABR84567.1"
FT                   /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELG
FT                   AAWLDAYLTSPLWRFAIAPGLLGDDAVAGVVMPSIDRVGRYFPLTVACLLPANADLGAL
FT                   VGGDDGWFEQVEGLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAA
FT                   TPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFP
FT                   GIPG"
FT   gene            complement(161170..164700)
FT                   /locus_tag="PSPA7_0148"
FT   CDS_pept        complement(161170..164700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0148"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81637"
FT                   /db_xref="GOA:A6UXK9"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXK9"
FT                   /protein_id="ABR81637.1"
FT                   /translation="MKGFLNFFTRWVVPVLGLLALSLVIWFLGPLLRLGNYEPLASATS
FT                   RWVLIALLFLVWIGFRVLRIVQARRNAAKVMQSLAEVSAPDAASVATAEELATLKQRMD
FT                   EALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGAIRG
FT                   VGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPIDGAFI
FT                   AISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSL
FT                   NREERAQVWGMTFALDDGKSAEGPLAGFASEFALLEQRLTARLVERLQQERDPARRDLV
FT                   YGFPQQFAALRECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSM
FT                   NLDRQHLARQTGTGRSYFIERLFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVV
FT                   LAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLNAVQNLANDA
FT                   PGWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQLRSGGSSDFLYEGLKAY
FT                   LMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDL
FT                   VEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPL
FT                   SGFFTYRGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQ
FT                   WDDLLADLTVVPITNVTQAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKK
FT                   AADGTVDKLKQRLGSLVGQEEEGVREQPQQADSDPISAHFAELNSLVSKGEGGNEPAPI
FT                   DSLLEDMNTLYVQVSAMAGASGDSLLGDAKNQVAAAASRVALSAERQPPVVQGLVKKVV
FT                   NSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFGAGGV
FT                   MDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPT
FT                   VRFELKPVTMDAAISQFILDLDGQQLTYDHGPSRPVAMQWPSANGLGVVRLTVTPAPSS
FT                   GRSGLTLEGPWAWFRLLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRV
FT                   VSGFSLPERL"
FT   gene            complement(164697..166046)
FT                   /locus_tag="PSPA7_0149"
FT   CDS_pept        complement(164697..166046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0149"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82952"
FT                   /db_xref="GOA:A6UXL0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL0"
FT                   /protein_id="ABR82952.1"
FT                   /translation="MSPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPASGPRAGD
FT                   PYTPPPMASLAPLASRGDGLNPLEQAAGPLLAMLTRLRSTIAHPAPASLRAQLLGYLRQ
FT                   FEEKARQAGVAADEVMLARYVLCTALDEAVLSTPWGSASDWGKQSLLITLHNEAWGGEK
FT                   VFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLETLRERTAAVIRSTR
FT                   GEYERELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFRR
FT                   IHAIGEIPVQAIDRPAIQPRVIERPRLARFLAEDIKAQRVAVEDAVDRSVVTIRGDELF
FT                   ASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEV
FT                   ADLLGATTGEAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ"
FT   gene            complement(166053..167387)
FT                   /locus_tag="PSPA7_0150"
FT   CDS_pept        complement(166053..167387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0150"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85744"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL1"
FT                   /protein_id="ABR85744.1"
FT                   /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGF
FT                   SELKLDDALLTQGKLAVLSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPL
FT                   KRVGTRDTAEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGLGEY
FT                   AALGIARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALAGRVV
FT                   ASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQR
FT                   RPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRNLI
FT                   DNASFILVVRADVPGETLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPY
FT                   HAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
FT   gene            complement(167404..167868)
FT                   /locus_tag="PSPA7_0151"
FT   CDS_pept        complement(167404..167868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0151"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   TIGR03352"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82323"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL2"
FT                   /protein_id="ABR82323.1"
FT                   /translation="MQKLMIALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQ
FT                   AAPLRLRLYELKKDTAFGRADYFALTDNAPSTLGGDLVEQDEFLLRPGEERRIERTLDE
FT                   QTRQLGFVAAYRDLDRATWRQVLDIPGQRTSHLDVTLGAQAIGIVARPAP"
FT   gene            complement(167913..169439)
FT                   /locus_tag="PSPA7_0152"
FT   CDS_pept        complement(167913..169439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0152"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82978"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL3"
FT                   /protein_id="ABR82978.1"
FT                   /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPER
FT                   LVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQ
FT                   LGHDIALPGSGNPQTDPFTSFDALMSRQNAATAPAFPEPAATPHPAVAAHFQGGSPLDT
FT                   RPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPPPPAITPAPAPAGGAPLIPADW
FT                   DPFAELLGNTPAAGPAPATEPLATPLPTPEPAPLAMPFADPGITQQPPQPQPQPQPQPQ
FT                   PQPQPQPQPQPQPQPASVAPPTPPASAAPTAGADLLQAFLRGAGMTQLKVDPAGAEAQM
FT                   EAIGRSYRGLVEGLVDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEAMLLLLRR
FT                   DNQAFMAPDRAVADSFEDLKAHQLAVMAGVQAAIRHLLARFEPAALEARFGKPAGLSGL
FT                   LPGARQAQNWESFTELYAKILREAEDDFQELFGREFSRAYEEHSARLRRS"
FT   gene            169807..170838
FT                   /locus_tag="PSPA7_0154"
FT   CDS_pept        169807..170838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0154"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81447"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL5"
FT                   /protein_id="ABR81447.1"
FT                   /translation="MLDVPVLLAAVAPDSPCGEDLEYDAAFLELERIAQGQPERQMGDA
FT                   VLPAEPPEWPRVRALACELFGRSKDLRVANLLLQSNVALDGLDGLAEGLLLVRELLDQY
FT                   WDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAG
FT                   LQRFASETLSPEQIAGAFADADADALAATRRALEGAQEHALAIEGGVAERVGSAQGLDL
FT                   APLRQLLRQALQVFDLYGPQGAGASVVPGAEAAPAEEPGAAPVAAAVPAARASGEIGNR
FT                   EDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGITQFETLRGP
FT                   ENE"
FT   gene            170927..171445
FT                   /locus_tag="PSPA7_0155"
FT   CDS_pept        170927..171445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0155"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF05591; match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80663"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL6"
FT                   /protein_id="ABR80663.1"
FT                   /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMAD
FT                   LAGKPAEPQAAVADRKFLEIDADNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESM
FT                   DDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEDMIMKAIKDPALLQALASAP
FT                   KPKDDEPQA"
FT   gene            171458..172954
FT                   /locus_tag="PSPA7_0156"
FT   CDS_pept        171458..172954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0156"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF05943; match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81367"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL7"
FT                   /protein_id="ABR81367.1"
FT                   /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAV
FT                   RTLAEHALEQTSLISNDAIKSIESIIAAIDAKLTAQVNLIMHHADFQQLESAWRGLHYL
FT                   VNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCL
FT                   VGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTT
FT                   PEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWAN
FT                   SAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDR
FT                   REAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDASANANLAARLPYLFATCR
FT                   FAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVE
FT                   EVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
FT   gene            173030..173518
FT                   /locus_tag="PSPA7_0157"
FT   CDS_pept        173030..173518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0157"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF05638"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83085"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL8"
FT                   /protein_id="ABR83085.1"
FT                   /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGG
FT                   GGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKE
FT                   VLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPIKYGWNIRQNVQA"
FT   gene            173677..174462
FT                   /locus_tag="PSPA7_0158"
FT   CDS_pept        173677..174462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0158"
FT                   /product="virulence protein, SciE type"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF07024"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85748"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXL9"
FT                   /protein_id="ABR85748.1"
FT                   /translation="MIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLLAVMGQ
FT                   WTRALNQLKVVGELDASALPMVQTYSTAIECEALRREVFAGRLTPVILGQPAEWIAPLL
FT                   QALSLDAEGHGEAAQGLREQAFDAAPAVPGRIGETPFAWLADADTRLGPVLEVIVNGRY
FT                   AWLPMSNLRSLQVEAPSDLRDLVWLPAELTLANGGATVALLPARYAETVEHGDDAARLG
FT                   RKTEWLESGLPLGQRLFVTDAGETALFDLRRLDFEATDA"
FT   gene            174464..174973
FT                   /locus_tag="PSPA7_0159"
FT   CDS_pept        174464..174973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0159"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81378"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM0"
FT                   /protein_id="ABR81378.1"
FT                   /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVL
FT                   RDLAWLFNTTSLFDHDLAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATF
FT                   EPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQ
FT                   GERRRA"
FT   gene            174970..176829
FT                   /locus_tag="PSPA7_0160"
FT   CDS_pept        174970..176829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0160"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85371"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM1"
FT                   /protein_id="ABR85371.1"
FT                   /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPY
FT                   VERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGAL
FT                   SSGFSVERGASLRGQLGPEDQTACEYRTAHPVTLWPLEVVQADYFGNPAAVLGRLAASE
FT                   PRAKAGLRIRLRSGAGIPFHSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVRAPDN
FT                   AWVERLPASSLRPRGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRALR
FT                   RCAGEELELIVLFGKHDARLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVI
FT                   VDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSK
FT                   QRRKGPRSTYVGSETFVALVDASQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHRSDFT
FT                   LEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGAAALRELLRL
FT                   YGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDENAFRGTGVFLL
FT                   GAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
FT   gene            176793..177839
FT                   /locus_tag="PSPA7_0161"
FT   CDS_pept        176793..177839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0161"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83569"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM2"
FT                   /protein_id="ABR83569.1"
FT                   /translation="MAGEAGQPSEPLSLLAGMAAAPWDYDFFQALRRIECESPQLPRLG
FT                   HSVRLADDPLRLGQKPDCTFAPSTLASVSQAGADAVPRLDQFFFGLTGPNGPLPLHLTE
FT                   YARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAALSG
FT                   RGMPSLRAREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQWLELP
FT                   ERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWVA
FT                   EYLGEELDWDVNLVLQRQEIPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPH
FT                   EHKEKEHE"
FT   gene            177832..180540
FT                   /locus_tag="PSPA7_0162"
FT   CDS_pept        177832..180540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0162"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00004; match to protein family HMM PF02861; match to
FT                   protein family HMM PF07724; match to protein family HMM
FT                   PF07728; match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86797"
FT                   /db_xref="GOA:A6UXM3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM3"
FT                   /protein_id="ABR86797.1"
FT                   /translation="MSEISRVALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWFHQI
FT                   LQLPDSDLHQIVRQSGIDPARLAKDLTEALDRLPRGSTSITDLSSHVEEAVERGWVYGS
FT                   LMFGESQVRTGYLVIGILKTPSLRHALTGLSAEFAKLKVEALTERFDEYVGASPENGLS
FT                   ASDGFNAGAAPGEASGAMAPSAMGRQEALKRFTVDLTEQARSGKLDPIVGRDEEIRQLV
FT                   DILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRALDVGLLQAGAS
FT                   MKGEFEQRLRQVIEDVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLR
FT                   TVAATTWAEYKKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEQHHQVQILDE
FT                   ALEAAVRLSHRYIPARQLPDKSVSLLDTACARTAISLHAVPAEVDDSRRRIEALETELA
FT                   IIRRESAIGVATGERQRNAETLLAEERERLAGLERRWAEEKRLVDELLETRARLRAAAE
FT                   AVDAGGTPLGEGEARLDEEQRQALHARLAELQAQLSALQGEEPLILPTVDYQAVASVVA
FT                   DWTGIPVGRMARNEIETVLNLDSHLKKRIIGQDHALEMIAKRIQTSRAGLDNPSKPIGV
FT                   FMLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEG
FT                   GVLTEAVRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRLIDFKNTLILLTT
FT                   NAGTEMIASLCADPELMPEPEAIAKSLREPLLKIFPPALLGRLVTIPYYPLSDDMLKAI
FT                   SRLQLGRIKKRVEATHKVPFEFDEGVVDLIVSRCTETESGGRMIDAILTNTLLPDMSRE
FT                   FLTRMLEGKPLAGVRISSRDNQFHYDFATAD"
FT   gene            180575..182515
FT                   /locus_tag="PSPA7_0163"
FT   CDS_pept        180575..182515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0163"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04524; match to protein family HMM TIGR01646; match to
FT                   protein family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84753"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM4"
FT                   /protein_id="ABR84753.1"
FT                   /translation="MGLMQLTRLVQVDCPLGADVLLLQRMEGREELGRLFAYELHLVSE
FT                   NPNLPLEQLLGKPMSLSLELPGGGRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLT
FT                   RTSDCRIFQNQSVPEIIRQVFRDLGFSDFEDALTRPYREWEYCVQYRESSFDFVSRLME
FT                   QEGIYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREV
FT                   QPGSLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEA
FT                   LQAQHERVRLRGVVRGLGAGHLFRLSGYPREDQNREYLVVGAEYRVVQELYETGSGGAG
FT                   SQFESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDR
FT                   HDQSNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQT
FT                   VPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASL
FT                   IVGHDRNKSVGNDELARIGHNRTRAVKLNDTLLVGGAKSDSVSGTYLIEAGAQIRLVCG
FT                   KSVVEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDANGKGVQGTIDGQ
FT                   VQAMFPPPPKA"
FT   gene            complement(182642..182767)
FT                   /locus_tag="PSPA7_0165"
FT   CDS_pept        complement(182642..182767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0165"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83853"
FT                   /db_xref="InterPro:IPR040818"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM6"
FT                   /protein_id="ABR83853.1"
FT                   /translation="MVPLGHQPNRAALHRIGIGAIAVKEFDETDVELAEALKAAH"
FT   gene            complement(182778..183311)
FT                   /locus_tag="PSPA7_0166"
FT   CDS_pept        complement(182778..183311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0166"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83785"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM7"
FT                   /protein_id="ABR83785.1"
FT                   /translation="MSMNPDNVLTLALANDELDRFLVGEPFYFLEARSDNEEPQNVSQA
FT                   FDQLLMPYWRATRDPDLPFRFVAALLKILATYPDRNRAIYVAQNWIWYYRFCLSKKRAN
FT                   PQGPYGDLFEVDLGAVAVALKRQLEANKDELIRDTRWAGAAWNSSNGLWGPLLRTSTTV
FT                   RDKLGGPDFVPDNP"
FT   gene            complement(183308..184612)
FT                   /locus_tag="PSPA7_0167"
FT   CDS_pept        complement(183308..184612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0167"
FT                   /product="paar motif family"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF05488"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82927"
FT                   /db_xref="GOA:A6UXM8"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM8"
FT                   /protein_id="ABR82927.1"
FT                   /translation="MDAQAAARLGDEIAHGFGVAAMVAGAVAGALIGAAVVAATAATGG
FT                   LAAVILAGSIAAGGLSMFQIVKGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDV
FT                   SATCSGLPLNHPLWPFPVIIAEGSATVYINGKPAARLQSKMVCGAHIKTGSQDTFIGGP
FT                   TERVAFVLDLEEWLHTGLEALGLAALAGGLLLAAMAGVAALAGFVAIGGLMMGGMALLG
FT                   DLGDRLGPGYRDLFQGVAGMALLGFGPKMARLGRASAAGEVRTPAYKRGRTEADILGLA
FT                   KGKRPPPSEYLKKSYIDKHLKVFKEEGGAFLFTTDDIANPNYTSFNPNKFVMAKSDLNS
FT                   VVAEYKRTGDVSVLESALGYDPGSLAGKEIYMLNLENPKVLMPTGNEGGVNSLWRPGGL
FT                   THPGGMREAVLDNVAIPHGNDVNVLMSTHDIARIQ"
FT   gene            complement(184628..185062)
FT                   /locus_tag="PSPA7_0168"
FT   CDS_pept        complement(184628..185062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0168"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84219"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXM9"
FT                   /protein_id="ABR84219.1"
FT                   /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDAS
FT                   QGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVF
FT                   IERRPAVLITTLTTTPGDLPHHEPAWKQAMQTLVPRPAGH"
FT   gene            185315..187540
FT                   /locus_tag="PSPA7_0169"
FT   CDS_pept        185315..187540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0169"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04524; match to protein family HMM PF06715; match to
FT                   protein family HMM TIGR01646; match to protein family HMM
FT                   TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81056"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN0"
FT                   /protein_id="ABR81056.1"
FT                   /translation="MALAQQTRLVRVDSPLGADVLQLQRMEGREELGRPFAYELELISE
FT                   DPDLQLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLT
FT                   RTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLME
FT                   QEGIYYWFRHEQSRHILVLSDAYGAHRSPPGYASVPYYPPTLEQRERDHFYDWHMAREV
FT                   QSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEA
FT                   LQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVG
FT                   AQFESELDCIDGGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDR
FT                   HDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQT
FT                   VPYELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDETH
FT                   WVGHDRSKTIDHDETVHVKHDRTETVDNNETLTIGVDRTEKVGNNEKISIGANRTEDVG
FT                   SNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADR
FT                   SESVGANESIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLV
FT                   TGAASIRMKKDGSIVISGKNITIDGSGAINIKADKNVVMKGRKILQN"
FT   gene            187569..188018
FT                   /locus_tag="PSPA7_0170"
FT   CDS_pept        187569..188018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0170"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83649"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN1"
FT                   /protein_id="ABR83649.1"
FT                   /translation="MSVEIHLPGPASALPARLDGVVIGILLDVPDAAAPVVAYPGCPNE
FT                   HGLAAATTTQLGRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEASAQLDGERLEFSAE
FT                   REIVLRCGKASITLTRAGKVIIRGAYLSSRSTGVNRIKGGSVQIN"
FT   gene            188035..189147
FT                   /locus_tag="PSPA7_0171"
FT   CDS_pept        188035..189147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0171"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82286"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN2"
FT                   /protein_id="ABR82286.1"
FT                   /translation="MELLNATPLAAAYNQGLDAAGRESLVVIAKGSFDLPLDGREARLL
FT                   DEQQALLMMDEFFGEPGLSAPRRECDFVPFKPFCDVLVLGSAQAPGGRPVQQLTAGIRV
FT                   GRVGKALTVHGPRQWEPGLLGAGAGVAQPFQRQDISYASAFGGSHASPDNPGFMDCYMA
FT                   NPAGRGWFPRSADTAEIVGTPMPATEKPGEPVDSPHGRFTPMALGPLGRHWQARVGFAG
FT                   RYDETWLAEQFPFLPADFDERYFQSAPSDQWTDYLRGGEEVLLLNLTGEERAAFRVPRR
FT                   EVPVTFFLKKGGHETAQARIDTLLVDCDARRVEITWRIRRPLRRNLFEIAQVLVGTMSS
FT                   AWWRARELGKDYHPSLAALVRSRQAEEDEA"
FT   gene            189144..190181
FT                   /locus_tag="PSPA7_0172"
FT   CDS_pept        189144..190181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0172"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84029"
FT                   /db_xref="GOA:A6UXN3"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN3"
FT                   /protein_id="ABR84029.1"
FT                   /translation="MSQPLSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGGE
FT                   WLLAASVPLEQPWRGRAKLLKMAARAIDEALRGQPGLDCAELPLLLCVAEGDRPGRCAG
FT                   LDESFLRDLENELGRRFHPSSALIARGRVGGAVALLNARKLVQGGCRQVLLAGVDSFLN
FT                   GPTLAAYEARERLLSSQNSNGFIPGEGAAAVLVAAPLHEEAPQLLCIGLGFGLEKATVE
FT                   SEDLPLRADGLTQAVRAALAEAGCGLEQMDYRLTDISGEQYYFKEASLTLSRNLRVLKP
FT                   KFDLWHPADCIGECGAAIGPALLAVALAASRKGYGDGPNVFCHLGNDAGERAAALLSYR
FT                   RVRAA"
FT   gene            190181..191344
FT                   /locus_tag="PSPA7_0173"
FT   CDS_pept        190181..191344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0173"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86745"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR028917"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN4"
FT                   /protein_id="ABR86745.1"
FT                   /translation="MANEVYANDMEISCKAASGKSIAAFPDVCFTPPQAPPTPMGVPIP
FT                   YPNTGLAKDTTKGTRTVRITRKEVMLKNKSYFKTSYGDEAGRAPKKGVITSKIKGKVYF
FT                   TSWSMNVKFESKNVVRHMDLTTHNHGSQPGNTMTWTYADRMAYAKGLSQCDDERTRAKD
FT                   ACGDTSKKVVCPDISALKKASAARAAAKKKAGDKFKDNADYQSRHQEVQREFSALAEKI
FT                   NNDPCQKALRCFLAPYRPNRCCPGQTGDHLVDAASFGPRKGKKITGWSKYQTNKAPCIC
FT                   AEGPNQTTATHGQLHTRRGVVALHEQDDKGEWPRGRATQVGAKAARKTFPDSNCSQECL
FT                   EAQLNKYHDTAKDDGTEKPIKANASMTSDVGERAAARAEMFEQVTLR"
FT   gene            191358..192281
FT                   /locus_tag="PSPA7_0174"
FT   CDS_pept        191358..192281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0174"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81400"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN5"
FT                   /protein_id="ABR81400.2"
FT                   /translation="MDANDRRFSGFSLSTGVLRYSDLAYLLATSDEDIQEGLVGTLLFT
FT                   IDRGTPGAASLDWLACSGTVCHLPSERYVALGVQGQVRVMGGGSQSDESISNSGRDPRS
FT                   RGPLREVRGVARGRAYAVGTCRQAYVREDEGVWRCIDQTAQGGDVALTDTSFESIDGFS
FT                   EQEIYTVGWEGEIWSYDGSVFTQASSPTNLALYKVRCAGDGYAYACGQLGTLLRGRGDK
FT                   WEIIEHESTREDLWGMEYFDGHLYVSSTHFVYRLVDGRLERVDFGDDVPASCYHLSAAD
FT                   GIMWSVGAKDVMEFDGQSWKRILEIQ"
FT   gene            192293..193540
FT                   /locus_tag="PSPA7_0175"
FT   CDS_pept        192293..193540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0175"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81919"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN6"
FT                   /protein_id="ABR81919.2"
FT                   /translation="MPRMSLPIVSMLDQHAEEAAFLALLRDYAVCAPHYDLEELAELDQ
FT                   RIEAHLDGLSIAGQAGYEALFEQLDAHAQGEAFALAALAMQAGDEAVIGRMRACLAESR
FT                   EARRGFAAALGWLDWERVQPWVERLLASPEPLFRSLGLAACGMHRQDPGPALLSALGHA
FT                   DPAVLARAARTAGELRRRDLMADIRAYRAHDDPSLCFWANWATAQMGDEEALGPLRAFA
FT                   GQPGPFQLPATMVLLAWQPRDTSMAWIRQLMQAAETRRIGIQATGLFGDPVAVPWLIQQ
FT                   MRDESLARVAGEAFSLITGADLALLDLELEVLPDHDPGPNDDPDDENVALDDDENLTWP
FT                   EAERVSAWWRDNGARFVAGRAYLLGEPLGEARCREVLRDGQQRQRMAAACLLARFVPGL
FT                   PLFPTSAPVRRQLALF"
FT   gene            193915..194643
FT                   /locus_tag="PSPA7_0176"
FT   CDS_pept        193915..194643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0176"
FT                   /product="putative carbonic anhydrase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86248"
FT                   /db_xref="GOA:A6UXN7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN7"
FT                   /protein_id="ABR86248.1"
FT                   /translation="MPDRMRGVKTDSQEQESADDALKRIVDGFQHFRREVFPEQQELFK
FT                   KLAKSQRPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEY
FT                   AVLALGVHHIIVCGHSDCGAMRAVLDPQTLERMPTVKAWLRHAEVARTVVADNCDCGAN
FT                   HDTLGVLTEENVVAQLDHLRTHPSVASRLASGQLFIHGWVYDIESAQIRAYDAKQGRFL
FT                   PLDGEHPVPMATPAPRYLNQ"
FT   gene            194853..196424
FT                   /locus_tag="PSPA7_0178"
FT   CDS_pept        194853..196424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0178"
FT                   /product="putative sulfate transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00860; match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83613"
FT                   /db_xref="GOA:A6UXN8"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN8"
FT                   /protein_id="ABR83613.1"
FT                   /translation="MHVSKVFPSLRDTLPRDLMASVVVFLVALPLCMGIAIASGMPPAK
FT                   GLLTGIVGGLVVGFLAGSPLQVSGPAAGLAVLVFELVRTYGVAMLGPILLLAGAIQLVA
FT                   GRLRLGCWFRVTSPAVVYGMLAGIGILIVLSQLHVMLDLAPKASGLDNLLAFPQAAFAA
FT                   LGSLGMDSGLDAALLGLGTIAVMWGWDKLRPQRLRFLPGALLGVSLATLASLWLALDVR
FT                   RVEVPANLGEAIDWLRPADLLALADPSLLLAAVVVAFIASAETLLSAAAVDRLHDGPRS
FT                   DMDRELSAQGVGNMLCGLLGALPMTGVIVRSSANVNAGARTRASAIFHGLWLLAFVLLL
FT                   GSLLRQIPVASLAGVLVYTGIKLVDFKALGNLGRYGRMPMLVYAATALAIVFTDLLTGV
FT                   LVGFALTLLKLVLKAARLKIVLRYTGEHEAELRLSGAATFLKVPALSRMLDQVKPGTTL
FT                   HVPMDNLSYVDHACMELLEDWGRMAPVQGSRLVIEPRALKRRLEGRLRSNAGLGGARSG
FT                   GAVSPG"
FT   gene            complement(196411..197049)
FT                   /locus_tag="PSPA7_0177"
FT   CDS_pept        complement(196411..197049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0177"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81363"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXN9"
FT                   /protein_id="ABR81363.1"
FT                   /translation="MNTAALRELIQQAHLSEARHGYLADLIASRLPHLHRTIRPQGENT
FT                   EDILTRFVHAYVEQVPDLLDAANSVAREAGIEDRIKPVLKVAEQFFLTPPALLAGHDGL
FT                   DALLDEAYLAHRLVEEVNDRYIAHFGQALIPLDTTVANLVAHQLIGEPFANQLDEAVRH
FT                   ALEHMLDADTFDAESARAYRENLKNPRVVAAWQQWPCLSRQLGVELSLG"
FT   gene            197421..198545
FT                   /locus_tag="PSPA7_0180"
FT   CDS_pept        197421..198545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0180"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86131"
FT                   /db_xref="GOA:A6UXP1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP1"
FT                   /protein_id="ABR86131.2"
FT                   /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHMT
FT                   IFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAVPA
FT                   TRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQEQIRNQQAKDEHYL
FT                   LEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPGIYRG
FT                   QCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVARGDKV
FT                   YHTICAACHQAEGQGMPPMFPALKGSKVVTGPKEHHLEVVFNGVAGTAMAAFGKQLNEV
FT                   DLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
FT   gene            198555..200147
FT                   /gene="ctaD"
FT                   /locus_tag="PSPA7_0181"
FT   CDS_pept        198555..200147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="PSPA7_0181"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00115; match to protein family HMM TIGR02891"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81025"
FT                   /db_xref="GOA:A6UXP2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP2"
FT                   /protein_id="ABR81025.1"
FT                   /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSFM
FT                   MFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPL
FT                   MIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHSVTF
FT                   FIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   VVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAIIPTFAR
FT                   KPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTGVKVFNW
FT                   VTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFVGMNLAFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRSGKPAPAKPWDGAEGLEWSIPSP
FT                   APYHTFSTPPEVK"
FT   gene            200158..200712
FT                   /locus_tag="PSPA7_0182"
FT   CDS_pept        200158..200712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0182"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04442"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82071"
FT                   /db_xref="GOA:A6UXP3"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP3"
FT                   /protein_id="ABR82071.1"
FT                   /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPIYDVMCRALGINGK
FT                   TAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARNPS
FT                   DKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDVRHV
FT                   TLAYTLFDITARNPPVPVAGR"
FT   gene            200723..201610
FT                   /gene="coIII"
FT                   /locus_tag="PSPA7_0183"
FT   CDS_pept        200723..201610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coIII"
FT                   /locus_tag="PSPA7_0183"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86392"
FT                   /db_xref="GOA:A6UXP4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP4"
FT                   /protein_id="ABR86392.1"
FT                   /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHEESH
FT                   GPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAAFF
FT                   GALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWKLPL
FT                   INTILLVTSSFTVTFAHHALKKNRRGPLKAWLALTVLLGIAFLILQAEEYVHAYNELGL
FT                   TLGAGIYGSTFFMLTGFHGAHVTLGALILGIMLIRILRGHFDAEHHFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVI"
FT   gene            complement(201626..201835)
FT                   /locus_tag="PSPA7_0184"
FT   CDS_pept        complement(201626..201835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0184"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84499"
FT                   /db_xref="GOA:A6UXP5"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP5"
FT                   /protein_id="ABR84499.1"
FT                   /translation="MLKVAIVLLLLATLVSLFSGLFFLVRDQGHGSRVVNSLTVRVVLA
FT                   AATLALIAWGFYSGELNSHAPWHF"
FT   gene            201851..202645
FT                   /locus_tag="PSPA7_0185"
FT   CDS_pept        201851..202645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0185"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83714"
FT                   /db_xref="GOA:A6UXP6"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP6"
FT                   /protein_id="ABR83714.2"
FT                   /translation="MGGFMQYSQRLAEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLLW
FT                   LGTWQLQRADEKRALLASYEARRDADPLSPGQLEDLRDPAYVRVRLHGRFDERHTLLLD
FT                   NRLRNGQAGVEVLQPFYDQASGLWLLVNRGWVPWSDRRSPPTLETPDRVLLLDAWTYLP
FT                   PPGGLHLADAPAVGWPRLVTQLEIPALWRDFGRAGLPWEIRLEPGDGSFDTDWPLVSMP
FT                   PERHTGYAAQWFALAAALLALYLYLGVRRAREKNHESRDSDA"
FT   gene            202620..203198
FT                   /locus_tag="PSPA7_0186"
FT   CDS_pept        202620..203198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0186"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84120"
FT                   /db_xref="GOA:A6UXP7"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP7"
FT                   /protein_id="ABR84120.1"
FT                   /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWVP
FT                   QGRSYSGALIGNGQTPADLGVQGRSQGEPWQLLVTAPGTCGEDCQQLVYLARQVNIALG
FT                   REASRAGHALAASGELPADFANLVKLDYPRLQRYGLDPALYDKAGGGERPLLWVVDPHG
FT                   NLVLRYDAKANGKKLLKDVQLLLKLSHIG"
FT   gene            203263..204336
FT                   /locus_tag="PSPA7_0187"
FT   CDS_pept        203263..204336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0187"
FT                   /product="membrane protein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81026"
FT                   /db_xref="GOA:A6UXP8"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXP8"
FT                   /protein_id="ABR81026.1"
FT                   /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPGC
FT                   YGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVRRG
FT                   RDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALRLSG
FT                   RFAARRYPAATRGLAGLALLLVIGQITLGGWVSSNYAAVACIDLPTCHGEWWPRMDFAN
FT                   GFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVWPTALM
FT                   LLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRAPAPSPQ
FT                   RVRRTLPPAQGSRLKAA"
FT   gene            204362..205276
FT                   /gene="cyoE2"
FT                   /locus_tag="PSPA7_0188"
FT   CDS_pept        204362..205276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE2"
FT                   /locus_tag="PSPA7_0188"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84840"
FT                   /db_xref="GOA:A6UXP9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UXP9"
FT                   /protein_id="ABR84840.1"
FT                   /translation="MATVIDRHSQPTWRDFLELTKPKVVVLMLITSLIGMLLATKAPLD
FT                   GFVPWQVLIFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPLAEGRVSPSMALGFA
FT                   LLLALAGMAVLLAFTNPLTAWLTLASLLGYAALYTGFLKRATPQNIVIGGLAGAAPPLL
FT                   GWVAITGHLSAEPLLLVLIIFAWTPPHFWALCIHRKDEYAKADIPMLPVTHGERYTKLH
FT                   ILLYTLVLFAVSLMPFVIHMSGLVYLLCALALGARFLDWAWALYCDSRPHAAIRTFKYS
FT                   IVYLFLLFMALLVDHYLPLKLLL"
FT   gene            205302..205937
FT                   /locus_tag="PSPA7_0189"
FT   CDS_pept        205302..205937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0189"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86039"
FT                   /db_xref="GOA:A6UXQ0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ0"
FT                   /protein_id="ABR86039.1"
FT                   /translation="MTRVNKTALVLAALVALVLGLTVHKVLTAQRQADPTVLLDAGIVI
FT                   LPQTRKVPALEFTNQDGQAVGTDSLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKLPQ
FT                   EVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANALSIPYIPAD
FT                   TSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
FT   gene            complement(205969..206421)
FT                   /locus_tag="PSPA7_0190"
FT   CDS_pept        complement(205969..206421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0190"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84155"
FT                   /db_xref="GOA:A6UXQ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ1"
FT                   /protein_id="ABR84155.1"
FT                   /translation="MSLDWTCKHHADLTLKELYALLQLRTEVFVVEQKCPYQEVDGLDL
FT                   VGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGRVVSSSAARGQGLGHQLMERALQAA
FT                   ERLWLDTPVYLSAQAHLQAYYGRYGFVPVTEVYLEDDIPHIGMRRA"
FT   gene            206553..207026
FT                   /locus_tag="PSPA7_0191"
FT   CDS_pept        206553..207026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0191"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81268"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ2"
FT                   /protein_id="ABR81268.1"
FT                   /translation="MRWEELSEQPCSLARVLAIVGDRWTLLVLRDCFLGIRRFDDFERS
FT                   LGVTRHVLADRLKRLVEAEILAKSPYQEKPLREEYRLTEKGMELYPTILSLVNWGDRHL
FT                   AGVEGPPLEHVHKRCGQHMHGVLVCSECGEPLHARDVTVREGLFWRGRLLRRG"
FT   gene            207379..208107
FT                   /locus_tag="PSPA7_0192"
FT   CDS_pept        207379..208107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0192"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00106; match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83142"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ3"
FT                   /protein_id="ABR83142.1"
FT                   /translation="MTQRKAVLVMGAGDATGGAIARRFAREGYVACVARRNAEKLEPLV
FT                   QAIRDQGGEALACACDARQEQQVIDLFARIEREVGPLEAVIFNVGANVWFPITETTERV
FT                   YRKVWEMAAFGGFLSGREAARVMLPRQRGTIIFTGATASLRGRAHFAAFSGAKFALRAL
FT                   AQSMARELGPKGIHVAHPIIDGAIDTDFIRETLPELYKRKEQDGILDPEHIAETYWQIH
FT                   CQPRDCWVHELDLRPWTETF"
FT   gene            208132..208719
FT                   /locus_tag="PSPA7_0193"
FT   CDS_pept        208132..208719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0193"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83426"
FT                   /db_xref="GOA:A6UXQ4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ4"
FT                   /protein_id="ABR83426.1"
FT                   /translation="MNKQIEFFFDVGSPTTYLAWTQLPRIAAERGATIAWRPMLLGGVF
FT                   KATGNHSPIEVPAKGRYTLHDLARHAQRYGVPLAFNPAFPINTLTLMRGAQGYLGGEGF
FT                   HPYLKAVFEALWVRQQNLGKPEVVAQVLAEAGFDPDEFLRLVGDEQVKEGLKATTEEAV
FT                   RRGVFGAPSFFVGDQLFFGQDRLDFVAEALAG"
FT   gene            208964..210298
FT                   /locus_tag="PSPA7_0194"
FT   CDS_pept        208964..210298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0194"
FT                   /product="putative dicarboxylate transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81852"
FT                   /db_xref="GOA:A6UXQ5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UXQ5"
FT                   /protein_id="ABR81852.1"
FT                   /translation="MFIKRCSRSIFLQVVIGLVIGVLCGVGIPDLAVQMKPLGDGFIKL
FT                   IKMLIALIVFCVVVNGISGAGDLKKVGRIGLKSVIYFEILTTIALVLGLVVAYSLGLGS
FT                   GANIHLNELPAGDIALYTGRTQEIHGPVAFLMGLIPTSVFSAFAENDILQVLLFSVLFG
FT                   SALNLVGEQASGVARLINEFSHIVFRIMGMIVRLAPLGVFGAVAFTTARYGVDSLSHLG
FT                   ALVLVFYATCLVFVMAVLGSVLRLSGVRMLPFLRYFREELLIVMGTASSDAVLPQVMRK
FT                   LEHMGIRSSTVGLVIPTGYSFNLDGFSIYLTLAVVFIAHVTGTPLAMTDLLTILLVSLV
FT                   TSKGAHGIPGSALVILAATLTAVPAIPVAGLVLVLSVDWFMGIGRALTNLIGNCVATVT
FT                   IARWENDIDLPRAQAILDGRLEAPTRTGGEPLERGVVAGEGKLQG"
FT   gene            210347..211033
FT                   /locus_tag="PSPA7_0195"
FT   CDS_pept        210347..211033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0195"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00392; match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84135"
FT                   /db_xref="GOA:A6UXQ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ6"
FT                   /protein_id="ABR84135.1"
FT                   /translation="MFSSSKLVNAVAQRLLDTIEQGRWVAGQMLPGQRELAEQMEISRP
FT                   SLREAIMVLETLGVVRSMPGKGVMVLERSEPLREVAAPGEATMEDVLQLRYALEPFIVG
FT                   IVAQSAGAAEISELRLLLLDLREAVEDGAAQAVVEAYTAFHRRLVKLTSNPIFLSVSEQ
FT                   IGSALERSDNLVRRQPEYAEEILQEHEAILRAIRQHDSERASQAMRQHILNEGARLNID
FT                   LRLPQG"
FT   gene            211134..211868
FT                   /locus_tag="PSPA7_0196"
FT   CDS_pept        211134..211868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0196"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85123"
FT                   /db_xref="GOA:A6UXQ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ7"
FT                   /protein_id="ABR85123.1"
FT                   /translation="MVGFEARTPQGAALRPTSHFVYESIYTAILEKRLAPAAKLSKETL
FT                   GQIFRVSNGTIQRALTRLAEDGAVVMAPKEVASVARPDERQARQVLEARLLVESEVLRQ
FT                   LRKGVDATTLDELRALVDEEQACLEARDSAGVIRLAGRFHLRLAECTENPLLLGFVRGL
FT                   VARASLDIALNKGAVYSVEACVAQRGLLDALEAGDSVAATELMDEYLRGLFARMRFLPP
FT                   PTTDLRKAFGMSARRQDKRQEA"
FT   gene            212047..212436
FT                   /locus_tag="PSPA7_0197"
FT   CDS_pept        212047..212436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0197"
FT                   /product="aegerolysin superfamily"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82829"
FT                   /db_xref="GOA:A6UXQ8"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ8"
FT                   /protein_id="ABR82829.2"
FT                   /translation="MAYAEWIAVKVVVSNSIGTAGIRNATLQWGMFCRCSNRDDEISAE
FT                   KDSSMNVQAGSPQWIASCGRENAASGTRGCFDCHDGNTKMGTFSWDDPRKSGATQTRHF
FT                   TPASQNYAGISSGGNATGAASARSP"
FT   gene            complement(212503..213393)
FT                   /locus_tag="PSPA7_0198"
FT   CDS_pept        complement(212503..213393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0198"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83352"
FT                   /db_xref="GOA:A6UXQ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXQ9"
FT                   /protein_id="ABR83352.1"
FT                   /translation="MDSLKGMAIFATVVDKGSMAAAAESLGLTPSAVSQQIRRLESRAQ
FT                   VTLLHRTTRRLTLTEAGEAFYRSCAQMLAIAEEAERRLGEWRDAPVGELRLAAPVGLSG
FT                   SLITQALKPLLEDHRQLRLQLFFQDERIDLVAERIDLAIRVGNLADSSLVARHLGDWNH
FT                   ILCAAPGYLRQRAPLKRPEQLLELDWIALNTASQFNLLTLTGADGEVCKLRLEPRVAAN
FT                   GMLAVRQFTLDGLGVSCQPLPEVREALDAGRLQRLLPEWKLPDLGIHAVTPRRDAQPAK
FT                   VKVAIEALRRAFATG"
FT   gene            complement(213690..213971)
FT                   /locus_tag="PSPA7_0200"
FT   CDS_pept        complement(213690..213971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0200"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR1"
FT                   /protein_id="ABR82386.1"
FT                   /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQE
FT                   VANQGAGRPSEVPGVRTLALERWPFSAPFRVKGKEIQILRIDRVEITP"
FT   gene            complement(213968..214195)
FT                   /locus_tag="PSPA7_0201"
FT   CDS_pept        complement(213968..214195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0201"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81763"
FT                   /db_xref="GOA:A6UXR2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR036535"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR2"
FT                   /protein_id="ABR81763.1"
FT                   /translation="MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQW
FT                   QVAAIDEGLADANAGRLLEHTEIEKRWGLQ"
FT   gene            complement(214371..214991)
FT                   /locus_tag="PSPA7_0202"
FT   CDS_pept        complement(214371..214991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0202"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83306"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR3"
FT                   /protein_id="ABR83306.1"
FT                   /translation="MPTRVLRGLVAALPLFLAACSDPAPSSEEIARLLTERGFDKPACA
FT                   SSTLFKAFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLQRDGDTYALTPAGREDYKPES
FT                   KAFCYSSGFDVSVRSVDPAKPDDHGPAVEKGWLVTVEVRPRGVKDWAKNPEVLKQASLT
FT                   TLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
FT   gene            215092..215592
FT                   /locus_tag="PSPA7_0203"
FT   CDS_pept        215092..215592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0203"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83634"
FT                   /db_xref="GOA:A6UXR4"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR4"
FT                   /protein_id="ABR83634.1"
FT                   /translation="MRLPANLGRLLPALCLGVLLSACSTFGQRDPLRIDLVGLEPLPGQ
FT                   GMEMRFMVKLRVQNPNDEPIEYNGIALDLDVNGQPLASGVSDQAGEVPRFGERVVSVPL
FT                   TVSAFSAFRQAWGLSNNAPTQGMPYVVKGKLAGGLFGTVRFSEKGTLDFPGPAVGVPKT
FT                   KGL"
FT   gene            215665..216006
FT                   /locus_tag="PSPA7_0204"
FT   CDS_pept        215665..216006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0204"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03831; match to protein family HMM PF08274; match to
FT                   protein family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86035"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR5"
FT                   /protein_id="ABR86035.1"
FT                   /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKV
FT                   IKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMK
FT                   LKSEFVRKV"
FT   gene            complement(216126..217553)
FT                   /gene="gabP"
FT                   /locus_tag="PSPA7_0205"
FT   CDS_pept        complement(216126..217553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabP"
FT                   /locus_tag="PSPA7_0205"
FT                   /product="GABA permease"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00324; match to protein family HMM PF03845; match to
FT                   protein family HMM TIGR01773"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82970"
FT                   /db_xref="GOA:A6UXR6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR6"
FT                   /protein_id="ABR82970.1"
FT                   /translation="MSKVVLASQLPDKRNASLAPGLKQRHVTMLSIAGVIGAGLFVGSG
FT                   HAIAAAGPAALLAYLIAGTLVVLVMRMLGEMAVASPDTGSFSTYADRSIGRWAGFTIGW
FT                   LYWWFWVLVIPLEAIAAAAILNAWFPAIDTWIFALAVTFLLTVTNLFSVARYGEFEFWF
FT                   ALLKVIAIIAFIVLGAVAIVGGLPEREVSGLSSLMASHGGFVPNGYGAVLGALLTTMFS
FT                   FMGTEIVTIAAAESKDPAKQITRATNSVIWRIGLFYLVSIFIVISIVPWNDPLLIQVGS
FT                   YQRALELLDIPHAKLIVDLVVLVAVASCLNSAIYTSSRMVFSLARRGDAPSVLKLTNTA
FT                   HVPRPAVLASTAVGFLTTIVNYFAPEKVFTFLLASSGAVALLVYLVIAVAQLRMRKQLQ
FT                   ASGQPIEFRMWLYPWLTWAVILFIVAALSIMLVMPEHRHEVFATALLTIFTVCLGLLNA
FT                   RRKPRLGEDYAGKTARV"
FT   gene            complement(217722..219215)
FT                   /gene="mmsA3"
FT                   /locus_tag="PSPA7_0206"
FT   CDS_pept        complement(217722..219215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA3"
FT                   /locus_tag="PSPA7_0206"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00171; match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81903"
FT                   /db_xref="GOA:A6UXR7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR7"
FT                   /protein_id="ABR81903.1"
FT                   /translation="MGMLQHLINGELVADSGRSADVFNPSTGEAIHKVPLADGKTLQKA
FT                   IDAAKAAFPAWRNTPPAKRAQVLYRFKQLLEQNEARISKLISEEHGKTLEDAAGELKRG
FT                   IENVEYACAAPEILKGEYSRNVGPNIDAWSDFQPIGVVAGITPFNFPAMVPLWMYPLAI
FT                   ACGNTFILKPSERDPSSTLLIAELFHEAGLPKGVLNVVHGDKDAVDGLIQAPEVKAISF
FT                   VGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSCGERCM
FT                   AISVAVCVGDQVADALIAKLVPQIKALKIGAGTSCGLDMGPLVTAAAQAKVTGYIDSGV
FT                   AQGAELVVDGRGYQVAGHENGFFLGGSLFDRVTPEMTIYKEEIFGPVLCVVRVNSLEEA
FT                   MQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFGGWKRSLFG
FT                   DLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
FT   gene            complement(219296..219583)
FT                   /locus_tag="PSPA7_0207"
FT   CDS_pept        complement(219296..219583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0207"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86902"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR8"
FT                   /protein_id="ABR86902.1"
FT                   /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVPM
FT                   TDGTLLLETAEGDRHAPLVAGQAYFRKAGVEHNVVNASAHEVVFIETEIK"
FT   gene            complement(219583..220929)
FT                   /locus_tag="PSPA7_0208"
FT   CDS_pept        complement(219583..220929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0208"
FT                   /product="beta-alanine--pyruvate transaminase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86284"
FT                   /db_xref="GOA:A6UXR9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXR9"
FT                   /protein_id="ABR86284.1"
FT                   /translation="MNQPLNVAPPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSWL
FT                   TDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIA
FT                   QLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAGTSL
FT                   GGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDASNIAA
FT                   VIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTP
FT                   DLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVACAAGLA
FT                   ALDILARDNLVQQSAELAPHFEKVLHGLQGAKNVIDIRNCGLAGAIQIAPRDGDPTVRP
FT                   FEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALDGIA"
FT   gene            221065..221982
FT                   /locus_tag="PSPA7_0209"
FT   CDS_pept        221065..221982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0209"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82262"
FT                   /db_xref="GOA:A6UXS0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS0"
FT                   /protein_id="ABR82262.1"
FT                   /translation="MGKSRNPSLGQVSDFDIRLLRIFKTIVECGSFSAAESTLGLSRSA
FT                   ISLHMGDLEKRLGMRLCQRGRAGFALTDEGREVYRATQTLLAALEGFRAEVNDLHQHLR
FT                   GELNIGIINNLVTLPQMRITHALSTLKGQGPQVRINIGMTTPNEIELGVLDGHLHVGVV
FT                   PLISPLSGLEYLPLYDEHAQLYCSRGHPLFERADGDIAVDQVLAADAVAPSYRLPAEAQ
FT                   ARHQELNNSASASDREGMAFLILTGNFIGYLPSHYAADWVAAGMLRPLLPERFHYAIAL
FT                   TIVTRKGRRPNLVLERFLEAVAVS"
FT   gene            complement(222088..223386)
FT                   /gene="guaD2"
FT                   /locus_tag="PSPA7_0210"
FT   CDS_pept        complement(222088..223386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaD2"
FT                   /locus_tag="PSPA7_0210"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01979; match to protein family HMM PF07969; match to
FT                   protein family HMM TIGR02967; match to protein family HMM
FT                   TIGR03179"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80795"
FT                   /db_xref="GOA:A6UXS1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS1"
FT                   /protein_id="ABR80795.1"
FT                   /translation="MSSSAHRGRILHFLGDPAKLGDKAWEYFDDGLLWIEHGQVRALDH
FT                   AAYLLPRLPAGLALEEHPGRLLLPGFVDCHVHYPQLGVVASYGTQLLDWLEAHTYPAEQ
FT                   RFADAGYATVQAELFLDELLRHGTTTALVFGTVHAVSAEAFFQAAQKRRLRMIAGKVLM
FT                   DRNAPPALCDTAASGYAESRALIERWHGNGRLQYAVTPRFAPTSSPGQLAAAARLLDEY
FT                   PGVYLHSHLSENLKEVAWVGELFPQAQDYLDVYHRAGLVGERSVFAHGIHLSERECRCL
FT                   AHKNAALAHCPSSNLFMGSGLFDLGRAQQYGIRVGIGSDLGGGTSLSLLANLADAYKIQ
FT                   QLRGASLDPFQALYLATLGGARTLGLDGLIGNFLPGREADFVALDLAATPMIAQRMEHA
FT                   RGLADTLFVLNTLGDDRAVAATWVLGERRHAKG"
FT   gene            224616..226187
FT                   /locus_tag="PSPA7_0213"
FT   CDS_pept        224616..226187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0213"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82589"
FT                   /db_xref="GOA:A6UXS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS4"
FT                   /protein_id="ABR82589.1"
FT                   /translation="MTTVSSPAPPRLELRGISKRYPGCLANDRIDLRIDAGEIHALLGE
FT                   NGAGKSTLMKIIYGVTRPDAGEILWQGEPVRVRDPAGARALGIGMVFQHFSLFETLSVA
FT                   QNIALALGTEAGGPRRLEARIREVSQRYGMPLEPRRLVHGLSIGERQRVEIVRCLMQDI
FT                   RLLILDEPTSVLTPREAEDLFVILRRLAEEGCSVLFISHKLAEVRALCRRATVLRGGRV
FT                   AGQCLPAQCSDLELARLMVGDAEGLAAEYPKVAGGAPFLQVRDLYWRNPDPFGVSFAGL
FT                   DLEVRSGEILGIAGVAGNGQDELLALLSGEVRLPRVQAGRIRLGGTAGGHLAADARRRA
FT                   GQAFVPAERLGHGAVPEMSLADNTLLSAFQRGLVKRGLVRRRKVLALAEEIIRRFAVKT
FT                   PGAGAPARSLSGGNLQKFILGREILQSPRLLVAAHPTWGVDVGAAALIHRALIALRDAG
FT                   TAILVVSEDLDELFLLSDRIAALCSGRLSPAVATASASPQQVGGWMAGQFEAPAAVAGA
FT                   VAQGSL"
FT   gene            226187..227284
FT                   /locus_tag="PSPA7_0214"
FT   CDS_pept        226187..227284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0214"
FT                   /product="ABC transporter, permease protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83305"
FT                   /db_xref="GOA:A6UXS5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS5"
FT                   /protein_id="ABR83305.1"
FT                   /translation="MLLSLEPRGRQSRWILLASPLLAGLLTLVCGALLFAGLGHDPWQA
FT                   LHTVLVQPVSDLYGIGELLVKAMPILLCALGLALAYQARVWNIGAEGQLLIGALAGSAV
FT                   AIQLLDWQSRWALAGVLLAGSAAGAFWAGLAAWLRTRFNANEILTTIMLNYIALNLLLY
FT                   GVHGPLKDPEGFNFPQSALFGEASRLPALFEDSRVHFGALFGLLALAAVWVLAQRSFLG
FT                   FQVRVLGLDRRAAGFAGFREKRLVWFVLLFSGALAGLAGVCEVAGPIGQLVPQVSPGYG
FT                   YAAITVAFLGRLNPFGILAASLLMALLYLGGEAAQMSLNLPLALTGLFQGMMLFFLLAC
FT                   DVLILYRPRLHGHWRKRPALRDALA"
FT   gene            227308..228234
FT                   /locus_tag="PSPA7_0215"
FT   CDS_pept        227308..228234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0215"
FT                   /product="putative permease of ABC transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80749"
FT                   /db_xref="GOA:A6UXS6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS6"
FT                   /protein_id="ABR80749.1"
FT                   /translation="MDIDLLNNLLFAMVRTGTPLLLVALGELVCERSGVLNLGQEGMML
FT                   FGAVIGFMVAFSSGSLWLGVLLAVLAGMLLAALFAGVALYLNANQVACGLALTIFGVGL
FT                   SSFVGAAWVGKPLQGFAPLALPVLGELPLLGRMLFAQDALVYLSLALFAAVAWMLLRSR
FT                   AGLVLQAVGENPDAASAMGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMTAG
FT                   RGWIALALVVFASWRVFRVLLGAWLFGLASILHLVAQGVGLAIPANLLAMLPYVATILV
FT                   LVLLSRDALRTRLYAPVSLGQPWKAGL"
FT   gene            228400..228963
FT                   /gene="ahpC"
FT                   /locus_tag="PSPA7_0216"
FT   CDS_pept        228400..228963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PSPA7_0216"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00578; match to protein family HMM PF08534; match to
FT                   protein family HMM TIGR03137"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84013"
FT                   /db_xref="GOA:A6UXS7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS7"
FT                   /protein_id="ABR84013.1"
FT                   /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTF
FT                   NCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQL
FT                   TNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPG
FT                   EVCPAKWKEGEKTLAPSLDLVGKI"
FT   gene            229109..230674
FT                   /gene="ahpF"
FT                   /locus_tag="PSPA7_0217"
FT   CDS_pept        229109..230674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PSPA7_0217"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /EC_number="1.8.1.-"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00070; match to protein family HMM PF07992; match to
FT                   protein family HMM TIGR03140"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84593"
FT                   /db_xref="GOA:A6UXS8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS8"
FT                   /protein_id="ABR84593.1"
FT                   /translation="MLDANLKAQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVG
FT                   LTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLD
FT                   AEVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVE
FT                   ARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTAREAFDVLVVGGGPA
FT                   GAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRHYEV
FT                   DIMNLQRASKLVPAKNAGELHEVQFESGGSLKARSLILATGARWREMGVPGEQEYKAKG
FT                   VCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKL
FT                   YSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLK
FT                   GSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRT
FT                   SAPE"
FT   gene            complement(230748..231821)
FT                   /locus_tag="PSPA7_0218"
FT   CDS_pept        complement(230748..231821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0218"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85790"
FT                   /db_xref="GOA:A6UXS9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXS9"
FT                   /protein_id="ABR85790.1"
FT                   /translation="MSEEPTVSPPSAEQPAAQPAKPARPAARRAPRKPATRRPRVASPA
FT                   QKAREEIQAISQKPVALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQI
FT                   ELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQ
FT                   WYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLTNSG
FT                   ILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDT
FT                   ADAPWTVIKSDDKKRARLNCIRHFLHALDYPGKDRRIAHEPDPLLVGPASRVIEEDEKV
FT                   YAEAAAAPGHANLDIPA"
FT   gene            232099..233448
FT                   /locus_tag="PSPA7_0219"
FT   CDS_pept        232099..233448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0219"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83087"
FT                   /db_xref="GOA:A6UXT0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT0"
FT                   /protein_id="ABR83087.1"
FT                   /translation="MSRTWIRNPLAIFTANGLDAAGGLVVEDGRIVELLGAGQHPAQPC
FT                   ASQFDASQHVVLPGLINTHHHFYQTLTRAWAPVVNQPLFPWLKTLYPVWARLTPEKLEL
FT                   ATKVALAELLLSGCTTAADHHYLFPGGLEQAIDVQAGVVEELGMRAMLTRGSMSLGEKD
FT                   GGLPPQQTVQEAETILADSERLIARYHQRGEGARVQIALAPCSPFSVTPEIMRASAELA
FT                   ARHDVRLHTHLAETLDEEDFCLQRFGLRTVDYLDSVGWLGPRTWLAHGIHFNAEEIRRL
FT                   GEAGTGICHCPSSNMRLASGICPTMELEAAGAPIGLGVDGSASNDASNMILEARQALYL
FT                   QRLRYGAERITPALALGWATRGSARLLGRGDIGELAPGKQADLALFKLDELRFSGSHDP
FT                   LSALLLCAADRADRVMVGGTWRVVDGAVEGLDLAALIARHRAAASALIAG"
FT   gene            233557..234609
FT                   /locus_tag="PSPA7_0220"
FT   CDS_pept        233557..234609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0220"
FT                   /product="putative nucleoside hydrolase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81660"
FT                   /db_xref="GOA:A6UXT1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT1"
FT                   /protein_id="ABR81660.1"
FT                   /translation="MSRAARPRNRFCRLLLGLALLMPASLPFAAAETAAPQSPRTLIID
FT                   TDPGADDVIALLFAMASPKELKIQALTTVAGNVPLEKTARNARLAREWGKRPDIPVYAG
FT                   APRPLLRTPIYAADVHGSEGISGVEVHEPKQPLAEGNAVDYLIRTLRAAPEKSVTLAML
FT                   GPETNLALALTQAPDIVKGIREIVIMGGAHFNGGNITPAAEFNIFADPHAAEIVLKSGA
FT                   PITMLPLDVTHKILTSPERIARLRNLGNRAGKTVADILDAYVQYDIKYYGLEGGPVHDA
FT                   TVVAYLLEPSLFKGKRINVQVDSREGITFGQTVADWYGGLKQPANVNWINEGDAQGFFD
FT                   LLAERIARLP"
FT   gene            complement(234624..235247)
FT                   /locus_tag="PSPA7_0221"
FT   CDS_pept        complement(234624..235247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0221"
FT                   /product="nucleoside 2-deoxyribosyltransferase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81077"
FT                   /db_xref="GOA:A6UXT2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT2"
FT                   /protein_id="ABR81077.1"
FT                   /translation="MSRSKGSSSRRSFLRLAALLLPAGALLGSLPGVRAAARPRKLYLA
FT                   GPDVFRADAVAHGEALKALCARYGFEGLYPLDNALPKRIADPREQAAWIYRANLGLIER
FT                   ADAVLANLNFFRGAEPDSGTAFEVGYATALGKPVYGYVDDAGSYAERIRRHAPALIGQD
FT                   PSRDRDGMALEEFGLPLNLMLAVPATLVVGDAEQALRQLAGHHG"
FT   gene            complement(235372..235890)
FT                   /locus_tag="PSPA7_0222"
FT   CDS_pept        complement(235372..235890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0222"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81265"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT3"
FT                   /protein_id="ABR81265.1"
FT                   /translation="MTAIYLAGPDVFRPDAEAHGETLKALCAEFGFVGLYPLDHALPAD
FT                   IREPAAQAAWIYRANVGLIERADCVLANLDPFRGSEPDSGTAFEVGYALALGKPVYAYL
FT                   DDAGAYAERLARLAPEWLGERPGVDRDGWQLEGFGLPLNLMLAVPSRLVAGGPREALLR
FT                   LAEDLGRNT"
FT   gene            236128..237225
FT                   /locus_tag="PSPA7_0224"
FT   CDS_pept        236128..237225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0224"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86478"
FT                   /db_xref="GOA:A6UXT5"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT5"
FT                   /protein_id="ABR86478.1"
FT                   /translation="MKHRRTQSRTSVLCRLAAVLGLGACALAAEAAEPLKVGFVYVGPV
FT                   GDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTSFG
FT                   YMNPTAKVARQFPRVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKIGYI
FT                   ASFPIPEVIRDINAIRLALDKYDPQAELKVMWVNTWFDPGKEADAANALIDQGVDVVFQ
FT                   HTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMDGTWKS
FT                   EDFWGGLAESMVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSGKERFAA
FT                   GVSATNADLASMNYYVEGIKADLPK"
FT   gene            237298..238260
FT                   /locus_tag="PSPA7_0225"
FT   CDS_pept        237298..238260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0225"
FT                   /product="putative oxidoreductase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85004"
FT                   /db_xref="GOA:A6UXT6"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT6"
FT                   /protein_id="ABR85004.1"
FT                   /translation="MDRLPIIDIAPLYGADRGAWNDVARRIDQACREWGFFYIAGHPLP
FT                   AARFEALLAAAREFFALPVEEKLKIDITRSRNHRGYGAIATEQLDPALPSDFKETFDMA
FT                   LHLPAEHPDVGAGTSFYGPNRHPDLPGWEALLEGHYADMLALARTVLRALAIALGIEED
FT                   FFDRRFEQPVSVFRLIHYPPAADRQSADQPGAGAHTDYGCVTLLYQDAAGGLQVQNRQG
FT                   EWIDAPPIDGTFVVNIGDMMARWSNDRYRSTPHRVLSPRGVDRYSMPFFAEPHSDTEIR
FT                   CLPGCFDADNPPRYPPTTCGEWLTSRFAQTYAYRRGETA"
FT   gene            238360..239310
FT                   /gene="add"
FT                   /locus_tag="PSPA7_0226"
FT   CDS_pept        238360..239310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="PSPA7_0226"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00962; match to protein family HMM TIGR01430"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83229"
FT                   /db_xref="GOA:A6UXT7"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UXT7"
FT                   /protein_id="ABR83229.1"
FT                   /translation="MYEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETL
FT                   RKAYAFNNLQEFLDLYYAGADVLRSEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTD
FT                   RGIPFEVVLAGIRAALRDGEKQLGIRHGLILSFLRHLSEEEAQKTLDQALPFRDAFVAV
FT                   GLDSSEVGHPPRKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRA
FT                   FEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFG
FT                   GYVTENFHALQQSLGMTEEQARRLAQNSLDARLVK"
FT   gene            239448..240035
FT                   /locus_tag="PSPA7_0227"
FT   CDS_pept        239448..240035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0227"
FT                   /product="putative sigma-70 factor, ECF subfamily"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04542; match to protein family HMM PF04545; match to
FT                   protein family HMM PF08281; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83261"
FT                   /db_xref="GOA:A6UXT8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT8"
FT                   /protein_id="ABR83261.1"
FT                   /translation="MSDRDLPSGPRPDALPADGEAARRADLLKAFLAQRQRMESLVRRR
FT                   VGCRATAADLVQELFLRFWRRPAAPVEELGSYLLRSARNLAIDHLRGEGSRQRQLDDWL
FT                   PEQRQGEPVGPEQALEAGDQWRRVEAALRDLPERTRRIFLLNRIHGRTYAEIARAMQLS
FT                   QSAVEKHMMRALDACKASLAGPAGEQTRSAQP"
FT   gene            240032..241027
FT                   /locus_tag="PSPA7_0228"
FT   CDS_pept        240032..241027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0228"
FT                   /product="putative transmembrane sensor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04773"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85853"
FT                   /db_xref="GOA:A6UXT9"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXT9"
FT                   /protein_id="ABR85853.1"
FT                   /translation="MTRTDSDAAPCDPALEQTAQAWLVRLRGTSDVAVRRAFEDWLAQR
FT                   PEHAQAYARAETLWRLTEMPATRLALEEADALEIYLRPRRAPRNPRRWAYPLASVACLL
FT                   AMLWLGGWWQPGDWLQDWRADYVAAPGQVAEWKLADGSYLSLDAGSAVRVRIDGGQRRV
FT                   ELLRGAVALRVKRDALPFVVEAGEGRARVLGTEFEVRRGARATRVTVLQGRVAVSAGTG
FT                   AGAAEEVLGAGQQVGFADGELGRPVAVDAAAALAWRQGWLSFYRQPLAEVLDELARYYP
FT                   GRILLLDDALGRQPVSGSFRSDDPEAALKSLQAVLGYRQQILFGRLVVIR"
FT   gene            241176..243563
FT                   /locus_tag="PSPA7_0229"
FT   CDS_pept        241176..243563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0229"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00593; match to protein family HMM PF07660; match to
FT                   protein family HMM PF07715; match to protein family HMM
FT                   TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82321"
FT                   /db_xref="GOA:A6UXU0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU0"
FT                   /protein_id="ABR82321.1"
FT                   /translation="MTPFPRFALHTLPALFLSLGCLAATAQAAEAVRYRFSQAAAPLAR
FT                   ALDAFSRASGQTLLYTAELPPQATAPALHGSLGAEEALQRLLQGSGLRARRVDERTLTL
FT                   EPIPASGALDLDATTVSAAAPAQGYRPAASASISRGDAPVLEIPQTISVVPAQALQDQR
FT                   PRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTATADH
FT                   VEVLKGPASLLYGIQDPGGVVNVVSRKPQLQQANALTLRGSAYAHGRNGGGGQLDSTGP
FT                   LGDSGLAYRMILDHEDEDYWRDFGKSRETLVAPSLAWYGEDTTVNLSYEHREFTTPFDR
FT                   GTAIDPRTNRPLDIPRSRRLDEPFNITEGRSDLTRLDLERQLDDSWKAHFGYGYSRETY
FT                   DDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGALQLAGMRHDLQFGMDHEKR
FT                   KIFRADLLRDSRTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYFQDSIHLDDR
FT                   WILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSLYGSYTRSFKP
FT                   NSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRKKNVLVNELDGA
FT                   GNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLDAEVTEDPTLEGKRLQNVARNT
FT                   ASLSAVYELGEVLGGDRLRLGGGARYVGERPGDPGNSFDLPSYTVADAFASYDTRFGGH
FT                   GVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQVSTTVEF"
FT   gene            243647..244663
FT                   /gene="pcaQ"
FT                   /locus_tag="PSPA7_0230"
FT   CDS_pept        243647..244663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaQ"
FT                   /locus_tag="PSPA7_0230"
FT                   /product="pca operon transcription factor PcaQ"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85916"
FT                   /db_xref="GOA:A6UXU1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU1"
FT                   /protein_id="ABR85916.2"
FT                   /translation="MRRAPGHYLAKRHLVPSLPVGYHARTTRRHGRPMNLDNRIKFRHL
FT                   ACFLEVARQRSFAKAADAVAVSQPAISKTLKELEEILGARLFERSKAGVELTEAGVTFL
FT                   RYAGPCVQALRDGVNTLRGHEAQVETVRVGVLSTVESLVVPEVLRRLHRRHRALVVSVA
FT                   TGPSAYLLAQLKVGELDLVVGRMTDSPEIQGLTFEHLYSESMMLVVRPGHPLLAAPLRD
FT                   PQRLADFPLVLPLAGTTIRRHADSLFVQCGIPLAGQRLETLSPTLSRSYVLRSEAIWVA
FT                   PRDAVRLDVGNGELVELDLGIREPGGSVGLCHNAALPLPLGAQWFSVVLREVAAELH"
FT   gene            244798..245517
FT                   /gene="pcaH"
FT                   /locus_tag="PSPA7_0231"
FT   CDS_pept        244798..245517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="PSPA7_0231"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00775; match to protein family HMM TIGR02422"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84435"
FT                   /db_xref="GOA:A6UXU2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU2"
FT                   /protein_id="ABR84435.1"
FT                   /translation="MHDAENRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLS
FT                   ETSGPDFSHLKLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQAN
FT                   AGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGNYYFRTIKPGPYPWRNGPNDWRPAHIH
FT                   VSVSGPAIATRLITQMYFEGDPLIPRCPIIRTLADPEAAQSLIGRLDMSMANPMDCLAY
FT                   RFDIVLRGQRRTFFENA"
FT   gene            245528..246133
FT                   /gene="pcaG"
FT                   /locus_tag="PSPA7_0232"
FT   CDS_pept        245528..246133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="PSPA7_0232"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /EC_number="1.13.11.3"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00775; match to protein family HMM TIGR02423"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84745"
FT                   /db_xref="GOA:A6UXU3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU3"
FT                   /protein_id="ABR84745.1"
FT                   /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMAREDA
FT                   PGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPEQPFNSFGRTATTFDAGE
FT                   WTLHTVKPGVVRNAQGVPMAPHINVALFARGINIHLQTRLYFDDEAEANAACPVLNLIE
FT                   QAPRRDTLVARRCEVNGQLAYRFDIRIQGDNETVFFDF"
FT   gene            246346..247191
FT                   /gene="pcaR"
FT                   /locus_tag="PSPA7_0233"
FT   CDS_pept        246346..247191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaR"
FT                   /locus_tag="PSPA7_0233"
FT                   /product="transcriptional regulator PcaR"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01614; match to protein family HMM PF09339; match to
FT                   protein family HMM TIGR02431"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86583"
FT                   /db_xref="GOA:A6UXU4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU4"
FT                   /protein_id="ABR86583.1"
FT                   /translation="MSMSEHPEHPATLAPPSVLSPARRIAAFTGDPNFMTSLARGLAVI
FT                   HAFQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDGRTYSLLPKVLTLGHAY
FT                   LSSTPLAITAQPILDRLSEQLHEACSMATLEGDDVLYIARSATPQRLISVDLNVGSRLP
FT                   AYCTSMGRILLAALDDDALHGYLGEVEMQAKTSRTLYTPDTLLPCLMDIRRQGWCIVDQ
FT                   ELEVGLRSLAVPVRDSAGHVLAALNVGTHAGRVSRAELENRFLPLLLEASRELSARLFS
FT                   "
FT   gene            247392..248495
FT                   /locus_tag="PSPA7_0234"
FT   CDS_pept        247392..248495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0234"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00529; match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82364"
FT                   /db_xref="GOA:A6UXU5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU5"
FT                   /protein_id="ABR82364.1"
FT                   /translation="MALPAILCASLLAGCGAEPPTEERTRVLAQTVKLAEFASATSITG
FT                   DIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQRSNVENAQAAVAAQQA
FT                   QSKLADLNYRRQKALLPKGYTSQSEYDQALASVRSAQSSLKAAQAQLANARDLLSYTEL
FT                   RASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYESLFSHDVEGQRISVSLL
FT                   GRPEVTASGKVREITPTVDERSGTLKVKVGLDAVPAEMTLGSVVNASVAAPAQHSVVLP
FT                   WSALSKLGSQPAVWLLDQERKARLQPVRVARYASEKVVIASGLEAGQTVVTVGGQLLHP
FT                   GQVVEVAQPPQPTQTTASRDALGGGQP"
FT   gene            248492..249562
FT                   /locus_tag="PSPA7_0235"
FT   CDS_pept        248492..249562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0235"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00529; match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81843"
FT                   /db_xref="GOA:A6UXU6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU6"
FT                   /protein_id="ABR81843.1"
FT                   /translation="MKPVVLASLFGCALLLSACGDEQPSAPPRPVLSVTVKTLKNDDLG
FT                   RFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLA
FT                   SAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAALQQARDQLS
FT                   YTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFL
FT                   VSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVR
FT                   SVLPASVLLERDGKTQVWVIDAKQSSVALREVQVLSRDERQVVIGRGLVDGDRVVRAGV
FT                   NSLEPGQKIKLDEDAR"
FT   gene            249559..252606
FT                   /locus_tag="PSPA7_0236"
FT   CDS_pept        249559..252606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0236"
FT                   /product="putative RND efflux transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85796"
FT                   /db_xref="GOA:A6UXU7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU7"
FT                   /protein_id="ABR85796.1"
FT                   /translation="MKGGFNLSDWALRHQSLVWYLMAVSLVMGVFSYLNLGREEDPSFA
FT                   IKTMVIQTRWPGATVDDTLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLKDTTK
FT                   AGDIPDIWYQVRKKISDIQGEFPQGIQGPGFNDEFGDVFGSVYAFTADGLDFRQLRDYV
FT                   EKVRLDIRSVKDLGKVQMIGAQDEVIYLNFSTRKLAALGLDQRQVVQSLQAQNAVTPSG
FT                   VVEAGPERISVRTSGNFRSEKDLQAINLRVNERFYRLSDLASISRDFVDPPTSLFRYKG
FT                   EPAIGLAVAMKEGGNILEFGEALNARMQEITGELPVGVGVHQVSNQAQVVKKAVGGFTQ
FT                   ALFEAVVIVLIVSFVSLGLRAGLVVACSIPLVLAMVFVFMEYTDITMQRVSLGALIIAL
FT                   GLLVDDAMITVEMMITRLELGDSLHDSATYAYTSTAFPMLTGTLVTVAGFVPIGLNASS
FT                   AGEYTFTLFAVIAVALLLSWIVAVLFAPVIAVHILPKTLKHKSEQKKSRIAERFDSLLH
FT                   LAMRRRWTTIFLTALLFGVSLFLMKFVQHQFFPSSDRPELLVDLNLPQNSSIHETRAVM
FT                   DRLEATLKDDEDIDHWSAYVGEGAIRFYLPLDQQLQNNFYGQLVIVTKDLEARERVATR
FT                   LRERLRKDYVGISTYVQPLEMGPPVGRPIQYRVSGPQIDKVREYAMGLAGVLDGNPNIG
FT                   DIVYDWNEPGKMLKIDIAQDKARQLGLSSEDVAQIMNSVVTGSAVTQVRDDIYLVNVIG
FT                   RAEDSERGSLETLESLQIVTPSGTSIPLKAFAKVSYELEQPLVWRRDRKPTITVKASLR
FT                   GEIQPTDLVARLAPEVRRFADGLPANYRIEVGGTVEESGKAEGPIAKVVPLMLFLMATF
FT                   LMIQLQSVQKLFLVASVAPLGLIGVVAALLPTGTPMGFVAILGILALIGIIIRNSVILV
FT                   TQIDAFEKDGKTPWEAVLEATHHRTRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGI
FT                   VAATLLTLIFLPALYVAWYRIPEPGR"
FT   gene            252676..253743
FT                   /locus_tag="PSPA7_0237"
FT   CDS_pept        252676..253743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0237"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81847"
FT                   /db_xref="GOA:A6UXU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU8"
FT                   /protein_id="ABR81847.1"
FT                   /translation="MGHPPRRRAGYARRCYGDEGQYRQPGAAENPTNLRICFATEVTVD
FT                   TLQGMRVFARVVDSGSFTSAAQALDLSTAQVSRLISDLEAHLQTRLLHRTTRRLALTEA
FT                   GERYLERCRAILADIEVAEAEASGAHIRPCGRLRVQSLMGLGQHHLVPMIARYGALFPD
FT                   VVIELTLSQRNPDMLEEGQDVLITGERQLPDSEFVAQRLGSIHSVLCASPGYLQQRGVP
FT                   RSVDELEQHVCLRLQDPAYPEGWLFVDEQGERTVSPQNTFMVNVAEVMAQAARAGLGIA
FT                   LLPSYVAAPALRNGELRRVMPGHTMHERTIYALYPSRRYLDAKIRTWVDLLQQELPQAF
FT                   ARDETTMQSSSYWAQ"
FT   gene            253859..254044
FT                   /locus_tag="PSPA7_0238"
FT   CDS_pept        253859..254044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0238"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86656"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXU9"
FT                   /protein_id="ABR86656.1"
FT                   /translation="MNRQILAAAVLSLFSLAFSQVGFAEESSLMTNRMVDANQQAIEHQ
FT                   QELSASAAPAETRRDS"
FT   gene            254630..255964
FT                   /locus_tag="PSPA7_0242"
FT   CDS_pept        254630..255964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0242"
FT                   /product="putative porin"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82853"
FT                   /db_xref="GOA:A6UXV3"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXV3"
FT                   /protein_id="ABR82853.1"
FT                   /translation="MRNLFALTPLALALFSAPGAWADEGEAEEGFIEGSSLQLLTRNYY
FT                   FNHDRRHASGHDSKEWAQGFIATFQSGYTPGVVGFGVDAYGMLGLKLDGGGGTGGTSIL
FT                   PITAPSKEGYESGKAPDEFSSGGAALKIRAFDTELKLGDQFLGNPVVAGGESRMLPQTF
FT                   RGVSLTNNSFEDLTLTAGQVSFTKYYNQSGHRRLGSYYGELPGDRDSHHLSWLGGTWGG
FT                   IEGFTSSLYAAELQNVWKQYYADVDYTYEIDEDWSLNPGAHYYKTVDSGDSLLGRIDNN
FT                   TYSLHFAVGYRQHTVTAVLQKVNGNTPFDYINQGDSIFLDNSQQYSDFNGPNEKSWKLQ
FT                   YDYDFVALGMPGLTASASYSRGKLDLTRVDPDSPGYGGWYSADGNNAKHWERDLDLQYV
FT                   VQGGPAKDLSLRLRWATHRGTGGYSAVDNDIDEYRVIVDYPVDVF"
FT   gene            complement(255993..256790)
FT                   /locus_tag="PSPA7_0243"
FT   CDS_pept        complement(255993..256790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0243"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00165; match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83924"
FT                   /db_xref="GOA:A6UXV4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXV4"
FT                   /protein_id="ABR83924.1"
FT                   /translation="MTMNGQPAELHRPIPRLARLPRPVYARAESLRAGSWTSRHHHAWV
FT                   QLSYAISGVLGVHTAEGSFFAPPQRAIWIPAQLEHEVVTSTRAEMRSLYIRGDACAWAP
FT                   TRCRVLEVTPLARELIKSFCELPVDYPEGDSAESRLVQVLLDQLRLLPEVAFSLPMPRE
FT                   PRLLRLCQALIDEPTQSLTMGDWAQRLGTSEKTLSRLFQRETGMNYRLWRQRQRLLASL
FT                   NALEAGDSVTGAALDSGYDSTSAYIAAFKGLFGFTPGELFRQR"
FT   gene            256868..258484
FT                   /locus_tag="PSPA7_0244"
FT   CDS_pept        256868..258484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0244"
FT                   /product="putative gamma-glutamyltranspeptidase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01019"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82715"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXV5"
FT                   /protein_id="ABR82715.1"
FT                   /translation="MLDFSAHALPYASQRSPVHARRGMVATSQPQAAQVGLEILRRGGN
FT                   AIDAAIATAAALTVVEPTGCGIGGDAFALVWTRGRLHGLDASGRAPGLLDRERVRAAGH
FT                   DRMPLYGWTPVTVPGCPAAWAELSRRFGKLPFGQLLQPAIELARDGFPVSPVIARLWQG
FT                   GLDKFRAALPQRPELRAWFDEFLIDGRAPRAGEVFRQPGQADTLDELARSQCESFYRGE
FT                   LARTIAGHAEHSGGYLRLDDLAGYRAQWVEPIALNYRGYDVWEIPPSGQGLIALMTLNI
FT                   LKGFEFGERDCAQTWHRQLEAMKLAYVDGLHYISQPRSMRVSVEELLHEDYAASRRALI
FT                   GAHALDPTPGQPKPGGTVYLACGDEEGNLVSFIQSNYHGFGSGVVVPGTGIALQNRGAE
FT                   FSLDPDHVNCLEPGKQTFHTIIPGFLSKDGIPLGPFGVMGAYMQPQGHVQMVMNLVDFG
FT                   LNPQAALDAPRWQWLGGLRVGIEHAAPRALATELAQRGHQVEIAYDSTSYGRGQIVLRD
FT                   PASGVLCGGTEPRTDSQIAVW"
FT   gene            259148..259984
FT                   /locus_tag="PSPA7_0245"
FT   CDS_pept        259148..259984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0245"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82214"
FT                   /db_xref="GOA:A6UXV6"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXV6"
FT                   /protein_id="ABR82214.1"
FT                   /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESL
FT                   TYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEITP
FT                   RLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNFYYR
FT                   KPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLH
FT                   FNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF"
FT   gene            260228..261634
FT                   /locus_tag="PSPA7_0246"
FT   CDS_pept        260228..261634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0246"
FT                   /product="putative transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00860; match to protein family HMM TIGR00801; match to
FT                   protein family HMM TIGR03173"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85898"
FT                   /db_xref="GOA:A6UXV7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXV7"
FT                   /protein_id="ABR85898.1"
FT                   /translation="MHSEEQRPHDLIYGLDDRPRPLPAFLAALQHVLASFVGIVTPPLV
FT                   IGSLLGLGEHLPYLISMALTVSGVGTLIQARRPFGIGAGMICLQGTSFAFLGAVLAAGM
FT                   LVKQRGGGPEDILAMIFGVCFFGAFVQIVLSRFLGHLRRVITPLVTGIVITLIGVSLIK
FT                   VGITDLGGGAGAADFGAPANLALGALVLLSIVLLNRSRLPWLRLAAIVGGLALGTLAAW
FT                   ATGVFVPRPLPELPLLSLPQPFRFGFAFDWMAFLPVALIYLISSIETVGDLTANCMLSR
FT                   QPLDGPKYLERLRGGVLGDGVSCLLAATFSAFPNTTFAQNNGVIQLTGVASRHVGIYIG
FT                   GVLLALGLFPWIGAILQQIPKPVLGGATLVMFGSVAAAGIRILGQTAMDRRSVLIIAAS
FT                   FGVGLGVAAQPTLLDQMPAVVKTLFDSAITSGGVTAILLNLLLPEERVAQAPLGSPEGG
FT                   ALARWRKPLG"
FT   gene            261727..262392
FT                   /locus_tag="PSPA7_0247"
FT   CDS_pept        261727..262392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0247"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00440; match to protein family HMM PF08362"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84288"
FT                   /db_xref="GOA:A6UXV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXV8"
FT                   /protein_id="ABR84288.1"
FT                   /translation="MTLTVPAHAPDARDKPAGRIRQKNEEAILAAAEEEFARHGFKGTS
FT                   MNTIAQNVGLPKANLHYYFGNKLGLYTAVLSNILELWDGTFNTLGPGDDPAEALAGYIR
FT                   AKMEFSRRYPLASRIFAMEIISGGECLTAHFNQDYRSWFRGRAAVFEAWIAAGRMDPVD
FT                   PVHLIFLLWGSTQHYADFATQIGLVTGRKRLSKQDFAAATENLVRIILKGCGLTPPAA"
FT   gene            262397..262987
FT                   /locus_tag="PSPA7_0248"
FT   CDS_pept        262397..262987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0248"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01205; match to protein family HMM PF09186"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82320"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXV9"
FT                   /protein_id="ABR82320.1"
FT                   /translation="MPSTLQGLAEFREEIRKSRFHTIAAPVADEGAAQAFIAAHRDASA
FT                   GHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVAVLVSRWFGGIKLGTGGL
FT                   ARAYGGGAAKCLQQAPRRELVERCRVRFACAFAEHALLKARSLALGARVEEEEYRADGV
FT                   GLVLELPAARFDELQALLVDLSRGQVRPQRLEA"
FT   gene            complement(262992..263819)
FT                   /locus_tag="PSPA7_0249"
FT   CDS_pept        complement(262992..263819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0249"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82416"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW0"
FT                   /protein_id="ABR82416.1"
FT                   /translation="MSRERELDAWIDGLLADPRFHGHPLHEALGRLRQQSLEQLVRLER
FT                   IARISDGFQSMAREQNLTLSERYHKQLRRLEKVARISDRYQQMMRDLNLALKEASIRDP
FT                   LTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQVNDTWGHDSGDRVLVEIAR
FT                   AMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVRDSVRTLAVRVGTEALSVTA
FT                   SVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAVPATPASPRPAPAR"
FT   gene            complement(263826..264206)
FT                   /locus_tag="PSPA7_0250"
FT   CDS_pept        complement(263826..264206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0250"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86048"
FT                   /db_xref="InterPro:IPR018530"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW1"
FT                   /protein_id="ABR86048.1"
FT                   /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDW
FT                   VERFLAEERRPLELDLRLLYLNTSSIKAMMDIFDLLEEAHQGGRAIDLRWHYDRRNERV
FT                   AELAEEFREDCSFPFAIQAHDE"
FT   gene            complement(264233..264775)
FT                   /locus_tag="PSPA7_0251"
FT   CDS_pept        complement(264233..264775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0251"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82608"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW2"
FT                   /protein_id="ABR82608.1"
FT                   /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHAE
FT                   QAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLVER
FT                   DDGQRLVQSIQAIANLDKAALKAAYKEQLRRPRDSGSASGAGLGLLDIARKSSEPLAAS
FT                   LKEQPDGRAFFSLRAVI"
FT   gene            complement(264784..266775)
FT                   /locus_tag="PSPA7_0252"
FT   CDS_pept        complement(264784..266775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0252"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82576"
FT                   /db_xref="GOA:A6UXW3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW3"
FT                   /protein_id="ABR82576.1"
FT                   /translation="MAANWGLRGKSVVALLLACALALVPAVLLGWRAMDDIRTHFGLAY
FT                   AKNFTLLHRQQILAPVSRELALSRRFAESVVTRDWLLKEDDPARRALFFREAEGYRGDF
FT                   RDHAYFIIASGSGHYYFNDGRQAHSDAPRYTLEADDPEDAWYFNTLRNSAAYNINVNVD
FT                   SKLNLTKVWFNLVIRDQGRPIGLAGSGLDLSGFLDDFIIAREPGVTPMIVGDDGAIQAH
FT                   PDRRLIAYSSAAGGASERHRVFDLLDRPEQRDALREAMRLARAKAGSVHCLWAGLDGRQ
FT                   QLFAVAYIPQLRWYVLTAVDLHAAQVLDNRWLWPLAGTFLLLLVALLLGFAYAVERLLL
FT                   RPLRSLKRSAKAIAAGRYDTPLPLARQDEIGSLSKAFASMADQVRRHTAELEDKVQERT
FT                   QALEEANREMAAAQKKIGDSLDYASLIQRAILPDRQLSATLGEHHFILWKPRDVVGGDF
FT                   YVYREQADGYLIGVVDCAGHGVPGALMTMLARAAIDHAIEAVGSRDPAAILDETDQAMR
FT                   SMLSQEQIPQALATNMDAGLVWVDRRRGQLAFAGAKISLYASDGEEVQELKGARRAIGD
FT                   KRRGDYRNIEVPLAPGWTFYLSTDGFLDQAGGEHGFGFGSRRFADMLRDHARQPLPEQA
FT                   EAFVATLAEYQGEHPQRDDITILSFRFD"
FT   gene            complement(267049..268098)
FT                   /locus_tag="PSPA7_0253"
FT   CDS_pept        complement(267049..268098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0253"
FT                   /product="putative methylesterase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00072; match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81839"
FT                   /db_xref="GOA:A6UXW4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW4"
FT                   /protein_id="ABR81839.1"
FT                   /translation="MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIR
FT                   QHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVDFI
FT                   AKPRLGIAEGMQAYAEEIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIALGAS
FT                   TGGTEALKEVLLGLPANSPGVVITQHMPPGFTRSFAERLDRLTRLAVSEARDGDRILPG
FT                   HALIAPGDYHMQVQRSGADYMVRLNRQPQVNGHRPAVDVMFESLARCAGRNLLAGLLTG
FT                   MGRDGARGLLAIRQAGGYTLAQDEATCVIYGMPREAVELGAAEDVLPLERIAQALLQQA
FT                   CRRGGGNRL"
FT   gene            complement(268118..268720)
FT                   /locus_tag="PSPA7_0254"
FT   CDS_pept        complement(268118..268720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0254"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03975"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83496"
FT                   /db_xref="GOA:A6UXW5"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW5"
FT                   /protein_id="ABR83496.1"
FT                   /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASDEDLLIVTVLG
FT                   SCVSVCLRDPVNGIGGMNHFMLPERGAGSDPASPSARYGGHAMELLINRMLALGARRER
FT                   LQAKVFGGGSVLRQISAAIGQRNVEFTLGYLATERIPLLASDVLEAFPRKIYFFPRNGR
FT                   VLVKSLVELKNDTVLQRERDYRRRIDRNPDGGPIDLF"
FT   gene            complement(268726..269568)
FT                   /locus_tag="PSPA7_0255"
FT   CDS_pept        complement(268726..269568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0255"
FT                   /product="putative chemotaxis protein methyltransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01739; match to protein family HMM PF03705"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84473"
FT                   /db_xref="GOA:A6UXW6"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW6"
FT                   /protein_id="ABR84473.1"
FT                   /translation="MSISTPSPVFGNHEFHYTREDFQQVRERLYRLTGISLAESKVQMV
FT                   YSRLSRRLRLLRLASFAEYFAHLDREPGERQLFVNALTTNLTAFFRERHHFPLLADLAR
FT                   RQLQRHRPLRVWSAAASTGEEPYSIAITLVEALGRFDPPVKIIASDIDTGVLDCARQGV
FT                   YPLDRLEQLPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWPIAGELDA
FT                   IFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRSVGQTVYRPA"
FT   gene            complement(269638..271677)
FT                   /locus_tag="PSPA7_0256"
FT   CDS_pept        complement(269638..271677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0256"
FT                   /product="putative chemotaxis transducer"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80942"
FT                   /db_xref="GOA:A6UXW7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR041395"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW7"
FT                   /protein_id="ABR80942.1"
FT                   /translation="MGLFNAHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLY
FT                   DSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEAGWIDRTIPDERLEGRAARIGKGI
FT                   NELVAAHIAVKMKVVSVVTAYGRGDFEPLMDRLPGKKAQITEAIDGVRERLRGAAEATA
FT                   AQLATAAYNARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDA
FT                   GRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFALDVVPVFNDANERLGSAV
FT                   QWTDRTEEHRAEQEVSQLVQAAAAGDFSKRVEESGKEGFFLRLAKDLNSLVDTADRGLR
FT                   DVSRMLGALAQGDLTQRIEADYQGTFGQLKDFSNETAQSLSRMLGQIRDAADTINTAAG
FT                   EIASGNAELSARTEQQASSLEETASSMEELTSTVKLNAENARQANSLAANASEVATQGG
FT                   TVVQKVVSTMSSINESARKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   GEVRTLAQRSAAAAKEIKTLISDSVDKVENGNTLVAQAGQTMSDIVVAIRRVTDIMSEI
FT                   AAASAEQSTGIEEVNSAVSQMDDMTQQNAALVEEAAAAAEAMQEQAGLLNQSVAVFRLD
FT                   NAPSVVQLASARPPAPRPAAPAPLARGGMARASKARKEDGWEEF"
FT   gene            complement(271713..272198)
FT                   /locus_tag="PSPA7_0257"
FT   CDS_pept        complement(271713..272198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0257"
FT                   /product="putative purine-binding chemotaxis protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86345"
FT                   /db_xref="GOA:A6UXW8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW8"
FT                   /protein_id="ABR86345.1"
FT                   /translation="MNGTEASQAHGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTAI
FT                   ANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSVSD
FT                   VIALGGDAIRPPPEFGASFDTKYLLGLATAGERMLILVDIERLMTSREMALVDEAAA"
FT   gene            complement(272185..274062)
FT                   /locus_tag="PSPA7_0258"
FT   CDS_pept        complement(272185..274062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0258"
FT                   /product="putative two-component sensor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01584; match to protein family HMM PF01627; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   PF02895"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84861"
FT                   /db_xref="GOA:A6UXW9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXW9"
FT                   /protein_id="ABR84861.1"
FT                   /translation="MPQDMSQFLQVFFEETEEHLATLELLLIGLDLDRPDSETLHGIFR
FT                   AAHSIKGSSGMFGFDDISAVTHELETLLDRIRCGQMRLRPDMISAFLEARDVLQRLLDA
FT                   HRSGHADPDVPLDETVERLRGWLRAPEEQPEDGFGFFDGAPGSPAEDAALDDAFGFFDD
FT                   APGAPGEASGTEAFGLFDDSPGTPLPQERAFGLFDGAPGSPAAPGAPAQTIAATARGAA
FT                   ASARGDGESGSIRVSVEKIDSLINLVGELVITQAMLGQLGEQLEPSRHERLQHALAQLE
FT                   HNTRDLQESVMSIRMLPINFIFSRFPRLVRDTAARLGKQVELHLHGEHTELDKSVIEKL
FT                   SDPLTHIVRNSIDHGIETPAERLAAGKPASGTVKLAASHQGGSVVVEVSDDGRGLSRPR
FT                   ILAKARERNLPVHDGMSDAEVWQLVFMPGFSTAETVTELSGRGVGMDVVKRNIGAMGGR
FT                   IDIDSAPGMGTRIGIRLPLTLAILDGLIVAVAAVNYVIPLTYIVESLQARSEDVRGLGG
FT                   EDNAMIRVRGEYLPLFSLHELLRIGGEAPAPERGIVVILESEGRSFALQVDELVGQQQV
FT                   VIKSLEQNFRRVEGIAGATIMGDGSVALILDVDALPRLAAREDTADERH"
FT   gene            complement(274090..274455)
FT                   /locus_tag="PSPA7_0259"
FT   CDS_pept        complement(274090..274455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0259"
FT                   /product="putative two-component response regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84727"
FT                   /db_xref="GOA:A6UXX0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX0"
FT                   /protein_id="ABR84727.1"
FT                   /translation="MGKPILIVDDSASIRQMLSFTLKSAGYEVDEAADGKEGLGKAQSR
FT                   NYSLVFTDQNMPNMDGLSLIRSLRNLAGYRSVPILMLTTESSDAMKQQGRSAGATGWLV
FT                   KPFDPPKLLEVTRKVLP"
FT   gene            complement(274651..275826)
FT                   /locus_tag="PSPA7_0260"
FT   CDS_pept        complement(274651..275826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0260"
FT                   /product="putative chemotaxis transducer"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86628"
FT                   /db_xref="GOA:A6UXX1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX1"
FT                   /protein_id="ABR86628.1"
FT                   /translation="MRESLGVSVPSRSLALTLGLLSLPWALCAGLYAMGLDTWLALSLG
FT                   WLASLAAVLPLRRADRQSATTNSGSEADAALPAWDEAQRALGEETAQLDGHARQVDELL
FT                   HSAIRQLSDSFHGLAERIDTQRGLSHSLIERYDGHGQVDEGINFQDFIRTTQQTLSLFV
FT                   EATLETSRTSQQLVERMDHVRQKIAEILQSTQDMDAIAKQTNLLALNAAIEAARAGESG
FT                   RGFAVVADEVRALSTRSTEFSAAIRKHVDVVYHEIQDAKGAISQLADKDMSFALDSKQK
FT                   IQGMLDDLEAMNRHTLKVIHELDRLSLEVGQGVNAAVTALQFQDMSSQLLGQMRKHHAR
FT                   LGAFALGLGALRTRPRQEWPARVAQEVAELRRPLPSPVSQNSVEVGEVELF"
FT   gene            complement(276019..276951)
FT                   /locus_tag="PSPA7_0261"
FT   CDS_pept        complement(276019..276951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0261"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84110"
FT                   /db_xref="GOA:A6UXX2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX2"
FT                   /protein_id="ABR84110.1"
FT                   /translation="METLSNIQCFVRSAEAGSFAEAARRLGLTPAGVGKNVARLESNLG
FT                   VRLFQRSTRRLALTEAGERFLQEVGGSLAGIQTALANVSNVGNQPSGTLKVSMGLAFGR
FT                   DYILPLLGEFLERYPGIVPDWHFDNRQVDLIGEGFDAAIGGGFELPPGVVARHLTPGHL
FT                   ILLASPAYLRDKPPIRHPGDLCDFDGIRIRSPQTGRVRPWPLRRRDGEQAPIELRERMT
FT                   MSDPEATCEVAAMGLGITLVCMQHAYAYLESGALVRVLPDWYVDAGNTSLYYAANRLLP
FT                   AKTRVFVDFVVDYFRRQELARRFCAFPSG"
FT   gene            277071..277823
FT                   /locus_tag="PSPA7_0262"
FT   CDS_pept        277071..277823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0262"
FT                   /product="putative short-chain dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81552"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX3"
FT                   /protein_id="ABR81552.1"
FT                   /translation="MSVSSASLAGKVAFVQGGSRGIGAAIVRRLAAEGASVAFTYVSSA
FT                   DKSRALAAELEAAGSSVLALHADSADAAALVAAVDAAAARFGRIDILVNNAAILAFGSV
FT                   EELPLADFERTLAINVRSVFVATQAAIRHMGDGGRVISIGSTNAERMPFAGGATYAMSK
FT                   SALVGLTKGLARDLGPRGITVNNVQPGPVDTDMNPDDGDFAETLKGLMALPRYARSEEI
FT                   ASFVAYLAGPEAAYITGASLSIDGGFSA"
FT   gene            complement(277924..279534)
FT                   /gene="atsA"
FT                   /locus_tag="PSPA7_0263"
FT   CDS_pept        complement(277924..279534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsA"
FT                   /locus_tag="PSPA7_0263"
FT                   /product="arylsulfatase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85447"
FT                   /db_xref="GOA:A6UXX4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX4"
FT                   /protein_id="ABR85447.1"
FT                   /translation="MSKRPNFLVIVADDLGFSDIGAFGGEIATPNLDALAIAGLRLTDF
FT                   HTASTCSPTRSMLLTGTDHHIAGIGTMAEALTPELEGKPGYEGHLNERVAALPELLREA
FT                   GYQTLMAGKWHLGLKPEQTPHARGFERSFSLLPGAANHYGFEPPYDESTPRILKGTPAL
FT                   YVEDEHYLDTLPEGFYSSDAFGDKLLQYLKERDQSRPFFAYLPFSAPHWPLQAPREIVE
FT                   KYRGRYDAGPEALRQDRLARLKELGLVEADVEAHPVLALSREWERLDEEERAKSARAME
FT                   VYAAMVERMDWNIGRVVDYLRRQGELDNTFVLFMSDNGAEGALLEAFPKFGPDLLGFLD
FT                   QHYDNSLDNIGRANSYVWYGPRWAQAATAPSRLYKAFTTQGGIRVPALVRYPRLSRQGA
FT                   ISHAFATVMDVTPTLLDLAGVRHPGKRWRGREIAEPRGRSWLGWLSGETEAAHDENTVT
FT                   GWELFGMRAIRQGDWKAVYLPAPVGPATWQLYDLARDPGEIHDLADSQPGKLAELIEHW
FT                   KRYVSETGVVEGASPFLVR"
FT   gene            complement(279621..280460)
FT                   /locus_tag="PSPA7_0264"
FT   CDS_pept        complement(279621..280460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0264"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83119"
FT                   /db_xref="GOA:A6UXX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX5"
FT                   /protein_id="ABR83119.1"
FT                   /translation="MNALTAPATGTPLVSFRQVRKHFAVDGRRLEAIQQFDLEIGEGEF
FT                   IAIVGASGCGKSTLLRLLIGLDRDYDGEISVDGRPIAGIGGERGIVFQEHRLFPWLTVQ
FT                   QNVALGLVNEALGETDKAARIDEYIRLVGLHGFERAYPHQLSGGMAQRVAIARGLVASP
FT                   RLLLLDEPFSALDALTRQQLQEELLAIRRRTRITTLLVTHDVEEALYLADRVVVMEPRP
FT                   GRIRRVVEVDLAHPRERGGFDFLRQREALLHELTADGEYLAPPPRRVENLPFEFLAC"
FT   gene            complement(280457..282073)
FT                   /locus_tag="PSPA7_0265"
FT   CDS_pept        complement(280457..282073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0265"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86012"
FT                   /db_xref="GOA:A6UXX6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX6"
FT                   /protein_id="ABR86012.1"
FT                   /translation="MKNIDKTLSPAWSRPLPRLAPPSSAAFARRLGDSLLPWSLPLGLA
FT                   LLWWVASHYHWMSAQVLPTPELVWQSARELLAGELWSELAISLRRLAWGLLAGVASGAA
FT                   LGTWLGFSARAERLVFPTFSALAQIPTLAWIPLFMLFFGIGELLKLVVLVKAVVVPVTI
FT                   HTLVGVRDAQPKLREAAAVLRLPPRLLIWRLILPAALPAFLTGLRLALAQGWTSLLAVE
FT                   LLASSEGIGYLMVQGRQLFMLDIVFVCILVIGLVGVGMDRAIHWLDRRLLHWPQAATGE
FT                   FRRRPPGRGWQRLQVWLPPLALLLLWQSASSAEWVDPAILASPLEVARATWSGALDGSL
FT                   PGALFDSLKRTLGGLLLGGGLGFLGGLLLGLWHPAERLFGPTFAALRQVAIFAWVPLLT
FT                   AWFGLGEPAKLAFVALAAFFPLLLATQRGIASLPPSLGEAARVLRLGPWRRLLRLALPG
FT                   AAPSVFAGLRLALIYAWLGTIGAEYFMPSDGGIGSLMIGAQQLFRMDLIGAGMLLVGLT
FT                   GALLNALGQRIEARATRWRHA"
FT   gene            282340..283401
FT                   /locus_tag="PSPA7_0267"
FT   CDS_pept        282340..283401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0267"
FT                   /product="sulfate ester transport system substrate-binding
FT                   protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82054"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX8"
FT                   /protein_id="ABR82054.1"
FT                   /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVSA
FT                   GNSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLGDL
FT                   AAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLSFDN
FT                   ALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLSTRDLN
FT                   GAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQASYPVV
FT                   ILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRRQFSAEQWAAPELLEAAD
FT                   RLAKGKAVAQAGQ"
FT   gene            complement(283427..284785)
FT                   /locus_tag="PSPA7_0268"
FT   CDS_pept        complement(283427..284785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0268"
FT                   /product="putative porin"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84844"
FT                   /db_xref="GOA:A6UXX9"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXX9"
FT                   /protein_id="ABR84844.1"
FT                   /translation="MHDLRHAVFAGLLAGTLCEGAAATAGAGGFIEDSELQFLARTYYF
FT                   NRDYRDGPNNAGRNRFKPRSERNGYREETTQGLRLLFGSGYTPGNLGFGLDAHAMLGLQ
FT                   LDSGGGRTGTGNLPVGADGHPEHRYGKLGGALKLRHGETRLKYGQTSTSAPVFAASSNR
FT                   TLTGMAYGLLLEDRTFDGLLLEGGRFSAASGPGESRMHGEISTVYGRLGAYPVRLDTVN
FT                   FLGGQWQAGERLQLSLYAARFDDVWRQAYLGARYRQPLGEQRALLLDFNAYRTRDSGQS
FT                   RFGRIDTLASSLALGYEQGPQRLTLAYQHVRGEQPFDYMAFGDGRSSASMVLANSLGYS
FT                   DFNGPGERSWQLRYDLELGALGLPGLSLHALHARGRAGASADSAAESIYAGLYGRDGRH
FT                   RETDLGLAYRVKAGPLAGLALRASQAWHRDNPTYLGGDVDETRLILDYPWTIW"
FT   gene            285035..285760
FT                   /locus_tag="PSPA7_0269"
FT   CDS_pept        285035..285760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0269"
FT                   /product="putative acid phosphatase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81259"
FT                   /db_xref="GOA:A6UXY0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY0"
FT                   /protein_id="ABR81259.1"
FT                   /translation="MTHNKTLRPSLLLCLALLAPLACLGETAVPYALAQPPRLADYLPP
FT                   PPSADSAAAVADLGAVLEAQRLRTPEQVRRVRAHDQWEDNVFPFAGDLLGESFSKERLP
FT                   LARSFFNRAQENLVEVLMPAKKHFARPRPYEVTPLVNPVLPPPEGESYPSGHTMDGYLK
FT                   ASLLSMLVPERHDAFFARAEEHAQSRVLAGVHFPSDLEGGRTAAAALVASLLAEPAVAA
FT                   DFAAVREEVRGALGLPKLQ"
FT   gene            complement(285785..286702)
FT                   /locus_tag="PSPA7_0270"
FT   CDS_pept        complement(285785..286702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0270"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81068"
FT                   /db_xref="GOA:A6UXY1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY1"
FT                   /protein_id="ABR81068.1"
FT                   /translation="MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELGC
FT                   QLVNRGSKDLRPTPEGQVVLQHALNLVQGAANLSQEIAQLNKLDAGELRFGSGPAPAQE
FT                   LVPDAVADFIRRHPRVQISLEVDNWEKLSRALLREELEFFVADIRDFEADPNFQTRPLT
FT                   PRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAANIRCE
FT                   NMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGIISRSGY
FT                   RLSAAAKAMIETLVELDQAQHAAA"
FT   gene            287060..289432
FT                   /locus_tag="PSPA7_0271"
FT   CDS_pept        287060..289432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0271"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00593; match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80938"
FT                   /db_xref="GOA:A6UXY2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY2"
FT                   /protein_id="ABR80938.1"
FT                   /translation="MTRRFRFPLDRTPPSGTDYTLALLLALGGALPASAAEAPDDAAPA
FT                   TSVAAATPGRADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQVL
FT                   PSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIEQLE
FT                   LLRGPQGTLFGKNTTAGVLNISTRAPTFTAERTVEVSGGQDGYFQGRGTVSGPLGETLA
FT                   GRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEEDSSNG
FT                   SMVVYGAAERFWQRAALVGASPLRDPQRKKVNVNGRQHVSVHQGGSSLEANWNLASGYR
FT                   LTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFDYVVGAYA
FT                   FRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQGTWHLTERL
FT                   DFTAGLRGTYEEKDAKVERFAPLGGAAVGGIGAAVRNGQLGAYDSGDLSQYNFAPSALL
FT                   SLSYQFSDELLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERANDAELGLKSTLF
FT                   DRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLEFEATALPLRGL
FT                   TLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLTGQRVVGASKWIANLNGEYRWR
FT                   LDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSDLGDGQLDTSVWLK
FT                   NAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
FT   gene            289473..290375
FT                   /locus_tag="PSPA7_0272"
FT   CDS_pept        289473..290375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0272"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84054"
FT                   /db_xref="GOA:A6UXY3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY3"
FT                   /protein_id="ABR84054.1"
FT                   /translation="MSNAAQALATPVRLDIQPVAGRIGAEIRGVTLSGELDAATVEAIQ
FT                   AALVRHKVIFFRGQSQLDDQTQEAFAHLLGEPVAHPTVPSREGTRFLLELDGAEGRRAN
FT                   SWHTDVTFVEAYPKASILRSVVAPESGGDTVWANTASAYADLPAELRELADRLWAVHSN
FT                   EYDYAGVKPSASVEQLENYRKVFTSTVYETEHPVVRVHPQSGERTLLLGHFVKRLKGLS
FT                   QHDSAHLFAVLQGHVTRLENTVRWRWQAGDVAIWDNRATQHYAIDDYGNQPRMVRRVTL
FT                   GGDVPVGIDGQRSRTIRKA"
FT   gene            290442..291341
FT                   /locus_tag="PSPA7_0273"
FT   CDS_pept        290442..291341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0273"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84406"
FT                   /db_xref="GOA:A6UXY4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY4"
FT                   /protein_id="ABR84406.1"
FT                   /translation="MSQTATARPLDSDAAEAFRITPLQAPLGAEVRGLDARRPLAPEQV
FT                   LALKQALREHHILVFRQQHLDDEQYLRFATLFGSVFQPPADIPVLSSGGDGKVPDIVKV
FT                   ANTGDGELGNFALPAHIDHQWTPVPSSGSFLYALEVPSSGGETRFTNLARAYESLDEAT
FT                   RREIDGLRLINYNPFIRLREGGYGGGFATYRTPDIEPIQGSEHPLVRTHPESGRRVLFL
FT                   SAHTEVEIPGYDPARGQALIGRLREHLARPELSYSHAWSVGDIVWWDNQAVLHARNAFP
FT                   ASERRRLKRISLAGSRPF"
FT   gene            291989..293107
FT                   /locus_tag="PSPA7_0275"
FT   CDS_pept        291989..293107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0275"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /note="Pyridinenucleotide transhydrogenase subunit alpha;
FT                   Nicotinamide nucleotidetranshydrogenase subunit alpha;
FT                   Annotation was generated automatically without manual
FT                   curation; identified by match to protein family HMM
FT                   PF01262; match to protein family HMM PF05222"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81104"
FT                   /db_xref="GOA:A6UXY6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY6"
FT                   /protein_id="ABR81104.1"
FT                   /translation="MQIGVPLETHAGETRVSATPETVKKLIGQGHQVIVQSGAGVNASQ
FT                   PDSAYEVAGATIGSAAEAFGADLVLKVVAPSAAELAQMKSGAVLVGMLNPFDNENIARM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVMLAANHYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAEGVGGYARPMPASWMERQAKAVHERAKQSDIVITTALIPGRKAPTLLHEATVAEMKP
FT                   GSVVIDLAAAQGGNCPLTEADQVVVRHGVTIVGHSNLAALVPADASALYARNILDFLKL
FT                   TLSAEGFSVNLEDDIVAACLMCRDGQAVRKNG"
FT   gene            293183..293491
FT                   /locus_tag="PSPA7_0276"
FT   CDS_pept        293183..293491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0276"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /note="Pyridinenucleotide transhydrogenase subunit alpha;
FT                   Nicotinamide nucleotidetranshydrogenase subunit alpha;
FT                   Annotation was generated automatically without manual
FT                   curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85692"
FT                   /db_xref="GOA:A6UXY7"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY7"
FT                   /protein_id="ABR85692.1"
FT                   /translation="MDIISDGIYNLIIFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTVTPLGKAMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAGGH"
FT   gene            293491..294927
FT                   /gene="pntB"
FT                   /locus_tag="PSPA7_0277"
FT   CDS_pept        293491..294927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PSPA7_0277"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02233"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82929"
FT                   /db_xref="GOA:A6UXY8"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXY8"
FT                   /protein_id="ABR82929.1"
FT                   /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIAV
FT                   ATTVGLVFKLGAEIATTGVGYILVGLLVGGSAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVAQLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAVARAQHA
FT                   LMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINSEFGQTDV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
FT   gene            295271..296065
FT                   /locus_tag="PSPA7_0279"
FT   CDS_pept        295271..296065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0279"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82781"
FT                   /db_xref="GOA:A6UXZ0"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ0"
FT                   /protein_id="ABR82781.1"
FT                   /translation="MATPQPVDARTQPWRETPGGDLVEFGRPVRQALHLVRHNPAQGRV
FT                   LSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPPPP
FT                   EPLAPVVEEPPPPVVDEKAVKPPPPKPVPKPKPKPKPQPRPEPAPKAVEPAPPAPPQPA
FT                   APPAPPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSEIQVQKS
FT                   SGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVGVPIDFKLN"
FT   gene            296094..296813
FT                   /gene="exbB1"
FT                   /locus_tag="PSPA7_0280"
FT   CDS_pept        296094..296813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /locus_tag="PSPA7_0280"
FT                   /product="transport protein ExbB"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82652"
FT                   /db_xref="GOA:A6UXZ1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ1"
FT                   /protein_id="ABR82652.1"
FT                   /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQDR
FT                   QFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRLER
FT                   ALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAG
FT                   PIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRVIVHP
FT                   SAARQAGNPSRNVKEAS"
FT   gene            296815..297216
FT                   /gene="exbD1"
FT                   /locus_tag="PSPA7_0281"
FT   CDS_pept        296815..297216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="PSPA7_0281"
FT                   /product="transport protein ExbD"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81241"
FT                   /db_xref="GOA:A6UXZ2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ2"
FT                   /protein_id="ABR81241.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPIN
FT                   LPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQAD
FT                   EGVNYGQVAKAMASIERAGITRLAVITAR"
FT   gene            complement(297397..297609)
FT                   /locus_tag="PSPA7_0282"
FT   CDS_pept        complement(297397..297609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0282"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80791"
FT                   /db_xref="InterPro:IPR021430"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ3"
FT                   /protein_id="ABR80791.1"
FT                   /translation="MAKKFPLHPSHPERICWGCDRYCSAQSMGCGNGASRTQHPSELFG
FT                   EDWAGEWEVEGTEDAKEQEAPARQA"
FT   gene            297822..298403
FT                   /locus_tag="PSPA7_0284"
FT   CDS_pept        297822..298403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0284"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83325"
FT                   /db_xref="GOA:A6UXZ5"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ5"
FT                   /protein_id="ABR83325.1"
FT                   /translation="MHSERVRYVLVPGWYGSEDAHWQSHWQRTLPNASRVEQKDWIAPL
FT                   RADWIAGLDAEIRRQPGPVVLIAHSLGCVTVALWAAQAERRVRDRVRGALLVAPADVER
FT                   ESCAEALRNFAPISREPLPFPAVLVGSDNDQACSPQRAMHLARAWGAETVILPEAGHIN
FT                   VKSGHGAWEAGYRHLFRLQYLIDSQARRRA"
FT   gene            complement(298411..299868)
FT                   /locus_tag="PSPA7_0285"
FT   CDS_pept        complement(298411..299868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0285"
FT                   /product="putative amidase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85153"
FT                   /db_xref="GOA:A6UXZ6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ6"
FT                   /protein_id="ABR85153.1"
FT                   /translation="MNRYPPINELVLLQAHQLAERIRLRQVSCREVMQAYLAHIERFNP
FT                   RVNALVSLLPAERLLAEAAARDDELAHGQYRGWMHGLPHAIKDLSLTRGIRTTLGSPLY
FT                   RDYVPERDGIMVERIRAAGAILIGKTNTPEFGLGSQTYNPLFGATACAYDERLSAGGSS
FT                   GGAAAALALHLVPVADGSDMMGSLRNPAAFNNVIGFRPSQGRVPFDDSADLFFDQLGYE
FT                   GPMGRSVRDTALLLSVQAGADRRAPLSIAEPGASFAAPLERDFAGTRLGWLGDLDGYLP
FT                   MQDGILQLCQRALGDFRSLGCEVEEAALGFAPERLWESWRTLRHWLVAGSLGALHADPA
FT                   KRTQLKPEALWEVENGLRLGADAVYRASVIRSDWYRAIGRLFERYDYLLLPSAQVFPFA
FT                   KEIPWPRSIEGVAMDTYHRWMEVVVPGSLSGCPVANVQAGFNAEGLPMGLQIIGPHQAD
FT                   FAVLQLAHAYEQASRWFERQPSPLLVG"
FT   gene            complement(299935..300969)
FT                   /locus_tag="PSPA7_0286"
FT   CDS_pept        complement(299935..300969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0286"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82973"
FT                   /db_xref="GOA:A6UXZ7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ7"
FT                   /protein_id="ABR82973.1"
FT                   /translation="MYQRIARIGLGLSIVLGGSAQAAGQLNVVSWSGYFSPQLLEKFEK
FT                   ESGIRVTVDSYDSNETLLAKLKQGGAGYDVAIPSQQFVPILVEERLLERFDPAAEPYYA
FT                   NLVDNLKKPAWDPEGAYSVPFIWGTTSVVLDGARYAGPADSYAVLYQPPEELRGRINMF
FT                   DSVSEVVDMASLYLGIPLCSEDPKQMQRVLDLLKAQKPFVKTYSSKAGSIRENLAAGEV
FT                   DMSMFWGGSSLRARELKPSLKYLYPKEGVLAWVDNLVIPRGSRNPDNARRFIAFLAQPE
FT                   NAALTQNFLKHQSPVKGVEPYLEPGLKDAPELHVPEGTRVVFSQTCGEAAIRLADRLWT
FT                   NLMR"
FT   gene            complement(300991..301800)
FT                   /locus_tag="PSPA7_0287"
FT   CDS_pept        complement(300991..301800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0287"
FT                   /product="putative permease of ABC transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85554"
FT                   /db_xref="GOA:A6UXZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ8"
FT                   /protein_id="ABR85554.1"
FT                   /translation="MNARLWRGGRRSVQDFPGFGAFSLLFYLYLYAPILVLVVYSFNAN
FT                   QSATVWTGFSLDWYRAAFANQALRQAAGNSLLIAVCASAAATAIATLAALGTSRGARFK
FT                   GLRLSMGTIMLPLVLPEIVVGVATLALFSTLGLSLGYGNLIIAHTVFCIPFAYLPVRAR
FT                   LDDMDLSLEQAAADLYAGPWRTLRKVTLPLLAPGIFSGLMLAFIVSLDNFVISMMVAQA
FT                   GTTTLPIFIFGLLRMGVTPDVNAVSTLILGVSVIFVSLSYLLGKPRA"
FT   gene            complement(301797..302717)
FT                   /locus_tag="PSPA7_0288"
FT   CDS_pept        complement(301797..302717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0288"
FT                   /product="putative permease of ABC transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83389"
FT                   /db_xref="GOA:A6UXZ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UXZ9"
FT                   /protein_id="ABR83389.1"
FT                   /translation="MHPTSSPGAALQRRQALRSFLGVTPALVAIGLFLVLPILIVGAYS
FT                   LMEANPYGGVNRTFSGESYVALLFERQMDDSLAFADSYLVIALRSLGIAALTTLVTLLI
FT                   GFPVAVWLVMQPPRRRGLLIFLITVPFWANLLVRTYAWILLLRGSGVINNGLLGLGLID
FT                   QPLPLLYSDGAVLLGLVYTYAPFVVLPIYATLEKMDMRLLEAAQDLYAGRLRTLRKVVL
FT                   PLARPGILAGAMLTFVPCLGAMIAPELLGGGTRMMLGNLIFRQFADARNWPLGAALSLL
FT                   LMAAVMLVLSLYAWRAGRLARGAGR"
FT   gene            complement(302742..303854)
FT                   /locus_tag="PSPA7_0289"
FT   CDS_pept        complement(302742..303854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0289"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF03459; match to
FT                   protein family HMM PF08402; match to protein family HMM
FT                   TIGR01187"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82612"
FT                   /db_xref="GOA:A6UY00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY00"
FT                   /protein_id="ABR82612.1"
FT                   /translation="MNALHSLRTHAVSIRAVRKVYGDPGSGPVALKRIDLDIRDNEFFT
FT                   LLGPSGCGKTTLLRMIAGFEFPTEGEILLYGENIAARPPFERPVNTVFQHYALFPHMSI
FT                   AENLAFGLESRPPGRSLDKAGVAERVREMLALVQMERFAERRPAQLSGGQQQRVALARA
FT                   LAPQPRVLLLDEPLSALDLKLRQAMREELKAIQAKTGITFIFVTHDQEEALTMSDRIAV
FT                   LSEGQVQQVGPPEEIYERPGNRFVADFIGETNFIEAELLRRDGSLALYRGPGGESFEAA
FT                   ARDDLAPGARVSLSIRPERLGLRDAGTGDGLPCTVQSQVYLGTDLQYRVRLADGSLLTV
FT                   RAPNATGRRFAAGEAARLAVARDSASVLLD"
FT   gene            304084..304977
FT                   /locus_tag="PSPA7_0291"
FT   CDS_pept        304084..304977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0291"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81133"
FT                   /db_xref="GOA:A6UY02"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY02"
FT                   /protein_id="ABR81133.1"
FT                   /translation="MSIPRLPPLNAVRAFEAAARLGSYVAASKALHVTQPAVGRHVRLL
FT                   EDWLGARLFERTSRGVRLTPAGRQYYAAVSAALQQIAEAGGQLGGARWLRIMAVPAFAR
FT                   RWLTPRLETLCAQRPGLKIALEPNPTFDHVEERSADLGIVYGLPGQYANPRALLIRPKV
FT                   FPVCSPAYLAAAGPLETVERLVEHKLIHVDDGEWWNLWFSAVGVDVRVSPAVLYLSNDH
FT                   ALARAEEGLGIALANEVLVRQELRSGALVRPLAAEAALESYQVLTPPGVPSADVEWFID
FT                   WLGEALREAFPDAVTC"
FT   gene            305097..306761
FT                   /gene="mdcA"
FT                   /locus_tag="PSPA7_0292"
FT   CDS_pept        305097..306761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="PSPA7_0292"
FT                   /product="malonate decarboxylase, alpha subunit"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   TIGR01110"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85208"
FT                   /db_xref="GOA:A6UY03"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY03"
FT                   /protein_id="ABR85208.1"
FT                   /translation="MTTTLSPPPQWSRRRQEKQRRLERARSLADGVVLPRDRIVAALEA
FT                   LIAPGDRVVLEGNNQKQADFLSRSLARVDPGRLHDLHMIMPSVGRPEHLDLFELGIARK
FT                   LDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLLVDLIPNVALVAGFMADREGNV
FT                   YTGPSTEDSPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSN
FT                   RMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTPAW
FT                   LDMRPEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDD
FT                   VTHVLTEEGIAYLYKARSLEERRAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDL
FT                   GIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
FT   gene            306761..307642
FT                   /gene="mdcB"
FT                   /locus_tag="PSPA7_0293"
FT   CDS_pept        306761..307642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="PSPA7_0293"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase MdcB"
FT                   /EC_number="2.4.2.52"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01874; match to protein family HMM TIGR03132"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85098"
FT                   /db_xref="GOA:A6UY04"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UY04"
FT                   /protein_id="ABR85098.1"
FT                   /translation="MNAIANLAATPRADLGECLADLAVDALIDEAELSPKPALVDRRGN
FT                   GAHADLHLGLMQASALSLWPCFKEMADAAQRHARIDARLRGVLGQLGREGEVAMLRTTE
FT                   GVNSHRGAIWALGLLVAAAALAPRRTQAGEVAARAGRIALLDDPAAASGDSHGERVRRR
FT                   YGVGGAREEARLGFPRAVRHGLPQLWRSRESGAGEQNARLDALLAIMSVLDDTCVLHRA
FT                   GRVGLAAMQEGARAVLAAGGSASLAGRRRLRELDRRLLALNASPGGAADLLAACLFLDR
FT                   LPAALGGWAGSL"
FT   gene            307644..307943
FT                   /gene="mdcC"
FT                   /locus_tag="PSPA7_0294"
FT   CDS_pept        307644..307943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="PSPA7_0294"
FT                   /product="malonate decarboxylase acyl carrier protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF06857; match to protein family HMM TIGR03130"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84687"
FT                   /db_xref="GOA:A6UY05"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UY05"
FT                   /protein_id="ABR84687.1"
FT                   /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIEVV
FT                   TSVNGSGPRWQQLFARVFAAATAPAAAIRIHDFGATPGVVRLRLEQALEEAGHD"
FT   gene            307936..308799
FT                   /gene="mdcD"
FT                   /locus_tag="PSPA7_0295"
FT   CDS_pept        307936..308799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="PSPA7_0295"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /EC_number="4.1.-.-"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   TIGR03133"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84439"
FT                   /db_xref="GOA:A6UY06"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY06"
FT                   /protein_id="ABR84439.1"
FT                   /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSPW
FT                   LERQGIVPQADDGVVIARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAEDN
FT                   RNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCFGGM
FT                   SIAAGLCSHVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFASGLAD
FT                   AYLADDLDEIRASVLAHFAKGLPARPRCRRAGDYLRRLDDLDTAGQPDAADVRRLYRGL
FT                   SQGDVA"
FT   gene            308796..309602
FT                   /gene="mdcE"
FT                   /locus_tag="PSPA7_0296"
FT   CDS_pept        308796..309602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="PSPA7_0296"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /EC_number="4.1.-.-"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF06833; match to protein family HMM TIGR03134"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85941"
FT                   /db_xref="GOA:A6UY07"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY07"
FT                   /protein_id="ABR85941.1"
FT                   /translation="MSQPSASRGQAWFQALAGNLPPRAGDPASLRVADLELDGYPARVL
FT                   AVVPDAGNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGR
FT                   REEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALRDPGV
FT                   MVHAMGKAAAARITLRSVEELEALAAQVPPMAYDIDSYASLGLLWKTLEVEAIEAPTTN
FT                   DLARVRECLGAALLDILAGPRDLGGRLGAANREASARVRRLLREQW"
FT   gene            309618..310310
FT                   /gene="mdcG"
FT                   /locus_tag="PSPA7_0297"
FT   CDS_pept        309618..310310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcG"
FT                   /locus_tag="PSPA7_0297"
FT                   /product="holo-ACP synthase, malonate
FT                   decarboxylase-specific"
FT                   /EC_number="2.7.7.61"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   TIGR03135"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81519"
FT                   /db_xref="GOA:A6UY08"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY08"
FT                   /protein_id="ABR81519.1"
FT                   /translation="MVIANSSQRGSSRRRLAPVPMREASAPEPHDLLLGMAPEHLADDA
FT                   PPWAREVLAAGWPVVVRRAPGDPATVAIGVRGPAREQRWAGWMPLVAITRRLRPEALCQ
FT                   REPPLSRDLPAWRALRQLRAPLNALGLAWGVIGGAGFELASGVAVLHPDSDLDLLLRTP
FT                   RPFPRDDALRLLRCFEHCPCRIDLQLQTPAGGVALREWAEGRPRVLAKGVEAPVLLEDP
FT                   WRVAEIGA"
FT   gene            310307..311239
FT                   /gene="mdcH"
FT                   /locus_tag="PSPA7_0298"
FT   CDS_pept        310307..311239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcH"
FT                   /locus_tag="PSPA7_0298"
FT                   /product="malonate decarboxylase, epsilon subunit"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00698; match to protein family HMM TIGR03131"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83602"
FT                   /db_xref="GOA:A6UY09"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY09"
FT                   /protein_id="ABR83602.1"
FT                   /translation="MSTLFAYPGQGAQRPGMLAALPDEPVVRDCLAQAADCLGQAPAEL
FT                   DSAEALRGTRAVQLCLLIAGVAASRLLEQRGHRPGLVAGLSIGAYAAAVAAGALDFDDA
FT                   LRLVALRGELMQAAWPQGYGMSAILGLDQAQLEALIQAVRRAHPSLYLANVNGERQLVV
FT                   AGSDAALAALAERARDAGASAAKRLAVSVPSHCPLLDEPAARLAEAFAGIRLRRPRVPY
FT                   LSGSRARLVGDPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARP
FT                   LFGCATPAFEGTHPDTLDALLREEERRTR"
FT   gene            311295..311699
FT                   /gene="madL"
FT                   /locus_tag="PSPA7_0299"
FT   CDS_pept        311295..311699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madL"
FT                   /locus_tag="PSPA7_0299"
FT                   /product="malonate transporter, MadL subunit"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF03817; match to protein family HMM TIGR00807"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83408"
FT                   /db_xref="GOA:A6UY10"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY10"
FT                   /protein_id="ABR83408.1"
FT                   /translation="MIIYGVALLSLCTLAGLFIGEVLGVLLGVPANVGGVGIAMLLLIF
FT                   VGSYLGKRGLLSAKTEQGVEFWSAIYIPIVVAMAAQQNVIGALSGGPAAILAGIAAVAV
FT                   AFALVPLLDRVGRGKPEGVPPLKPHTSAQG"
FT   gene            311705..312469
FT                   /gene="madM"
FT                   /locus_tag="PSPA7_0300"
FT   CDS_pept        311705..312469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madM"
FT                   /locus_tag="PSPA7_0300"
FT                   /product="malonate transporter, MadM subunit"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF03818; match to protein family HMM TIGR00808"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82958"
FT                   /db_xref="GOA:A6UY11"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY11"
FT                   /protein_id="ABR82958.1"
FT                   /translation="MIESLNKVINGYGLISGFAIIGVTMALSYWLSARLTRGRLHGSAI
FT                   AIFLGLLLSYVGGLATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELRRA
FT                   GVSGVASLFLGVGSSFVAGVGVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGASSE
FT                   VMALSIAAGLVKAILVMVLTPFIAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAATDPKL
FT                   VPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
FT   gene            complement(312580..313509)
FT                   /locus_tag="PSPA7_0301"
FT   CDS_pept        complement(312580..313509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0301"
FT                   /product="MdcR"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81583"
FT                   /db_xref="GOA:A6UY12"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037400"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY12"
FT                   /protein_id="ABR81583.1"
FT                   /translation="MLIDEEITLKKLETFLAFMRTGNLARAAVELGTSNVSVHRAIHSL
FT                   ESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQEVLDTVRLTREAAGFSAERFKLGAL
FT                   YSLTVKTVPQLIMGLKLRRSALNIDLILGSNVDLFYQLKNMELDAILVSLNDSVSDPDC
FT                   ECLPLFSDDIYLAVPVDSPYAGLAEIDLSTLRDAPFVTLTQGFATHQDGTRVFRQAGFE
FT                   PQIAMQVNDIFTLLSMVSSGVGYALLPKRIEAVYENRVRLIPLQPRYRLQQHIGVVFLK
FT                   AKERDPNLLALLAECRMHSLRLEQEATG"
FT   gene            complement(313695..314126)
FT                   /locus_tag="PSPA7_0302"
FT   CDS_pept        complement(313695..314126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0302"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83970"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY13"
FT                   /protein_id="ABR83970.1"
FT                   /translation="MKKYLLPAFLFAAASLTGCTSYNISQPSAPVDGLVKTDLKADVAV
FT                   GAPISGQSSVNILFGFIRFGGDSQFADGVTYGGGESGLGLGFDPISSTKAAAAFKAVKS
FT                   ADADLIVAPRYEVAVNDYFVFKKVDVKVTGSKGTIQSIR"
FT   gene            complement(314318..315238)
FT                   /locus_tag="PSPA7_0303"
FT   CDS_pept        complement(314318..315238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0303"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82294"
FT                   /db_xref="GOA:A6UY14"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY14"
FT                   /protein_id="ABR82294.1"
FT                   /translation="MASYTLRQLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEES
FT                   FGVQLFIRHHAQGVSLTPAGARFYRKAQELLRMAHEFEQNALADNDVIAGQIDIGCFET
FT                   VAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIETEP
FT                   LMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPSRTYFVSLFEELGLTPNIA
FT                   FSSPSIEMVRGMVGQGFGFSLLVTRPHSECTYDGKKVVMVDLAEPVSTSGLAAAWLKRA
FT                   QLTKPARLFVDYCREQLGKLAVRRY"
FT   gene            315589..317079
FT                   /locus_tag="PSPA7_0305"
FT   CDS_pept        315589..317079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0305"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84927"
FT                   /db_xref="GOA:A6UY16"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY16"
FT                   /protein_id="ABR84927.1"
FT                   /translation="MFELSDWQRRAATQRFIDQALIGGRQRPAASGATFDAIDPASNRL
FT                   LARVAACDATDVDAAVAAARRAFDEGPWARLAPVERKRVLLRLAELMLAHREELALLDS
FT                   LNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYDQVAPTAREALATITRVPLGVIGAVV
FT                   PWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSALRLAELALEAGVPEGVLNVVPGLG
FT                   EQAGKALGLHPEVDALVFTGSTEVGKYFMQYSAQSNLKQVWLECGGKSPNLVFADCRDL
FT                   DLAAEKAAFGIFFNQGEVCSANSRLLVERSIHDEFVERLLAKARDWQPGDPLDPASRAG
FT                   AIVDRRQTAGILAAIERAQGEGATLLGGGRRLTINGSDNFIEPTLFGGVRPDMQLAREE
FT                   IFGPVLAISAFDSEDEAIRLANDSRYGLAASLWSDDLHRAHRVARRLNAGTVSVNTVDA
FT                   LDVAVPFGGGKQSGFGRDLSLHSFDKYTQLKTTWFQLR"
FT   gene            317137..318570
FT                   /locus_tag="PSPA7_0306"
FT   CDS_pept        317137..318570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0306"
FT                   /product="putative amino acid permease"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86912"
FT                   /db_xref="GOA:A6UY17"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY17"
FT                   /protein_id="ABR86912.1"
FT                   /translation="MNDTPNVREPALRRVLGLGPLLAVAIGLVVSQGVMVLMLQGAGTA
FT                   GPGFIVPLGVAYLLALSYAFSFSELALMIPRAGGLSSYTEVAIGHFPAILATFSGYVVV
FT                   AMFALSAELLLLDLIIGKVYPGALPPMLVAYGVLGLFTLLNLLGIDIFARLQSALALLM
FT                   MIVLLVLGLGAVSSEHASAQTALASGWNPLGVSALALTAMAVWGFVGAEFVCPLVEETR
FT                   RPERNIPRSMILGLSIIFLTIALYCFGALLCIPQAELAGDPLPHFLFANRVFGEYGQLF
FT                   LVIAAITATCSTLNSSLAAIPRMLYGMAQNGQAFPQFRQLSRRARTPWVAVLFVAAITG
FT                   LPILILGQDPDSINLLLLAAALAWLLAYIIAHVDVLALRRRYPHIARPFRTPFYPLPQL
FT                   FGIAGMIYAVVHVSPTPEMTGRIFASAGVVLGVVSLVAVVWIKGVMRKPLFVPEPLETA
FT                   GETAQGKSVALDPLQSPSA"
FT   gene            318601..319983
FT                   /locus_tag="PSPA7_0307"
FT   CDS_pept        318601..319983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0307"
FT                   /product="putative aminotransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85304"
FT                   /db_xref="GOA:A6UY18"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY18"
FT                   /protein_id="ABR85304.1"
FT                   /translation="MTAQLNPQRDTRDYQQLDAAHHIHAFLDQKALNREGPRVMVRGNG
FT                   LQLWDNDGKRYLDGMSGLWCTNLGYGRQDLAAAASRQLEQLPYYNMFFHTTHPAVVELS
FT                   ELLFSLLPDHYSHAIYTNSGSEANEVLIRTVRRYWQILGKPQKKIMIGRWNGYHGSTLG
FT                   STALGGMKFMHEMGGMLPDFAHVDEPYWYANGGELSPAEFGRRAALQLEEKILELGAEN
FT                   VAAFVAEPFQGAGGMIFPPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHFG
FT                   FQPDTLSIAKGLTSGYIPMGGLVLGKRIAEVLVEQGGVFAHGLTYSGHPVAAAVAIANL
FT                   KALRDEGVVTRVRDETGPYLQGCLREVFGAHPLVGEVQGAGFVAALQFAEDKATRRRFA
FT                   NENELAWRCRTIGFEEGVIIRSTLGRMIMAPALVAGRAEIDELIDKTRIAVDRTAREIG
FT                   VL"
FT   gene            320147..321205
FT                   /locus_tag="PSPA7_0308"
FT   CDS_pept        320147..321205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0308"
FT                   /product="spermidine/putrescine ABC transporter
FT                   substrate-binding protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85537"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY19"
FT                   /protein_id="ABR85537.1"
FT                   /translation="MYKSLHQCAHVFSRLSLFGLAFAAAVQAQGQSLTVISFGGATKAA
FT                   QEQAYFKPFERSGGGRVVAGEYNGEMAKVKAMVDVGKVSWDVVEVESPELLRGCDEGLF
FT                   ERLDPARFGDPAQFVPGTFSECGVATYVWSMVLAYDSTKLARAPQSWADFWNVREFPGK
FT                   RGLRKGAKYTLEVALLADGVKAEDIYKVLATPEGVSRAFAKLDQLKPNIQWWEAGAQPP
FT                   QWLAAGDVVMSAAYNGRIAAAQKEGVKLAIVWPGSLYDPEYWAVVKGTPNKALAEKFIA
FT                   FASQPQTQKVFSEQIPYGPVHKGTLALLPETVQEALPTAPANLEGARAVDAGFWVDHGE
FT                   ELEQRFNAWAAR"
FT   gene            complement(321283..322164)
FT                   /locus_tag="PSPA7_0309"
FT   CDS_pept        complement(321283..322164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0309"
FT                   /product="putative dihydrodipicolinate synthetase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00701"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83610"
FT                   /db_xref="GOA:A6UY20"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY20"
FT                   /protein_id="ABR83610.1"
FT                   /translation="MSAPIHGIIGYTITPFAADGALDLPALGRSIERLINGGVHAIAPL
FT                   GSTGEGAYLSDPEWDEVVDFTLKTVAHRVPTIVSVSDLTTAKTVRRAQFAESLGAEAVM
FT                   VLPISYWKLNEAEVFQHYRAVGEAIGVPVMLYNNPGTSGIDMSVELILRIVREVDNVTM
FT                   VKESTGDIQRMHKLRLLGEGRVPFYNGCNPLALEAFVAGAKGWCTAAPNLIPTLNGQLY
FT                   QAVLDGDLERARALFYRQLPLLDFILRRGLPTTIKAGLALSGLEVGAPRLPVQALDTEG
FT                   CRYLQGLLEELR"
FT   gene            complement(322224..323006)
FT                   /locus_tag="PSPA7_0310"
FT   CDS_pept        complement(322224..323006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0310"
FT                   /product="putative aldolase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83740"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY21"
FT                   /protein_id="ABR83740.1"
FT                   /translation="MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFEA
FT                   GHDSGLAGQITSRGPETGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPANRF
FT                   HSWVYRARPDVNCIIHTHPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVPVGN
FT                   EEGEIISAALGDKRAILLSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGEIKPI
FT                   PPTLAREAHDWISTPKRHGAAFNYYARRCLPRNSDCLS"
FT   gene            323160..323699
FT                   /locus_tag="PSPA7_0311"
FT   CDS_pept        323160..323699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0311"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01381; match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83269"
FT                   /db_xref="GOA:A6UY22"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY22"
FT                   /protein_id="ABR83269.1"
FT                   /translation="MSMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSIAAA
FT                   LKLAKALNVQVEELFCEENDGLDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARALLP
FT                   FIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHRIRS
FT                   LGETQAELLVVIHSEE"
FT   gene            323928..324779
FT                   /locus_tag="PSPA7_0312"
FT   CDS_pept        323928..324779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0312"
FT                   /product="putative CoA transferase, subunit A"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01144"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82401"
FT                   /db_xref="GOA:A6UY23"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY23"
FT                   /protein_id="ABR82401.1"
FT                   /translation="MAEILSLREAVQRFVHDGDSVALEGFTHLIPTAAGHELIRQGKKD
FT                   LTLIRMTPDLVYDLLIGAGCARKLVFSWGGNPGVGSLHRLRDAVEKGWPQPLEIEEHSH
FT                   ADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDVSVI
FT                   HAQKADRKGNVLLWGILGVQKEAALAARRCIVTVEEIVDELDAPMNACVLPSWALSAVC
FT                   LVPGGAHPSYAHGYYERDNRFYQDWDPIARDRDAFTAWIDDYIRGTEDFGAFQAKLAEG
FT                   KR"
FT   gene            324776..325558
FT                   /locus_tag="PSPA7_0313"
FT   CDS_pept        324776..325558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0313"
FT                   /product="putative CoA transferase, subunit B"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01144"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85606"
FT                   /db_xref="GOA:A6UY24"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY24"
FT                   /protein_id="ABR85606.1"
FT                   /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSPD
FT                   VVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQV
FT                   DRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAREVLIILKQSHRTFVDKLAFVTSVG
FT                   HGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEATGWAI
FT                   RFAERVAETPAPNEVELTALRDLEARTAAAHGQKGSDE"
FT   gene            325555..326760
FT                   /gene="pcaF"
FT                   /locus_tag="PSPA7_0314"
FT   CDS_pept        325555..326760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="PSPA7_0314"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00108; match to protein family HMM PF02803; match to
FT                   protein family HMM TIGR01930; match to protein family HMM
FT                   TIGR02430"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83493"
FT                   /db_xref="GOA:A6UY25"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY25"
FT                   /protein_id="ABR83493.1"
FT                   /translation="MSREVFICDAVRTPIGRFGGSLAAVRADDLAAVPLKALVERNPGV
FT                   DWSALDEVFLGCANQAGEDNRNVARMALLLAGLPESVPGVTLNRLCASGMDAIGTAFRA
FT                   IASGEMELAIAGGVESMSRAPYVMGKADSAFGRGQKIEDTTIGWRFVNPLMKEQYGIDP
FT                   MPQTADNVADDYRVSRADQDAFALRSQQRAGRAQAAGFFAEEIVPVTIRGRKGDTLVEH
FT                   DEHPRPDTSLEALARLKPVNGPEKTVTAGNASGVNDGAAALILASAEAVERHRLTPRAR
FT                   VLGMASAGVAPRIMGIGPVPAVRKLLRRLDLAIDAFDVIELNEAFASQGLACLRELGVA
FT                   DDSEKVNPNGGAIALGHPLGMSGARLVLTALHQLEKSGGRRGLATMCVGVGQGLALAIE
FT                   RV"
FT   gene            326913..328214
FT                   /gene="pcaT"
FT                   /locus_tag="PSPA7_0315"
FT   CDS_pept        326913..328214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaT"
FT                   /locus_tag="PSPA7_0315"
FT                   /product="dicarboxylic acid transporter PcaT"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00083; match to protein family HMM PF07690; match to
FT                   protein family HMM TIGR00883"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86488"
FT                   /db_xref="GOA:A6UY26"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY26"
FT                   /protein_id="ABR86488.1"
FT                   /translation="MTAPVHQYSHEERRKRIFAIVGASSGNLVEWFDFYVYAFCAIYFA
FT                   PAFFPSDNPTVQLLNTAGVFAAGFLMRPIGGWMFGRIADKHGRKTAMLISVVMMCAGSL
FT                   AIACMPTYASIGTLAPTLLLLARMFQGLSVGGEYGTSATYMSEVALKGQRGFFASFQYV
FT                   TLIGGQLLAVLVVVILQQLLSEDELRAWGWRIPFVIGAITAVIALWLRRSLNETASKST
FT                   LERKESGTFAELFGKHKRAFFTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAKTASAV
FT                   MTFALLAYMLMQPLFGMLSDRIGRKTSMLWFGALGTLCTLPILLALKTVSSPYMAFFLI
FT                   ILALAIVSLYTSISGLIKAEMFPPEVRALGVGVSYAVGNAIFGGSAEYVALGLKSVGME
FT                   NVFYWYVSAMCLLALLVCVSLPDLRKVSYLNDEP"
FT   gene            328237..329616
FT                   /gene="pcaB"
FT                   /locus_tag="PSPA7_0316"
FT   CDS_pept        328237..329616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="PSPA7_0316"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00206; match to protein family HMM TIGR02426"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83863"
FT                   /db_xref="GOA:A6UY27"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY27"
FT                   /protein_id="ABR83863.1"
FT                   /translation="MSDVPANQLFDAYFTAAPMRAVFSDRGRLQGMLDFEAALARAEAR
FT                   VGVVPATAVAPIEAACRAELYDPLALAEAVANAGNSAIPLVKALGRQVAAGDAEAERYI
FT                   HLGATSQDAMDSGLVLQLRRALALLEEDLQRLAAALADQAARHADTPLAGRTWLQHATP
FT                   VTLGMKLAGLLGALTRHRQRLRELRPRLLVLQFGGASGTLAALGEQALPVAAALAEELG
FT                   LALPEQPWHTQRDRLVEFASVLGLVAGSLGKLGRDVSLLMQTEAGEVFEPAGTGRGGSS
FT                   TMPHKRNPVGSAVLIAAATRAPGLVSTLFAAMPQEHERSLGLWHAEWETLPELCCLVSG
FT                   ALRQAIGLLEGLEVDAGRMRRNLGLTHGLVLAEAVSIALARRIGREAAHHLVEQCCRRA
FT                   VEQRRGLRAVLGEEARVSAELSGDELDRLLDPAHYLGQARAWVERALAEHHALGFEPHP
FT                   A"
FT   gene            329631..330422
FT                   /gene="pcaD"
FT                   /locus_tag="PSPA7_0317"
FT   CDS_pept        329631..330422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaD"
FT                   /locus_tag="PSPA7_0317"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00561; match to protein family HMM TIGR02427"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86164"
FT                   /db_xref="GOA:A6UY28"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY28"
FT                   /protein_id="ABR86164.1"
FT                   /translation="MPTVRLADGDLNYSLEGPAGAPVLLLSNSLGTDLGMWDTQIPALT
FT                   AHFRVLRYDTRGHGASLVTPGPYTIGQLGADVVALLDALDLPRVHFCGLSMGGLIGQWL
FT                   GIHAGARIGRLVLCNTAAKIASDEVWNTRIDTVLKGGEQAMRDLRDASLARWFTAGFAE
FT                   REPAQAERIVAMLAATSPQGYAANCAAVRDADFREQLELVQAPTLVVAGSHDAVTTPDD
FT                   ARFMQARIADAQLVVFAAAHLSNVEAGDAFSRRLVDFLLSA"
FT   gene            330433..330834
FT                   /gene="pcaC"
FT                   /locus_tag="PSPA7_0318"
FT   CDS_pept        330433..330834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="PSPA7_0318"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02627; match to protein family HMM TIGR02425"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83196"
FT                   /db_xref="GOA:A6UY29"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY29"
FT                   /protein_id="ABR83196.1"
FT                   /translation="MDEKQRYEAGMQVRRAVLGDAHVDRSLASLTPFNEEFQEMITRHA
FT                   WGDIWTRPGLPRHTRSLVTIAMLIGMNRNEELKLHLRAAKNNGVSRDEIKEVIMQSAIY
FT                   CGIPAANATFHLAESVWDELGVESQQETR"
FT   gene            330985..331926
FT                   /locus_tag="PSPA7_0319"
FT   CDS_pept        330985..331926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0319"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83200"
FT                   /db_xref="GOA:A6UY30"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY30"
FT                   /protein_id="ABR83200.1"
FT                   /translation="MSRKLHIHAPAIHYFDMVRRCDSIREAARRLNVASSAVNRQILKL
FT                   EDEIGAPLFDRLPGGLRLTGAGEIFARHVTVVLQDMERVRSELDALQGLCTGHVEIATI
FT                   EAVTSDLLPCVLKAMRERYPDVTVGVTLLGSQAIPDAVASGAVDLGLAFALPRSADLQQ
FT                   ISVGHFRLGAIVAPQHPLARRDAITFADCAGHGLIMAKSELSIHHLLAPLQRRLREPCR
FT                   AALESSSLELSRQLARRGLGVAFQTRLGIEADIASGELRFLPLQDNGGIHSDLGLYVRT
FT                   GRYLPVAVDALARQIAEEVRLREREEARLNDA"
FT   gene            332106..332939
FT                   /locus_tag="PSPA7_0320"
FT   CDS_pept        332106..332939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0320"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85204"
FT                   /db_xref="GOA:A6UY31"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY31"
FT                   /protein_id="ABR85204.1"
FT                   /translation="MKKMMRGAAALVALVGAGESMALEWMSNSVGFRYGQQFTNPNNPD
FT                   KFAKRIYSFTHADGYRYGSNFFNLDVFLSDSRDPRKGTDHGGSEVYAVYRHQLYASRVF
FT                   DRPLGTGLVKDYAFTLGFDASRNNNLASAKKRALVFGPTLKFNGPGVLDLSLLYYREKN
FT                   HFGVPGARHPDHTFDTTYMLNLTWMRPFKVGNHAAKFQGFVNYVGEKGEDYNDKDTAAE
FT                   TLVRAALMVAALPGDKRQPNLWLGVGYEYWHNKFGVDGGTGSRTSTPTLNMEFTF"
FT   gene            complement(333059..334405)
FT                   /gene="pcaK"
FT                   /locus_tag="PSPA7_0321"
FT   CDS_pept        complement(333059..334405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="PSPA7_0321"
FT                   /product="4-hydroxybenzoate transporter PcaK"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00083; match to protein family HMM PF07690; match to
FT                   protein family HMM TIGR00895"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82296"
FT                   /db_xref="GOA:A6UY32"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY32"
FT                   /protein_id="ABR82296.1"
FT                   /translation="MNSSSLPAVERLDVQAFINAQPLSPYQWRIVLLCFLIVFLDGLDT
FT                   AAMGFIAPALTQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRYGRKLVLVAAVFLF
FT                   GLFSLASAYSTNVEQLLALRFLTGLGLGAAMPNATTLLSEYTPERLKSLLVTSMFCGFN
FT                   LGMACGGFVSAKLIPLFGWHSLLLLGGLLPLALALVLLFRLPESARYLVVRNRGSERVR
FT                   RALAPIAPAQVALAQGFHVPEQHTVQARNVFAVIFSGTYSAGTLLLWLTYFMGLVIVYL
FT                   LTSWLPTLMRDSGASLEQAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGLFYLLAGV
FT                   FAWCVGQSLGQVTLLATLVLLAGMCINGAQSAMPSLAARFYPTQGRATGVSWMLGIGRF
FT                   GAILGAWIGATLLGLGWNFEQVLTALVLPAALATAAVLLKGLVSHADAG"
FT   gene            334694..335572
FT                   /locus_tag="PSPA7_0323"
FT   CDS_pept        334694..335572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0323"
FT                   /product="membrane protein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85541"
FT                   /db_xref="GOA:A6UY34"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY34"
FT                   /protein_id="ABR85541.1"
FT                   /translation="MNATSSALPGNDQPLRGIFLICAAVFLFASHDGLSKFLSGFYPIV
FT                   MVVWARYLVHTLLMVVVFVPRNGLAVIRTRRPFMQLARALCLIGTSLFFTTGLRYLPLA
FT                   EATAVNFLAPLLVTALSVPLLKEKVSPGQWLAVLTGFVGVLFIVRPGGALFTPAALFPL
FT                   GSALCFGLYQLLTRMLANSDSPTTSNFLAGIFNTLIMSLLVPFFWQTPSLLHGLMMIAL
FT                   GGCGMGGHLLLTQAFRHAPPATLAPFSYGQIIFAGLLGLLVFGHAPDAWALLGILVICA
FT                   SGLLVAWRRGR"
FT   gene            complement(335600..336850)
FT                   /locus_tag="PSPA7_0324"
FT   CDS_pept        complement(335600..336850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0324"
FT                   /product="putative porin"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84934"
FT                   /db_xref="GOA:A6UY35"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY35"
FT                   /protein_id="ABR84934.1"
FT                   /translation="MSHPSLVRALCASLCLGAGLPVHAERGFLEDAKVSLTARNFYLNR
FT                   DFVGHASQDKAEEWTQSFILDARSGFTEGSVGFGLDVLGLYSLKLDGGKGTAGTQLLPT
FT                   HGDGRPADDFGRLAVAGRLRVSNTELKLGEWMPVLPILRSDDGRSLPQTFRGGQLSASE
FT                   IAGLTLHAGQLRGNSPRNDASMQDMSLFGRPAATSDRFDFVGGEYRFNGERTLLGLWHA
FT                   ELKDIYRQQYLQLQHSQPLGGWLLGANLGWFRGRDDGSARAGELDNRTVSALFSVRHGL
FT                   HALYLGLQKVGGDDGWMRVNGTSGGTLANDSYNASYDNPGERSWQLRYDFDFVGLGLPG
FT                   LTFMTRYLHGSHVRLAGVTDDGSEWGRESELGYTVQGGAFKRLNLRWRNSSQRRDWGSN
FT                   TRFDENRLIVSYPLGLF"
FT   gene            complement(336916..338244)
FT                   /locus_tag="PSPA7_0325"
FT   CDS_pept        complement(336916..338244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0325"
FT                   /product="putative MFS transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84677"
FT                   /db_xref="GOA:A6UY36"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY36"
FT                   /protein_id="ABR84677.1"
FT                   /translation="MIHSSSSRLPAADTAARATRGGRMRSALAVGHTRWGMLALVFFAT
FT                   TLNYIDRAALGVMQPILAEKMSWTAMDYANINFWFQVGYAIGFILQGRFIDRVGVKRAF
FT                   FLAVLLWSLTTGLHGLATSAAGFMLCRFVLGLTEAANYPACVKTTRLWFPAGERAVATG
FT                   IFNAGTNVGAMVTPALLPLVLSVWGWQAAFLCMSALGLVWLAFWWRNYHNPEEHPRVRR
FT                   SELDYIQQQEEPPVTRVPFSRILRRRGTWAFALAYSITAPVFWFYLYWLPPFLNQQYGL
FT                   GISVTQMGIPLILIWLTADFGSIGGGILSSWLVGRGMPAVRARLLSMLLFACTIVGVVF
FT                   AANADGLWIAVLAIALAVGAHQAWTANIWSLVMDYTPRHLMSTVFGFGGMCAALGGMFM
FT                   TQLVGGVLTATNNNYAVLFCMIPAMYFIALAWLYFMAPRRIEA"
FT   gene            338772..340676
FT                   /locus_tag="PSPA7_0327"
FT   CDS_pept        338772..340676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0327"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84446"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY38"
FT                   /protein_id="ABR84446.1"
FT                   /translation="MQRSIATVSLSGTLPEKLEAIAAAGFDGVEVFENDLLHYDGSPRD
FT                   VRRLCADLGLDILLFQPFRDFEGCRRERLARNLERAERKFDLMQELGTDLVLVCSNVAA
FT                   DALGEPALLVDDLRLLAERAAARGLRIGYEALAWGRQVSTWEQAWELVRRADQPNLGLI
FT                   LDSFHTLSLNGDARGIAGLPAEKIFFVQMADAPLLAMDVLEWSRHFRCFPGQGGFDLAG
FT                   FLAPIVASGYRGPLSLEVFNDGFRAAPTRANAADGLRALLYLEEKTRERLRREAPQVAV
FT                   DGLFAPPPASVCDGIEFLEFAVDEALRARLGQWLRQLGFARVGQHRSKNVSLLRQGGIN
FT                   LVLNAEPYSFAHGFFEAHGPSLCATALRVRDAGQALERARRYGGQPYRGLVGPNEREIP
FT                   AVRALDGSLLYLVEQEGGGRDIYQTDFEMTGEATPGLGLRRIDHVAMALPAEGLDSWVL
FT                   FYKSLFDFSADDEVVLPDPYGLVTSRAVRSRCGQVRLPLNISEDRNTAIARALSSYRGS
FT                   GVHHIAFDCADIFAAVAQAKEAGLTLLEIPLNYYDDLAARFDFTEEFLSELAYYNVLYD
FT                   RDAQGGELFHVFTEPFEERFFFEILQRRHGYAGYGAANVAVRLAAMAQARRGVRRVKL"
FT   gene            340769..341437
FT                   /locus_tag="PSPA7_0328"
FT   CDS_pept        340769..341437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0328"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86770"
FT                   /db_xref="GOA:A6UY39"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY39"
FT                   /protein_id="ABR86770.1"
FT                   /translation="MSNPDPAAVEAPAPRGKGRKNNPEKTRQDILRAAADEFVAQGLSG
FT                   ARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIENSLQLGELPPVKAMRK
FT                   LVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNGSIVQGIAEILRRGEAEGV
FT                   FRPGLVALDVHLLISSFCFYRVSNRYTVSRIFRTDLHDAGVRQRHLEMICEAVLRYLRA
FT                   "
FT   gene            complement(341502..342356)
FT                   /locus_tag="PSPA7_0329"
FT   CDS_pept        complement(341502..342356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0329"
FT                   /product="shikimate dehydrogenase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85570"
FT                   /db_xref="GOA:A6UY40"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY40"
FT                   /protein_id="ABR85570.2"
FT                   /translation="MSRPRSVLAGLIGAGIQASRTPALHEHEGDAQGIRYLYRLIDLDL
FT                   LGKSADDLESLLAAASDLGFTGLNVTFPCKQAIIPLLDELSAEARGIGAVNTVVLRDGR
FT                   RIGHNTDCLGFAEGFRRGLADAPRQRVVQLGAGGAGAAVAHALLAEGVERLILFDVETA
FT                   RAQALADNLNAHFGAARTLAGNDLASALGAAQGLVNTTPVGMAKLPGMPLPAELLRSEL
FT                   WVAEVIYFPLETELLRQARALGCRTLDGGSMAVFQAVKAFELFSGVKADAARMQAHFAS
FT                   LGD"
FT   gene            complement(342353..342799)
FT                   /gene="aroQ2"
FT                   /locus_tag="PSPA7_0330"
FT   CDS_pept        complement(342353..342799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ2"
FT                   /locus_tag="PSPA7_0330"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01220; match to protein family HMM TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82604"
FT                   /db_xref="GOA:A6UY41"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY41"
FT                   /protein_id="ABR82604.1"
FT                   /translation="MTRTVLVLNGPNLNLLGTREPRTYGRQTLAGIAAQCAAFAESRGF
FT                   AVEFRQTNHEGELLDWIHQARGRIAGLVINPAAWTHTSVALRDALAAVELPVLEVHLSN
FT                   VHQREPFRHHSHVSPLATGVICGLGGLGYRLALEYFASQFEAAA"
FT   gene            complement(342916..344421)
FT                   /locus_tag="PSPA7_0331"
FT   CDS_pept        complement(342916..344421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0331"
FT                   /product="MFS transporter"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84302"
FT                   /db_xref="GOA:A6UY42"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY42"
FT                   /protein_id="ABR84302.2"
FT                   /translation="MPELAHNPPVVRTVLVGLMLSIFLSALDQTIVAVSLPAISADFAD
FT                   LDLLAWVISGYMVAMTVSMPIYGKLGDLYGRRRLMLFAIAVFSAASLLCGLAQSMGQLV
FT                   LGRVLQGIGAGGLMAVSQAIVGDIVPPRERGRYQGYFSSMYAIASVAGPVLGGLLTEYL
FT                   SWRWVFWINLPIGLLALAISRRTLVGLPVPRRQPLIDYPGIALMVVGLTALLLGITQIG
FT                   QGVAWNDPALLGLFALAAVVLLLFILQERRFREPLVPMQLFCIRAATLSWLVAFFASFQ
FT                   AISLTVLVPLRYQSVTGAGADSAALHLLPLVMGLPLGAYCCGRLTASLGRYKPLILGGA
FT                   LLLPCSIAGLALTPATHPWLSGLFMLLTGIAVGTQFPTSLVAAQNAVEQRHIGVATSNA
FT                   TLFRSLGGAVGVALMSAILLALLKHLRIGGGIDQGFSESALLSSLNAASGPAQIIFQHV
FT                   LADAFKVLFLINAAVALLGLAVAAALPDMPLRGRPVAEPAAGE"
FT   gene            complement(344581..345765)
FT                   /gene="pobA"
FT                   /locus_tag="PSPA7_0332"
FT   CDS_pept        complement(344581..345765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="PSPA7_0332"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01494; match to protein family HMM TIGR02360"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80760"
FT                   /db_xref="GOA:A6UY43"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY43"
FT                   /protein_id="ABR80760.1"
FT                   /translation="MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQAPDYVLGRIRA
FT                   GVLEQGMVDLLREAGVDQRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGRTVTVYGQTE
FT                   VTRDLMEARAACGATTIYQAAEVRLHDLEGEHPHVTFERDGERVRLDCDYIAGCDGFHG
FT                   VSRQSIPAERLKVFERVYPFGWLGLLADTPPVSHELIYASHPRGFALCSQRSATRSRYY
FT                   VQVPLTEKVEDWSDERFWTELKARLPAEVAQRLVTGPALEKSIAPLRSFVVEPMQHGRL
FT                   FLAGDAAHIVPPTGAKGLNLAASDVATLYHLLLKAYREDRADLLERYSAICLRRIWKAE
FT                   RFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGSEAGLATIAENYVGLPYEAVE"
FT   gene            345943..346809
FT                   /locus_tag="PSPA7_0334"
FT   CDS_pept        345943..346809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0334"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85615"
FT                   /db_xref="GOA:A6UY44"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY44"
FT                   /protein_id="ABR85615.1"
FT                   /translation="MTLPTGAVPVFKLYGEPLEWPTPDLLHCESIPARSRLHDWEIKPH
FT                   RHADLGQLLYVRRGWAQLQVEGELTRVERPAIQFVPPLCIHGFQFSERIDGYVLTLAAP
FT                   LLARLQAHLGAQRQALEAPGLYPVGADRRYIDTLFDAIDGEYAGTAPARELLLQSLIGV
FT                   LAVWLGRQVMVRRAEARPGRGQEYLSGFSQLVERHFREHLGIDEYARRLGITPAHLNGV
FT                   ARRLSGQTALGIVHQRLLLEAKRDLVYTAMTVNEIADRLGFSEPAYFTRFFKRLSGVAP
FT                   SVFRKGG"
FT   gene            complement(346806..347252)
FT                   /locus_tag="PSPA7_0333"
FT   CDS_pept        complement(346806..347252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0333"
FT                   /product="putative acetyltransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83304"
FT                   /db_xref="GOA:A6UY45"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY45"
FT                   /protein_id="ABR83304.1"
FT                   /translation="MSSPLQFRRYTPADRDATLAIWLEASRIGHGFLGEAELQKQKALV
FT                   RDHYLDASETWLALDGETPLGFIGLLDAFIGGLFVAPAAHGRGIGRQLLEHAAALKGAL
FT                   EVEVYAANREALGFYGHCGFVETGRRKEDDEGRPLEIVHLRRGD"
FT   gene            complement(347344..347778)
FT                   /locus_tag="PSPA7_0335"
FT   CDS_pept        complement(347344..347778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0335"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83978"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY46"
FT                   /protein_id="ABR83978.1"
FT                   /translation="MKTVAQLLNAKQNQQVYTIGPDEMVLDALRLMAEKNIGALLVLNH
FT                   GEVVGVVSERDYARKMVLKGRSSIGTPISAIMSAPVVSVDSKQSVDTCMNLMTDRHLRH
FT                   LPVVEEGRLLGLLSIGDLVKAAIAEQAELIQQLEQYIRGD"
FT   gene            complement(347920..348561)
FT                   /locus_tag="PSPA7_0336"
FT   CDS_pept        complement(347920..348561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0336"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82957"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY47"
FT                   /protein_id="ABR82957.1"
FT                   /translation="MNDYIARLRARYDEHFGCAPAMTLDCRGFWKHCAAVPDMAVFAYR
FT                   LENSRRAHHVAITAGMSQRPMHFAPYMGKARWSTELICYLDHLGGEDLRHLQWLAGMPF
FT                   HDQLALGRGHSVAFGFPLYEYSLLRHFLLLGTPDREDAGLFDGFADSAYPVDLLWVVPL
FT                   TEPEYQVKVKRNLEGIGALLSQSAHPLSLDRHRHCYVTGERPEGLGRVLH"
FT   gene            complement(349039..349488)
FT                   /locus_tag="PSPA7_0337"
FT   CDS_pept        complement(349039..349488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0337"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85993"
FT                   /db_xref="GOA:A6UY48"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY48"
FT                   /protein_id="ABR85993.1"
FT                   /translation="MNETNALGLPRGPLNLMTEIVRQRERQLTALLAPLGLGLHEWRAL
FT                   RIIHAFDGDVPMSLLIEHSQTDRTALGRTIERLVQRGWASRLPDPEDGRAVLVRRSRAA
FT                   QAVFEQALERVARLDEALLASLEAGEDGTLVVALGKLLRALDGRS"
FT   gene            complement(349541..351031)
FT                   /locus_tag="PSPA7_0338"
FT   CDS_pept        complement(349541..351031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0338"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01977; match to protein family HMM TIGR00148"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84897"
FT                   /db_xref="GOA:A6UY49"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032903"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY49"
FT                   /protein_id="ABR84897.1"
FT                   /translation="MNRSALDFRHFIDHLRHQGDLVDIHAEVDADLEIGAITRRVYERG
FT                   APAPLFHTIRGSLPGARILGAPAGLRADKARAHGRLALHFGLPDHSGPREIVAALRAAM
FT                   RAAPIAPRRVERGPVQENVWIGERVDLTRFPVPLLHAQDGGRYFGTYGFHIVQTPDRRW
FT                   DSWSVGRLMLVDRNTLAGPTIPTQHIGIIREQWRRQGRPTPWAMALGAPPAALAAAGMP
FT                   LPEGVSEADYVGALVGEPVEVVRARTNGLWVPANAEIVLEGEISLDETALEGPMGEYHG
FT                   YCFPTGKPQPLFHVHAVTFRDQPILPICVAGTPPEENHTIWGTMISAQLLDVLQDAGLP
FT                   VDMTWCSYEAATCWAVLSIDVQQLAALRTDAAAFAARIAEVAFGSHPGHLVPKLILVGN
FT                   DIDVSEIDQVVWALATRAHPLHDHFVFPAIRDFPMVPYLDAEDRARGSGGRLVINCLYP
FT                   EQFAGRMRASTASFRHSYPPALRQRVEERWREYGFADD"
FT   gene            complement(351163..351864)
FT                   /locus_tag="PSPA7_0339"
FT   CDS_pept        complement(351163..351864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0339"
FT                   /product="membrane protein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF06912"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85488"
FT                   /db_xref="GOA:A6UY50"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY50"
FT                   /protein_id="ABR85488.1"
FT                   /translation="MLPDSVVGSSARRLRLRRVRGRVGLGLVAGLSVLAGMTDAIGFLA
FT                   TGDFVSFMSGNTTRLAVSLGEGDLGGMARLAIALASFVAGNALGVILARFSGRRAAPIL
FT                   VCCAMLLALSAVWPFDWNVPALVAAIIAMGMLNAVVEQVNGLPIGLTYVTGALSRFGRG
FT                   LGRWLLGERRNGWRVQLVPWSGMCIGAVLGALLEQRLGLAAMAASAALAALLALAALVI
FT                   PRPWQMDYMAR"
FT   gene            complement(352228..352306)
FT                   /locus_tag="PSPA7_0340"
FT   tRNA            complement(352228..352306)
FT                   /locus_tag="PSPA7_0340"
FT                   /product="tRNA-Arg"
FT   gene            complement(352494..352910)
FT                   /locus_tag="PSPA7_0341"
FT   CDS_pept        complement(352494..352910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0341"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83375"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY51"
FT                   /protein_id="ABR83375.1"
FT                   /translation="MSSGSTSTTPRAWLSGSVVTGKCCLLVIREGQRPGAPFPSPCASG
FT                   AAATGRPPRAMGGQERSRPPTNVGEDTKESRGKGIAKQTPRRRHGGPTARKAGRATGRS
FT                   ERGHSRGTRPAELKPIPRSPIVVALGAFEISNES"
FT   gene            352935..354386
FT                   /gene="gabD"
FT                   /locus_tag="PSPA7_0343"
FT   CDS_pept        352935..354386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="PSPA7_0343"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00171; match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85403"
FT                   /db_xref="GOA:A6UY52"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY52"
FT                   /protein_id="ABR85403.1"
FT                   /translation="MQLKDAKLFRQQAYIDGAWVDADSGQTIKVNNPATGEIVGSVPKM
FT                   GAAETRRAIEAADKALPAWRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPLAE
FT                   AKGEIAYAASFLEWFGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPSAMI
FT                   TRKAGPALAAGCTMVLKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGGELTS
FT                   NPIVRKLTFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEGALISK
FT                   YRNNGQTCVCANRLYVQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDAKAVTKV
FT                   EEHIADAVSKGAKVVSGGKPHALGGTFFEPTILVDVPKDALVSRDETFGPLAPVFRFKD
FT                   EAEVIAMSNDTEFGLASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVAPFGGIKAS
FT                   GLGREGSKYGIEDYLEIKYLCLGGI"
FT   gene            354631..355911
FT                   /gene="gabT"
FT                   /locus_tag="PSPA7_0344"
FT   CDS_pept        354631..355911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="PSPA7_0344"
FT                   /product="4-aminobutyrate transaminase"
FT                   /EC_number="2.6.1.19"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00155; match to protein family HMM PF00202; match to
FT                   protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83703"
FT                   /db_xref="GOA:A6UY54"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY54"
FT                   /protein_id="ABR83703.1"
FT                   /translation="MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYI
FT                   DFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPK
FT                   KTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSF
FT                   MQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVA
FT                   GKAEIMDAIAPGGLGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQ
FT                   AKHKVIGDVRGLGSMVAIELFEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIR
FT                   FLMPVTIPDAQLEKGLAILAECFDELA"
FT   gene            356225..357424
FT                   /locus_tag="PSPA7_0345"
FT   CDS_pept        356225..357424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0345"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82577"
FT                   /db_xref="GOA:A6UY55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY55"
FT                   /protein_id="ABR82577.1"
FT                   /translation="MSAAKKAPVILIADPDPWSRDLLGQLVLSVRCDARLILCGDGGEA
FT                   LEHCRRRSFALVLAESNLPQVDGFELLREARLRRPVAEQPFILISDRADQASVRAAVAL
FT                   APTAYLVKPFQAGNLLQRLRGLLLKDDEVIACPLPEVTPDEDLLAFLERARDATEGAPL
FT                   LADVRAASDRCLGAEEQPLRVLEDEFGRDPQITAGLIAAANSAARHVGPPCQTLGQALR
FT                   RLGLGHSLNLVLGFSLQRAIQLDEPLLAARALQFWELSQRCADIAWELADALGADVERC
FT                   YTAGLLHRLGDLALLRTLQDWCDGGGALDEARLDEALGRFGASFGSALRARWRLPLELR
FT                   RLIAAAYQFGGVLSREELILSLATQAASLPEAETGQLADSKAARMLGLDGERLVKLLQP
FT                   "
FT   gene            complement(357659..359089)
FT                   /locus_tag="PSPA7_0346"
FT   CDS_pept        complement(357659..359089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0346"
FT                   /product="transcriptional regulator, GntR
FT                   family/aminotransferase, classes I and II"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00155; match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81080"
FT                   /db_xref="GOA:A6UY56"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY56"
FT                   /protein_id="ABR81080.1"
FT                   /translation="MELQLTLDGRHDLVGQLYRQLRDAILRGRLATGDRLPPTRYLAER
FT                   LEVSRKTVSEAYERLASEGFLEGRVGNGTFVARGLAQQQPPAGAEGPLRPAARWARIEP
FT                   QSGLMDQRPALRYSFAGGTTDKRRFPFDAWRTCVLQALRLQQRTPAFYKDTEGDPELRL
FT                   ATSRYLAISRAVQCDWNALMITQGAQQGLDLLGRVMLEPGDLAVVEEPGYPPARASLLA
FT                   TGAEVRGVPVDAEGLRVDLLPDNAKLVYVTPSHQFPLGMPMSLERRLQLLDWAQRQRAL
FT                   IIEDDYDSEYRFDGRSLESLRSLDRHGQVAYLGTFSKTLFPELRLGYLLPPASLREAVL
FT                   AARKLVDRHSETLQQRALALFIQRGDFARHTRRLQREYAQRRDRLLERLRGDLEPWLEA
FT                   LPAVAGIHLAARCREPLDVDRIARHLRQQGLEVGTLPPFYAETPPQAGFLFGFGCIECD
FT                   DIDPALDLLRAELQRSGG"
FT   gene            359216..359653
FT                   /locus_tag="PSPA7_0347"
FT   CDS_pept        359216..359653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0347"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02627; match to protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83711"
FT                   /db_xref="GOA:A6UY57"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY57"
FT                   /protein_id="ABR83711.1"
FT                   /translation="MTTRLEWAKAAPDAYTAMLGLEKALAKASLERPLIELVYLRTSQI
FT                   NGCAYCVNMHANDARKAGETEQRLQALCVWQETPYFTPRERAALAWTEQLARLSQGPLP
FT                   HALLDELREHFDDREIAELTLAVSAINAWNRFGVGMGMQPE"
FT   gene            359665..360072
FT                   /locus_tag="PSPA7_0348"
FT   CDS_pept        359665..360072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0348"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83931"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY58"
FT                   /protein_id="ABR83931.1"
FT                   /translation="MRLSRTFACLLCAVLPALAAAHDAEKVVTLRDQPLAEPPGYRGLM
FT                   LTVSFKPGQVSAPHVHPGPVFVYVLEGTVQTQLEGGPVETYTVGQSWYEPANVAHVLAR
FT                   NPDPMRPAKLLVWELLKDGEPVLKPLSPGAH"
FT   gene            360101..360385
FT                   /locus_tag="PSPA7_0349"
FT   CDS_pept        360101..360385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0349"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85099"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY59"
FT                   /protein_id="ABR85099.1"
FT                   /translation="MSASQVIRIRARKGQSDRLGLRLRQLSGPGREAPGCLDFQVRRDA
FT                   LEADVWLIRSQWREPQQMLDYLCGEIQQVFAEVLWRSLAASLEVRDEEG"
FT   gene            complement(360503..361273)
FT                   /locus_tag="PSPA7_0350"
FT   CDS_pept        complement(360503..361273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0350"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84976"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY60"
FT                   /protein_id="ABR84976.1"
FT                   /translation="MPRLALSALLCLCSLLSTLPARAALDDQQRALQQLQVQACRVVGS
FT                   LLLLRGEGFQEQHAAQLEKDLASLDRALAAVPEGVLLRQGEKALVARIREGAAYGPREE
FT                   DLPWRYPQQLSRALRDFLNLVERQVPPTPPGQPLPLWQLPARVEYLSLQYLARAYLGGL
FT                   EIAREQPRDYLGQDESVLVPLIDRRIALLVANSANPAGLKKLENRWEYLSQALRDLNSK
FT                   SSALVSASGRPWAPIIVDRHARVLSDSLMRLSAE"
FT   gene            complement(361384..362070)
FT                   /locus_tag="PSPA7_0351"
FT   CDS_pept        complement(361384..362070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0351"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86845"
FT                   /db_xref="GOA:A6UY61"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY61"
FT                   /protein_id="ABR86845.1"
FT                   /translation="MNARTDYRSQLQAGRWFQGLPEALQTHLLALAQPRQLPPGQRLFA
FT                   RGDAPCGLYCVVEGAIRISAVSEHGKEALLILVEPPHWFGEIALFDGQARTHDAYAEGP
FT                   TELLQVPQAALLELLRREPRYWRDMALLMSHKLRLAFIALEEMALLPAAQRLARRLLML
FT                   AEGYDNSRSRQILHLPQEQLALMLSLSRQTTNQILKDLEAQGILQLSYGGIEILDLAGL
FT                   RAASHG"
FT   gene            362113..362661
FT                   /locus_tag="PSPA7_0352"
FT   CDS_pept        362113..362661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0352"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84053"
FT                   /db_xref="GOA:A6UY62"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY62"
FT                   /protein_id="ABR84053.1"
FT                   /translation="MMRRPWRETTTMKTLVDHLAQYAAYHRDRRNILSHFIGIPMIVLS
FT                   IAVLLARPSPGFGLSPASLLALAAVLFYLRLDLRFGATMAALLALTVWSGAQLAAGSTA
FT                   AWLGWGIGLFVVGWIIQFVGHYYEGRKPAFVDDLSGLIVGPLFVLAELAFLLGLRGEVQ
FT                   REVEERAGPTCIREHKRAA"
FT   gene            complement(362701..363459)
FT                   /locus_tag="PSPA7_0353"
FT   CDS_pept        complement(362701..363459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0353"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82424"
FT                   /db_xref="GOA:A6UY63"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY63"
FT                   /protein_id="ABR82424.1"
FT                   /translation="MNTRLSLSALALACAALAGCQNLSQQDLMQHGMMAMKAATLSDAE
FT                   VRQVADQACAESDQQNRIAPANSKYGQRLDKIAKALGDQIDGVPVNYKVYLTEDVNAWA
FT                   MANGCIRVYSGLMELMSDNEIEGVLGHEMGHVALGHTRKAAQATYAAAAVRGAAGASKS
FT                   GTLAALSGSQLGELTESLINAQFSQSQESDADDFSYELLKKRGVNTQGLVTAFEKLARL
FT                   GGGDSSMFDSHPGSQARADHIRQRIAADRK"
FT   gene            complement(363620..364204)
FT                   /pseudo
FT                   /locus_tag="PSPA7_0354"
FT                   /note="hypothetical protein, N-terminal truncated by
FT                   genomic island insertion"
FT   gene            364553..364864
FT                   /locus_tag="PSPA7_0355"
FT   CDS_pept        364553..364864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0355"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85897"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY65"
FT                   /protein_id="ABR85897.1"
FT                   /translation="MTEHRKVLTIRDPDPELIRQAKIATGRGTGSQALIASAEKMIHQR
FT                   EQIEQMQEQIAQMREQISAYQAVLADAHSAATRLAEVAGQGDIFAPSNPLRLGHRRQR"
FT   gene            complement(365677..366429)
FT                   /locus_tag="PSPA7_0356"
FT   CDS_pept        complement(365677..366429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0356"
FT                   /product="exonuclease SbcC, putative"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82007"
FT                   /db_xref="GOA:A6UY66"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY66"
FT                   /protein_id="ABR82007.1"
FT                   /translation="MSFKTIDRGTLNPALKERLAHFEMNRHAYADAQQRFSDIAQEDTR
FT                   LAAEASKLEAQAEATEQAWRKRAIQPQVDQTEISAEIERGAALKRQVQALRATVEARSG
FT                   LTAPVLLEMAELRAGLQKEPAAINTAYWRALLDQVLAQDGLRDALLQAFTLSRDIYLSQ
FT                   LDSLEPVLAARCSGQRERQAFIAQGIWEAFADELKRLFAGAENGMGSPMLASLPSPLRD
FT                   EVVAETPGELYRLRQASASPLNGRTALR"
FT   gene            complement(366452..367477)
FT                   /locus_tag="PSPA7_0357"
FT   CDS_pept        complement(366452..367477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0357"
FT                   /product="phage major capsid protein, P2 family"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86516"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY67"
FT                   /protein_id="ABR86516.2"
FT                   /translation="MSKYLSARASTQYFQLQRTVAEAYHVDDAARTFAVEPTHAQELND
FT                   QITERVDFLGRINVIPVSEVKGEKVMLGLSGPATSRTDTNARDREPRHLLDLKNNTYEL
FT                   AHTETDVALSFATIDAWAKFPDFVDRYLTAVQKRIALDRILVGWSGTHAATQTDPAKYP
FT                   QLEDVNKGWLQIAREQIPEQVLRSEDPAKKITLGPGGDYANLDALVHDVKQMIDPVLRD
FT                   EGDLVAIIGSDLLAAEKSTLYAAQGQKPTEKERIEEVKVTETYGGLPSLLVPFFPVMGV
FT                   VVTSLDNLSIYYQDSSWRRHLLENPKRSRAEDFNGRNEGYVIEQLGKFAALEGSSLELV
FT                   R"
FT   gene            367732..368004
FT                   /locus_tag="PSPA7_0358"
FT   CDS_pept        367732..368004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0358"
FT                   /product="phage transcriptional activator, Ogr/delta"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF04606"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85431"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY68"
FT                   /protein_id="ABR85431.1"
FT                   /translation="MRIYCPECDSKARIATREEISRQFVKLYCQCTNGHCGHRFVMQLT
FT                   FSHALYGPSKPLDKLLFDRLREMPSQERRVLFDQLENMGVMDRNT"
FT   gene            368015..368275
FT                   /locus_tag="PSPA7_0359"
FT   CDS_pept        368015..368275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0359"
FT                   /product="zinc-finger protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF04606"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84712"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY69"
FT                   /protein_id="ABR84712.1"
FT                   /translation="MKIECPKCGGKARIYTRQKVTSDFCKLYCQCLDTKACHQRFVMNL
FT                   SLSHCLERPETVLDELVHERLRGLSVQQIKEMQDRIERTAI"
FT   gene            complement(368359..369690)
FT                   /locus_tag="PSPA7_0360"
FT   CDS_pept        complement(368359..369690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0360"
FT                   /product="inner membrane protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85266"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY70"
FT                   /protein_id="ABR85266.1"
FT                   /translation="MNDMTLGAVSAQVRPGFAVYDQDVTIDGKAYRAGLWYHGQERKGA
FT                   ARTVEPVDQWVSIPLHIEAETLDENGYTGRLLRFTNRGRPVRWVLPMGMLATHGGNVLK
FT                   ALFRQGFTADHQGHRQVLTYLREHPRPERLIQIATKPGWHDSGVFVLPGKPIGAADVYL
FT                   DASRQQASLYHRRGTLDGWRQSVGLGCLGDPALELAVCLALAGPLLDALGVPGGGVHLL
FT                   GGTDSSAPLAVRVAASVWGDPFDLTASWHSTQAALIQEAIQRNNTVLPLNGGDWPDLNA
FT                   EKLGDAIARGRLDIYRHGSCSTLAWRVLMLSHGRRRLFSDARTDWPLVDIATDRPAQAA
FT                   RLDVGHALETHYGHLGPAFVESLLACGGPDTLVPMFHEVRKRLLEVETPHVWRVADRFA
FT                   AMAVAGEHAIACELLDWSRGKALETCHRLYEQWRTTRKRPASRR"
FT   gene            complement(369687..369977)
FT                   /locus_tag="PSPA7_0361"
FT   CDS_pept        complement(369687..369977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0361"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81928"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY71"
FT                   /protein_id="ABR81928.1"
FT                   /translation="MKSHLDYLRERGFEVASVGQDVTVFPLENLTPSLRLWINLHRSEL
FT                   LAELAAGDGIARHCVWRVYLRGEFVCTAVSEPMSLDEVRKRVRFPGAEVRP"
FT   gene            complement(369974..371530)
FT                   /locus_tag="PSPA7_0362"
FT   CDS_pept        complement(369974..371530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0362"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84149"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY72"
FT                   /protein_id="ABR84149.1"
FT                   /translation="MAVKKDPYGDQWAGSDTLNDAIKKLGTDAGALYETKALAQLKKMR
FT                   GSDPAAFARLRAKVKDSKMLSMAEFDRLTIPAEDEEVAAGGDIFTEVEAWPKPVKGDEL
FT                   LDEICAVLRRYVAADKETIRAAALWSTFTWLIDVVQVAPIANITAPEKRCGKSILLTAL
FT                   GKLAYRPMQVSNIAPAALYRAIELWSPTLLIDEVDAFLAAYDDARGILNAGFTRDSASV
FT                   IRCVGDDHMPTRFNVWGAKALCGIGKIADTLADRSIPLRLRRRVAGEKVERLRHSDPVM
FT                   WERLQAKLARWTADNAVTVGDARPAPIQGLNDRANDCWEPLLAIAEAAGGHWPKSARQA
FT                   AIVLHGLEGEAPSIGAELLQDVKAVFEDKNITKIFSGELLDALLSDDESPWATWNRGKP
FT                   ISTRQLSGKLGDFGIKSKQIRIGSDSKKGYEIKDFLDAFNRYLSANPPSASETSKQTSN
FT                   HAASSDFSNETLGDGVSDKKTLQPSNHAGCFDVSDKTPPPGRKGGKKGATSQVSYEEVR
FT                   G"
FT   gene            complement(371530..371913)
FT                   /locus_tag="PSPA7_0363"
FT   CDS_pept        complement(371530..371913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0363"
FT                   /product="virulence-associated protein E"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81900"
FT                   /db_xref="GOA:A6UY73"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY73"
FT                   /protein_id="ABR81900.1"
FT                   /translation="MTPIDKVLGRLDKVKRVKVNGKHRWKACCPAHDDKSPSLDVTEAE
FT                   DGTVLLKCWVGCSAAEIVGAIGLELRDLFPGEKRERSGPSPAAVRHERTIYLIGKNQLD
FT                   QGGEMSAEDLERFNLAKQRLGVQ"
FT   gene            complement(371910..372476)
FT                   /locus_tag="PSPA7_0364"
FT   CDS_pept        complement(371910..372476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0364"
FT                   /product="Bbp36"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86102"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY74"
FT                   /protein_id="ABR86102.1"
FT                   /translation="MKNIQERRSALTGSACPEKADDTLHQDRTDNCEGYVAPQRTCRHV
FT                   GDRQCVQVGDFGTAVAGERGYALAGESGFALAGDRGTARAGDFGTAMVGEFGKAIAGDC
FT                   GMASACDGGSARAGFRGIASAGFQGAVAAGEFGELRLTYWDSPSKRYRTAVGYIGEDGL
FT                   LADTFYTLDSSHQFVPAKTEREARV"
FT   gene            complement(372543..372929)
FT                   /locus_tag="PSPA7_0365"
FT   CDS_pept        complement(372543..372929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0365"
FT                   /product="transcriptional regulator, AlpA family"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF05930"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83290"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY75"
FT                   /protein_id="ABR83290.1"
FT                   /translation="MTAARRKASPAPILTEWLSASQLCAKYQVCLTTLWRWAKTPGFPK
FT                   AVRVGRVLRWDAGEVDAFLPKGLSADELCERYQISRATLWRWTKLPGFPVASGIGRMLR
FT                   WEPQAVDAFLSRQRRAGTAPVQSA"
FT   gene            complement(372926..373153)
FT                   /locus_tag="PSPA7_0366"
FT   CDS_pept        complement(372926..373153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0366"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81181"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY76"
FT                   /protein_id="ABR81181.1"
FT                   /translation="MTGLTSTQVIDNARQRIEAAQCREGLDVAWDQGLGALHTLLALGR
FT                   IDLSTWRWHHADFDSRAELRAFALEQGGEQ"
FT   gene            complement(373150..373350)
FT                   /locus_tag="PSPA7_0367"
FT   CDS_pept        complement(373150..373350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0367"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84674"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY77"
FT                   /protein_id="ABR84674.1"
FT                   /translation="MSALVPAPPRTSVRFSVLALLGEAVIVNRVTGTSASRTRLLALAD
FT                   MAYAVSMVSELERQAVIGGAK"
FT   gene            complement(373651..373842)
FT                   /locus_tag="PSPA7_6385"
FT   CDS_pept        complement(373651..373842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6385"
FT                   /product="putative transcriptional regulator, AlpA family"
FT                   /note="manually annotated"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FS14"
FT                   /protein_id="QCB64559.1"
FT                   /translation="MQQTPPSPVSWESAQQLCKHFKVCRTTWWRWSKTPGFPAPVRFGR
FT                   AVRWDSAAVEAFLTSREG"
FT   gene            complement(374267..375646)
FT                   /locus_tag="PSPA7_0368"
FT   CDS_pept        complement(374267..375646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0368"
FT                   /product="phage integrase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82267"
FT                   /db_xref="GOA:A6UY78"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY78"
FT                   /protein_id="ABR82267.2"
FT                   /translation="MAKRNRLTEMEAYSVKKRKSEPVGARGKGTLLLERKAAGTISGYY
FT                   RERVEGKDKRIYLGTLNRKPRSGTDELTLDAMRLAALRLSQTALEAGGLEHVKLSAAKQ
FT                   LHSSGEGSFGDLLDSYCDHLEQAGKVSARPVRRMLDAHVKAHHPALLRRPASKVRPEDI
FT                   QLVLSQVLNRPPLPGGAGRTAKAHAANGMRTVCENLRLALQAAFSHAAKAHLSPERLAT
FT                   RGKTFAISSNPVRDIPAIRGARRAITESLTPDELGVLLRHLETLPEAHRAIAQALIYFG
FT                   GQRIAQFCAVPWAAVTDSTISLLDSKGKKERPWEHILPITPRLTEIMHPLLQHRIGPGP
FT                   FSLRESNTASPSSVMKIFGAAGQSLAASGKARPFSYRNVRVTAETLMAHLGISSEIRAW
FT                   ILSHGRSGVQAKHYDRYSYLPEKRAALERWGDYLDGLARGDAPADNVMLLSRNRKESDE
FT                   R"
FT   gene            complement(375786..375971)
FT                   /pseudo
FT                   /locus_tag="PSPA7_0369"
FT                   /note="hypothetical protein, N-terminal truncated by
FT                   genomic island insertion"
FT   gene            376066..376764
FT                   /locus_tag="PSPA7_0370"
FT   CDS_pept        376066..376764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0370"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84385"
FT                   /db_xref="GOA:A6UY80"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY80"
FT                   /protein_id="ABR84385.1"
FT                   /translation="MQFNPGFSSLAALLADPGRAQMIWALMDGSARPASELALLAGVSP
FT                   SSASGHLGRLVEGGVLSLEARGRNRFYRLAGPEVGQAVEALASASLALQPQRRSLPPSH
FT                   GTPSALREARTCYDHLAGELSVGVFARMLDAGWIEQEGRTVRLSATGEAGLAGLGIDLV
FT                   EARRRRRQFACACPDWSERKPHLGGALGAALLEACLRQGWLRPQDGSRALRVSPKGRAG
FT                   LRGLAERTAG"
FT   gene            complement(376778..377767)
FT                   /gene="cysA"
FT                   /locus_tag="PSPA7_0371"
FT   CDS_pept        complement(376778..377767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PSPA7_0371"
FT                   /product="sulfate transport protein CysA"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM TIGR00968"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81439"
FT                   /db_xref="GOA:A6UY81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY81"
FT                   /protein_id="ABR81439.1"
FT                   /translation="MSIEIRNVSKNFNAFKALDAINLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   GERPGESAIKAKVHELLSMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLLDEP
FT                   FGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPASDFVYHFLGDSNRLQLGDDQHLLFRPHEVSLSRSAVAEHRAAEVRDIRPLGA
FT                   ITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
FT   gene            complement(377771..378637)
FT                   /gene="cysW"
FT                   /locus_tag="PSPA7_0372"
FT   CDS_pept        complement(377771..378637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PSPA7_0372"
FT                   /product="sulfate ABC transporter, permease protein CysW"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00528; match to protein family HMM TIGR00969; match to
FT                   protein family HMM TIGR02140"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84850"
FT                   /db_xref="GOA:A6UY82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY82"
FT                   /protein_id="ABR84850.1"
FT                   /translation="MSSASISAATASARRGHAGGRLTLIVLAWLVFALFLLLPLYVVLS
FT                   EALKQGFGTFFEAILEPDALAALKLTLLAVAISVPLNLLFGVAAAWCVSKFEFRGKSIL
FT                   VTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSEHDIQIVFAVPGIVLATLFVTVPFV
FT                   ARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEFGA
FT                   VSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSESRMSRL
FT                   KSNADEE"
FT   gene            complement(378648..379466)
FT                   /gene="cysT"
FT                   /locus_tag="PSPA7_0373"
FT   CDS_pept        complement(378648..379466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PSPA7_0373"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00528; match to protein family HMM TIGR00969; match to
FT                   protein family HMM TIGR02139"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81768"
FT                   /db_xref="GOA:A6UY83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY83"
FT                   /protein_id="ABR81768.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWEQ
FT                   FWAIVSAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
FT   gene            complement(379624..380622)
FT                   /gene="sbp"
FT                   /locus_tag="PSPA7_0374"
FT   CDS_pept        complement(379624..380622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PSPA7_0374"
FT                   /product="sulfate-binding protein precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01547; match to protein family HMM TIGR00971"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85994"
FT                   /db_xref="GOA:A6UY84"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY84"
FT                   /protein_id="ABR85994.1"
FT                   /translation="MSLRRFALAALASALLSGPAAAATQLLNVSYDPTRELYQAYNAAF
FT                   IEHWKTQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELNKLGKLLPADW
FT                   QARLPDNSTPYTSTIVFLVRKGNPKGIEDWGDLTKEGVEVITPNPKTSGGARWNFLAAW
FT                   AWAKKQYGSDEKARDYVQALYRHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKK
FT                   EQGGENFEIVVPSLSILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFY
FT                   RPRNQKVAAEFAAQFPKLDLVTVDADFGGWKSAQPKFFNDGGIFDQIYQAQ"
FT   gene            complement(380798..380980)
FT                   /locus_tag="PSPA7_0375"
FT   CDS_pept        complement(380798..380980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0375"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83110"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY85"
FT                   /protein_id="ABR83110.1"
FT                   /translation="MSATLRSLDGQDEATILREIQSALRGLRFGAVEITVHNGQVVQIE
FT                   RKEKFRLQQPSVKQA"
FT   gene            complement(381137..383419)
FT                   /locus_tag="PSPA7_0376"
FT   CDS_pept        complement(381137..383419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0376"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00563; match to protein family HMM PF00989; match to
FT                   protein family HMM PF00990; match to protein family HMM
FT                   PF08447; match to protein family HMM PF08448; match to
FT                   protein family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83859"
FT                   /db_xref="GOA:A6UY86"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY86"
FT                   /protein_id="ABR83859.1"
FT                   /translation="MNPRLSALRLSLAYLAVAIAWAFLSDHLLQNQVQDHDQLVFWMTA
FT                   KRLFFFAATGLLLYLYLVRQFRRKAQAYDELHGSEQRLNRALEAVRDGLWDWDLVTGRM
FT                   FVSPGYAALVGLTPEELGDPIETWKKRLHPEEFATVLEAHRNHLQGLTDNLDHIYRLRH
FT                   KDGDYRWIHSRGRVLRDALGKPLHYTGVARDITLQRLKEDHLRQAAAVFDSTREGVLVT
FT                   DAQAVIVHVNPSFERITGYRSEDVLGKTPAILRSGRQDQAFYQRLWLALREQDVWSGEI
FT                   WNRRKSGEIYPQWLHIRAVRNDQGQLTHYVGVFSDLSSIKRSENELDFLAHHDSLTGLP
FT                   NRVLLRQRIEQALEDGKDRAVAGALLLIDLDHFKHINDSLGHTTGDMLLKEVSKRLQHQ
FT                   LGERCLLSRLGGDEFAILVENDDPEAVARLSQRILDGFNAPFDIHCQPIYISASLGVSL
FT                   YPEDASDVDHLMQHADAALFQAKDSGRNAYAFYTRVLTARARAHVQVESALRHALDHDE
FT                   LRVHYQPVHDLASGRIVGVESLVRWQHPERGLVPPGEFVPVAEECGLIAALDNWVLKRA
FT                   CRQMREWQDRGVGLEFIAVNVSSRLFNRGGLEERIANALEESGLEPRYLELEVTESAVM
FT                   EDFEQSLNLLCRLRILGVNLAIDDFGTGYSSLMRLKRLPVHKLKIDQGFVAGLPGAVDD
FT                   AAIARAIIALAQSMGLRVVAEGIEHQDQALFLREHGCDFGQGYWYGRPQPPETLRFDAP
FT                   PVALPED"
FT   gene            383592..384770
FT                   /locus_tag="PSPA7_0377"
FT   CDS_pept        383592..384770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0377"
FT                   /product="putative fatty acid desaturase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81484"
FT                   /db_xref="GOA:A6UY87"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY87"
FT                   /protein_id="ABR81484.1"
FT                   /translation="MWFNGFLDLSPWQLVAVTLVLTHITIVSVTVYLHRYSAHRALDLH
FT                   PALQHFFRFWLWLTTGMNTREWTAIHRKHHAKCETVEDPHSPVHKGLFTVLRAGAELYK
FT                   AEAKNQDTLRIYGKNCPDDWIERNLYSRFPIGGVVLMALIDLALFGALGLTVWAVQMAW
FT                   IPFWAAGVVNGLGHAVGYRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKLSVKK
FT                   WEFDLGWAWIKLFSFLRLARVARVAPIAHRVEGKHSLDMDTAMAILNNRFQIMAQYRKL
FT                   VIAPLVKQEVAKADESVRHLFRRAKRLLSRETSLLQDRHHVRIDSMLAHSQALKVIYEK
FT                   RLALQQIWAKTSANGHDMLAAMKDWVHEAEASGIQSLKEFAAQLKTYSLRPA"
FT   gene            384999..386384
FT                   /locus_tag="PSPA7_0378"
FT   CDS_pept        384999..386384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0378"
FT                   /product="putative sodium:solute symporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00474"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82867"
FT                   /db_xref="GOA:A6UY88"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY88"
FT                   /protein_id="ABR82867.1"
FT                   /translation="MLLDYLIMLVYALAMLGLGWYGMRKARSQSDFLVAGRRLGPGLYL
FT                   GTMAAVVLGGASTIGTVKLGYQFGLSGLWLVFMLGLGIIVLSLVFSRQIARLRVFTVTQ
FT                   VLEQRYQASSRLIGGVVMVAYDLMVAVTATIAIGSVTEVVFGIPRIPAILCGGGIVIVY
FT                   SVIGGMWSLTLTDIIQFVIKTIGIFLVLLPLSIDGAGGLGGMREALPAGFFDLGQIGLD
FT                   TILTYFLLYFFGALIGQDIWQRVFTARSETVVRYAGLGAGVYCMLYGTACALIGAAARV
FT                   LLPDLAVPENAYAEITREVLAPGLRGLVVAAALSAIMSTASGCLLAAATVLQEDIYARF
FT                   LRPGTTSDIRLSRCITLLMGVAMLALACLVNDVIAALSIAYNLLVGGLLVPIVGALLWR
FT                   RASPQGAIASIVVGCLAVVACMARDGLLANSPIVYGLLASLATFVVVSLATRPAAGLRA
FT                   QPE"
FT   gene            386439..387395
FT                   /gene="speB2"
FT                   /locus_tag="PSPA7_0379"
FT   CDS_pept        386439..387395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB2"
FT                   /locus_tag="PSPA7_0379"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00491; match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81216"
FT                   /db_xref="GOA:A6UY89"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY89"
FT                   /protein_id="ABR81216.1"
FT                   /translation="MSNDNPQPLDAAEIPRFAGIPTFMRLPAFTDPAAVRVGLIGVPWD
FT                   GGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRR
FT                   IEGFYRQVHAAGTLPLSIGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPY
FT                   THGTPFRRAIEEGLLDPRRTVQIGIRGSVYSPNDDAFARECGIRVIHMEEFVELGVEAT
FT                   LVEARRVVGDGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGAD
FT                   VVEVSPPFDVGGATALVGATMMFELLCLLAESAARSA"
FT   gene            387462..388412
FT                   /locus_tag="PSPA7_0380"
FT   CDS_pept        387462..388412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0380"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82382"
FT                   /db_xref="GOA:A6UY90"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY90"
FT                   /protein_id="ABR82382.1"
FT                   /translation="MLGNLNDIDLRLLRTFCAIVEAGGFTAAQARLNTSLSRLSVLVRD
FT                   LEVRLGYSLCRRGNGGFQLTEEGQELYDAALGLFSDIARFREQVRGLGGRDREALHLGC
FT                   VDGVIGQHCLPLPLAIRLFRQRAPEVRLNLHTRRPDELEHAVLEERLQLAVGAFHHRLS
FT                   GLCYQPLFREEQNLYCGRAHPFFARADDEPTLDEICAADYVGRGYMAENQRPHDLRFRH
FT                   GINAYTMEAIATLVFSGTYIGYLPTHYAANWVAEGRMRAIRPSQLAYDSEFHCVTRQGH
FT                   DERPTLSLFLSSLFEAQEQLGAQAPANMSGIARQL"
FT   gene            388525..389496
FT                   /locus_tag="PSPA7_0381"
FT   CDS_pept        388525..389496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0381"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82024"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY91"
FT                   /protein_id="ABR82024.1"
FT                   /translation="MDDLPSIPEDPQEAALALLHSRAEVARLKEREQLFSALLASVNSV
FT                   LWAYDWQNRRMVYVSPAYEKIFGRSAALLLADYEEWRNSIYPDDLDYADSSLRQVLERG
FT                   AVEQREYRIVRGDGEVRWLNDKCFVSRQGEAGLPLMVVGIAEDITDKKRMESELQRLAT
FT                   TDVLTQSSNRRYFFDSAEAAFKECRREGIPLAFLLLDVDDFKKINDRFGHQVGDQVLQR
FT                   IAQSGSAALRRGDLFGRIGGEEFAVLLPGCDEQTARQIGERLQREVQRLRFQEGEHSFG
FT                   ITVSQGLTVLQADDEGLGALYSRADAAMYSAKRQGKDCIVVG"
FT   gene            390109..391491
FT                   /gene="oprE"
FT                   /locus_tag="PSPA7_0382"
FT   CDS_pept        390109..391491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprE"
FT                   /locus_tag="PSPA7_0382"
FT                   /product="outer membrane porin OprE precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03573"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83753"
FT                   /db_xref="GOA:A6UY92"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY92"
FT                   /protein_id="ABR83753.1"
FT                   /translation="MKSRKINKSRLALAITAGTLGALAQQAVAAGFIEDSKASLTLRNF
FT                   YINTDNRNGSASPSKQEEWGQGFILNYQSGFTQGTVGFGVDALGLLGVRLDGGGRAGKN
FT                   GLDRQPGTVFPLESDGEPVHDFASLGLTAKAKVSNTEFRYGTLQPKLPVVTYNDGRLLP
FT                   VTFEGGQVTSTDLKDFTLVAGQLEHSKGRNSTDNRSLSIAGANGSSASSRDSNKFYYAG
FT                   GDYKVNKDLTLQYYYGNLDDFYKQHFLGLIHNWQIGPGVLKTDLRAFDSSSDGKNGSRS
FT                   GRADGYVSSGYYGSGVTKGEVDNRAFSGLFTYTVSGHSIGAGYQILNGDSDFPFLNRGD
FT                   GEGSTAYLITDVQIGKFQRAGERTWQVRYGYDFATVGVPGLTFNTIYLSGDKIKTARGD
FT                   QSEWERDISLAYVIPDGTFKGLGFTWKNASFRSGLPAAGSSNNQRDQDENRLIVSYTLP
FT                   LL"
FT   gene            complement(391582..392688)
FT                   /gene="aguA"
FT                   /locus_tag="PSPA7_0383"
FT   CDS_pept        complement(391582..392688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguA"
FT                   /locus_tag="PSPA7_0383"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF04371; match to protein family HMM TIGR03380"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84771"
FT                   /db_xref="GOA:A6UY93"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UY93"
FT                   /protein_id="ABR84771.1"
FT                   /translation="MSNPTSTPRADGFRMPAEWEPHEQTWMVWPERPDNWRNGGKPAQA
FT                   AFTAVAKAIARFEPVTVCASAAQYENARARLDDTNIRVVEISTDDAWVRDTGPTFVIDD
FT                   QGDVRGVDWGFNAWGGFEGGLYFPWQRDDQVARKILEIERRARYRTDDFVLEGGSIHVD
FT                   GEGTLITTEECLLNHNRNPHLSQAEIEGILRDHLAVDSIIWLPNGLYNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDQDDPNYLRCQAALRILEESRDAKGRKLVVHKMPIPGPLYATQEE
FT                   CDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIVAPSFDDPKDAEARAILQRVFPEHEV
FT                   VMVPGREILLGGGNIHCITQQQPAPRKA"
FT   gene            complement(392750..393628)
FT                   /gene="aguB"
FT                   /locus_tag="PSPA7_0384"
FT   CDS_pept        complement(392750..393628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguB"
FT                   /locus_tag="PSPA7_0384"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /EC_number="3.5.1.53"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00795; match to protein family HMM TIGR03381"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82216"
FT                   /db_xref="GOA:A6UY94"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY94"
FT                   /protein_id="ABR82216.1"
FT                   /translation="MSRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQEL
FT                   FETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAI
FT                   IDADGSNLGIYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESA
FT                   RSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQD
FT                   GYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYG
FT                   PLKTLDGSLES"
FT   gene            complement(393820..394455)
FT                   /locus_tag="PSPA7_0385"
FT   CDS_pept        complement(393820..394455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0385"
FT                   /product="transcriptional regulator AguR"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81094"
FT                   /db_xref="GOA:A6UY95"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY95"
FT                   /protein_id="ABR81094.1"
FT                   /translation="MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLSIYSVAER
FT                   AEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLERPVDHAGLRCWRDLSRIVEERMLA
FT                   VYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLA
FT                   MELGDRVYALSVQRHGTIDARLAEEGMRVFDAYLGLYLPPFLEKRSEP"
FT   gene            complement(394516..395577)
FT                   /locus_tag="PSPA7_0386"
FT   CDS_pept        complement(394516..395577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0386"
FT                   /product="putative periplasmic polyamine binding protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83029"
FT                   /db_xref="GOA:A6UY96"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY96"
FT                   /protein_id="ABR83029.1"
FT                   /translation="MPRLSVLLFLAFAPWLAQAEETLRVYNWNDYIDPQVLEAFQKDTG
FT                   IRVEYHTFATAEELDRALRSGEPIDVAVPSHDTLPALLKDNLLRPLDFARLPNRSHLDR
FT                   QLLSKLAAVDPDNRHAIPYLWGAVGLAINTPQAEAAYGGPLPDSWSLLFDASQSQRLKS
FT                   CGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAADALHGLRPNLRYVDSERYIADLE
FT                   GGRLCVAMAWVGDALRAAKAGQPVSFTVPQEGSVLFIDNLVIPASAQHPQQALRFIDYL
FT                   MQPQVAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLQPV
FT                   LGEIWQAFRDAAH"
FT   gene            complement(395833..397209)
FT                   /locus_tag="PSPA7_0387"
FT   CDS_pept        complement(395833..397209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0387"
FT                   /product="putative glutamine synthetase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00120"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82297"
FT                   /db_xref="GOA:A6UY97"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY97"
FT                   /protein_id="ABR82297.1"
FT                   /translation="MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERN
FT                   SLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPT
FT                   AQLLMTMHELEGEPFFADPREVLRQVVEKFTEMELTIVAAFELEFYLIDQENVNGRPQP
FT                   PRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLN
FT                   HVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNI
FT                   FTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTV
FT                   ALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLSNKVEPGAPIEGNSYEQME
FT                   PSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
FT                   "
FT   gene            397488..398240
FT                   /locus_tag="PSPA7_0388"
FT   CDS_pept        397488..398240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0388"
FT                   /product="putative glutamine amidotransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00117; match to protein family HMM PF07722"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80975"
FT                   /db_xref="GOA:A6UY98"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY98"
FT                   /protein_id="ABR80975.1"
FT                   /translation="MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPA
FT                   LGELLDQATLLDSIDGLLFTGSPSNVEPRHYSGAASEPGTLHDPDRDATTLPLVRAAID
FT                   AGIPVLGICRGFQEMNVAFGGSLHQKVHEAGTFMDHREPADQPLEVQYAPRHAMHVQPG
FT                   GVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHP
FT                   EWQVLTNPNYLAIFQAFGKACGKRAGQR"
FT   gene            398281..399639
FT                   /locus_tag="PSPA7_0389"
FT   CDS_pept        398281..399639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0389"
FT                   /product="putative glutamine synthetase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00120"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86229"
FT                   /db_xref="GOA:A6UY99"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A6UY99"
FT                   /protein_id="ABR86229.1"
FT                   /translation="MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEK
FT                   GMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHD
FT                   TFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRS
FT                   GRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALD
FT                   LADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGRNIFSNADG
FT                   TMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPD
FT                   SSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLT
FT                   IEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV"
FT   gene            399705..401075
FT                   /locus_tag="PSPA7_0390"
FT   CDS_pept        399705..401075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0390"
FT                   /product="aspartate aminotransferase family protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83210"
FT                   /db_xref="GOA:A6UYA0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA0"
FT                   /protein_id="ABR83210.1"
FT                   /translation="MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGV
FT                   YIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAK
FT                   AIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAG
FT                   VSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEEN
FT                   VAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYG
FT                   NAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIR
FT                   ILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDK
FT                   GVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA"
FT   gene            401191..402294
FT                   /gene="potF2"
FT                   /locus_tag="PSPA7_0391"
FT   CDS_pept        401191..402294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF2"
FT                   /locus_tag="PSPA7_0391"
FT                   /product="polyamine transport protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85587"
FT                   /db_xref="GOA:A6UYA1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA1"
FT                   /protein_id="ABR85587.1"
FT                   /translation="MMKRFGKTLLALTLAGTVAGMAQAADNKVLHVYNWSDYIAPDTLE
FT                   KFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKL
FT                   PNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFK
FT                   PENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFH
FT                   SSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPK
FT                   DAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMK
FT                   KLYTFPDLPAKTQRAMTRSWTKIKSGK"
FT   gene            402713..403810
FT                   /gene="potF3"
FT                   /locus_tag="PSPA7_0392"
FT   CDS_pept        402713..403810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potF3"
FT                   /locus_tag="PSPA7_0392"
FT                   /product="polyamine transport protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86260"
FT                   /db_xref="GOA:A6UYA2"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA2"
FT                   /protein_id="ABR86260.1"
FT                   /translation="MQHPIGKTLLVATLAAAIAGPVQAEKKSLHIYNWTDYIAPTTLKD
FT                   FTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLP
FT                   NWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPE
FT                   NMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKEYKKAEEVLTKVRPYVSYFHSS
FT                   KYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADA
FT                   KAADNAYAFIDYLLRPEVIAKVSDYVGYANAVPGARPLMDKSVSDSEEVYPPQAVLDKA
FT                   YVSAVLPAKVLRLQTRTWTRIKTGK"
FT   gene            403867..405021
FT                   /gene="potG"
FT                   /locus_tag="PSPA7_0393"
FT   CDS_pept        403867..405021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potG"
FT                   /locus_tag="PSPA7_0393"
FT                   /product="polyamine transport protein PotG"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM PF08402; match to
FT                   protein family HMM TIGR01187"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81767"
FT                   /db_xref="GOA:A6UYA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA3"
FT                   /protein_id="ABR81767.1"
FT                   /translation="MAIASGAYKKALEGSQQPKEVLVKIDRVTKQFDETLAVDTVSLTI
FT                   NKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYA
FT                   LFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENP
FT                   IYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHPGHNWAQGTVYDIAYLGGHSVY
FT                   YIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
FT   gene            405018..405929
FT                   /gene="potH"
FT                   /locus_tag="PSPA7_0394"
FT   CDS_pept        405018..405929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="PSPA7_0394"
FT                   /product="polyamine transport protein PotH"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82892"
FT                   /db_xref="GOA:A6UYA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA4"
FT                   /protein_id="ABR82892.1"
FT                   /translation="MKFANSLKKRMPGGRHAVIGVPFLWLFLFFLLPFAIVLKISLAEA
FT                   DVAIPPYTEIFAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFVSTLICLLVGY
FT                   PMAYAIARSSQSTQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGIISEP
FT                   LTILNTNVAVYIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKITVPL
FT                   SKNGIIAGCMLVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVML
FT                   AILIIPIILFNKNQAKELEGKV"
FT   gene            406012..406881
FT                   /gene="potI"
FT                   /locus_tag="PSPA7_0395"
FT   CDS_pept        406012..406881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="PSPA7_0395"
FT                   /product="polyamine transport protein PotI"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82934"
FT                   /db_xref="GOA:A6UYA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA5"
FT                   /protein_id="ABR82934.1"
FT                   /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSVK
FT                   WYVGLLDNTQLVSSVGRSLEIAFYTAFSSVILGTLAAFVLTRIPRFRGRTLFGGMVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLFTFLAWYFTRQAEERRRRAIQQAMEETASDW
FT                   QKGSPTPA"
FT   gene            complement(407064..409451)
FT                   /locus_tag="PSPA7_0396"
FT   CDS_pept        complement(407064..409451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0396"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81286"
FT                   /db_xref="GOA:A6UYA6"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA6"
FT                   /protein_id="ABR81286.1"
FT                   /translation="MKRTLTVIAVAVAAAAAGAAWYLHAKQPVRSGSLALAHLQAPVDV
FT                   RYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLSRGELAEVLGPRLVDTDRL
FT                   FRTLRIRDHAAAYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTP
FT                   EDTLSIAGYMAYSFAAAFRTEPALTYVRDELGGDYLRIFDLDWHPQGVLTPSGALGAGD
FT                   WQDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRSASGKPLLAGDPHIRFAAPAVWYE
FT                   AQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLIAEKVNPDNPNQVWYQ
FT                   GKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLESENP
FT                   VLDAFYELNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSF
FT                   ILDGSQGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWL
FT                   DAQLADRSVKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREAVDDAEGKRLVEQLAAWK
FT                   GDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDNLIATRAIDSALPRLAADADSPWW
FT                   DDRRTERRESRADIVKAAWAASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQPLLRR
FT                   LLNVGPFAAPGTHEVPNNLSAKIGPAPWPVTYGPSTRRLVDFADPTHSLGINPVGQSGV
FT                   PFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR"
FT   gene            409562..410614
FT                   /locus_tag="PSPA7_0399"
FT   CDS_pept        409562..410614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0399"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81938"
FT                   /db_xref="GOA:A6UYA8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA8"
FT                   /protein_id="ABR81938.1"
FT                   /translation="MQDDPSTSPLTHSATLRRLLYEAFDALGLDPTRVYRSVYRRTPLP
FT                   PPVLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEAL
FT                   RSFVRFQHILSGGFAARLEVEGDSARLILDINYLGHASLRQQIECLMLLFLKLLALISD
FT                   DEFVAEHIEFRHPAPARLGEHRRLFGRLPLFSREHDALLFPAALLRRPSRNANPDMHAL
FT                   LTRHAEEQSRELSENRLLNRVRYLVELRLGEGYGMRQCAAELGLGAGALQRALAAGGAS
FT                   FRQVREEVRRQRAGEMLRAGSAIREVAKACGFAELSPFYRAFRRWYAAPPEQYRARLAR
FT                   EERDYSTSGT"
FT   gene            complement(410593..411099)
FT                   /locus_tag="PSPA7_0398"
FT   CDS_pept        complement(410593..411099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0398"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80966"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYA9"
FT                   /protein_id="ABR80966.1"
FT                   /translation="MSLRPTLALLAALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLA
FT                   DVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVT
FT                   DDQASKLIDRVEELQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQ
FT                   VPLVE"
FT   gene            complement(411204..411815)
FT                   /locus_tag="PSPA7_0400"
FT   CDS_pept        complement(411204..411815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0400"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83382"
FT                   /db_xref="GOA:A6UYB0"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB0"
FT                   /protein_id="ABR83382.2"
FT                   /translation="MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLTAYWWFEIRYI
FT                   RPFSEQTTLFSGDSLRLPAGLAGPGPIRLVHFWDPACPCNVGNQQHLGELIERFAGQGV
FT                   EFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAV
FT                   CTSSNSFIEPILEALLQGRPVNATHTLAVGCYCPWAGEKD"
FT   gene            411892..412833
FT                   /locus_tag="PSPA7_0401"
FT   CDS_pept        411892..412833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0401"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84389"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB1"
FT                   /protein_id="ABR84389.1"
FT                   /translation="MSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRARHPDLR
FT                   ARLGSMLVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDL
FT                   PGHGLSEGERASIRDFAEYQAVFKGLLGQAAELALPQPWHLCGQSTGGAILLDYLLHGG
FT                   ERPELGETILMAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPRFLDFLREHDP
FT                   LQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGEADETVDWRHGLKVLREKFDEPR
FT                   ILLLDEARHHLANESEGLRRRYFDFLSDALGA"
FT   gene            complement(412853..413605)
FT                   /locus_tag="PSPA7_0402"
FT   CDS_pept        complement(412853..413605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0402"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83271"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB2"
FT                   /protein_id="ABR83271.1"
FT                   /translation="MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQ
FT                   KRYQDKLPPALYQTLVDNSNRRFAPAEVDRRALNGLRENLPDSANPLNFFESPLGRKVV
FT                   AAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADS
FT                   LSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRGLSDAELTQYVSFA
FT                   ESSAGRSYYQAALAALKAGLAVDQSVAQ"
FT   gene            413723..414352
FT                   /locus_tag="PSPA7_0403"
FT   CDS_pept        413723..414352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0403"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /note="identified by match to protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81688"
FT                   /db_xref="GOA:A6UYB3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB3"
FT                   /protein_id="ABR81688.1"
FT                   /translation="MHINVDHPLLQRIVDELVDQGWSHQSVFMPERLTTRLAEECRSRA
FT                   CAGELTPAAIGRGDGQVIREGIRGDLTQWLEPAESAACDEYLGVMDSLRQALNASLFLG
FT                   LEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPGRQL
FT                   DIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRDESPLLLP"
FT   gene            complement(414368..414922)
FT                   /locus_tag="PSPA7_0404"
FT   CDS_pept        complement(414368..414922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0404"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80656"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB4"
FT                   /protein_id="ABR80656.1"
FT                   /translation="MFPTRSLLPYLLTSALLASGASQAAMEALDNHSLSQVTGQAGINL
FT                   RLDLRAGAARVAWVDDGGSLSLRNLVIDNGCAKAGDCPDGRGGNIPLGAAQLGLSLPIF
FT                   GVEQPTLALDVTTGSGGRQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLHIGENS
FT                   IGRLELRDITDLRGTLKVRGH"
FT   gene            415187..415681
FT                   /locus_tag="PSPA7_0405"
FT   CDS_pept        415187..415681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0405"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04463"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82677"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB5"
FT                   /protein_id="ABR82677.1"
FT                   /translation="MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWQAQGRIVALCPEVA
FT                   GGLPTPRPPAEIPGGQGGEVLDRLNQVLTVDGEDVSEAFLLGAEVAVQLVRRHDIRMAV
FT                   LKARSPSCGNLENYDGRFNGSRIAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAG
FT                   G"
FT   gene            complement(415686..416378)
FT                   /locus_tag="PSPA7_0406"
FT   CDS_pept        complement(415686..416378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0406"
FT                   /product="putative permease of ABC transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00528; match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83734"
FT                   /db_xref="GOA:A6UYB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB6"
FT                   /protein_id="ABR83734.1"
FT                   /translation="MNSLQKLLEWLANLVELLGMAWPFLLQGAMYTVLFAAVSMVLGLV
FT                   LGFSVAVVRVTKVPLVSQIAAVYVSAFRGTPLLVQIFVLYYGLPSVGIEFTPVTAGILA
FT                   LTLNVAAYLSESMRGAILGIDKGQWEAGLSVGLTWGQTLWNIITPQALRLAVPSLSNSL
FT                   ISLIKDTSLISVITVTELMLATKEVIAETFQPLPLYLAAAGIYWLLSALFERVQKALEN
FT                   RLTAPLRR"
FT   gene            complement(416452..417222)
FT                   /locus_tag="PSPA7_0407"
FT   CDS_pept        complement(416452..417222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0407"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85162"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB7"
FT                   /protein_id="ABR85162.1"
FT                   /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFNF
FT                   KQGGKLTGFETELGELLAAELKVRPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQRRK
FT                   VFDFSAPYTISSAQLIVRADETRQFKSLEDLKGLKLGVGQGTNYADLAKSVAGVNVRTY
FT                   PGAPEYLQDLASKRIDAALNDRLLIPFAIREARLPVKPGAAVGPVANMAIPYRKNNPKF
FT                   GEALDAALEKLKADGRFARLSEKWFGLDVSQPPK"
FT   gene            417514..417951
FT                   /locus_tag="PSPA7_0408"
FT   CDS_pept        417514..417951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0408"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82368"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB8"
FT                   /protein_id="ABR82368.1"
FT                   /translation="MRVTLPCLGLAALMFGASASLMAADLPRTKAPEGAKVYFITPADG
FT                   ATVDKTFTVKFGLKGMGVAPAGVDMPDTGHHHLLVDLKEQPAMNLPLPMTDNIRHFGKG
FT                   QTETEITLPPGKHTLQLLVGDKNHVPLEPTVESEKITVTVK"
FT   gene            complement(418009..419238)
FT                   /gene="serA"
FT                   /locus_tag="PSPA7_0409"
FT   CDS_pept        complement(418009..419238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="PSPA7_0409"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00389; match to protein family HMM PF01842; match to
FT                   protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86070"
FT                   /db_xref="GOA:A6UYB9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYB9"
FT                   /protein_id="ABR86070.1"
FT                   /translation="MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSGD
FT                   ELKERIADAHFIGIRSRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVFNA
FT                   PYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYGSIG
FT                   TQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQWMIG
FT                   EKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEEFASPL
FT                   RGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYSDNGTSVSSVNFPEVALPSHPGKHR
FT                   LLHIHANIPGVMSEINKVFADNGINVSGQYLQTNEKVGYVVIDVDAEYSDLALEKLQQV
FT                   NGTIRSRVLF"
FT   gene            419442..420836
FT                   /locus_tag="PSPA7_0410"
FT   CDS_pept        419442..420836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0410"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85896"
FT                   /db_xref="GOA:A6UYC0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC0"
FT                   /protein_id="ABR85896.1"
FT                   /translation="MTREALIESLKPLVEPGKLLDDAASLDAYGKDWTKHFAPAPLAIV
FT                   FPKSVEQVQAIVRWANQHKVGLVPSGGRTGLSAAAVAANGEVVVAFDYMNRILDFNAFD
FT                   RTVVCQPGVVTKQLQTFAEENGLYYPVDFASSGSSQIGGNIGTNAGGIKVIRYGMTRNW
FT                   VAGLKVVTGKGDLLELNKDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLERTPKNLTA
FT                   MVLGAPDFDSIMPVLHAFQSKLDLTAFEFFSDKALAKVLARGDVPRAFETDCPFYALLE
FT                   FEATTEEVANEALATFEHCVEQGWVLDGVMSQSEQQLQNLWKLREYISETISHWTPYKN
FT                   DISVTVSRVPAFLKDIDAIVEANYPDFEVVWFGHIGDGNLHLNILKPENLGKDEFFAKC
FT                   ATVNKWVFETVEKYNGSISAEHGVGMTKRDYLTYTRSETEIAYMKALKAVFDPNGIMNP
FT                   GKLFAE"
FT   gene            420928..421593
FT                   /locus_tag="PSPA7_0411"
FT   CDS_pept        420928..421593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0411"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86841"
FT                   /db_xref="GOA:A6UYC1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC1"
FT                   /protein_id="ABR86841.1"
FT                   /translation="MSYQHHYIDGTPIHFSLGKLVCVGRNYAEHARELNNPVPSEPLLF
FT                   IKPGSCVVPVGGGLSLPQARGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPALDL
FT                   TLREVQAKLKEKGLPWELAKSFDGAGVLAPFVNADQFPDPTDIGIRLTINGEVRQDGNS
FT                   RDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLHSGDELVLELPGASRFETRVL"
FT   gene            421749..422681
FT                   /locus_tag="PSPA7_0412"
FT   CDS_pept        421749..422681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0412"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01436; match to protein family HMM PF06977"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85845"
FT                   /db_xref="GOA:A6UYC2"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC2"
FT                   /protein_id="ABR85845.1"
FT                   /translation="MSLASKLPRFRWLLLAFVALVGVVLTVIMHWDDRAGLWWKESQAS
FT                   QQLRDESIWLPGYRVVIDAKPLQGLEEEETSDLAYNPATRTLFTVTGKRPLLVELSLTG
FT                   DVLRTIPLLGLSNPEGVAVLENGNVAVTDERRNTLTIFHVDPQTAELSTKSLAEFPLGN
FT                   LGKKNKGFEGIAWDRRQQRLLLSKERDPMTLFSWKSDGGPRLSGAMTALPSDDLYMRNV
FT                   SALSVDPRTGHTLVLSAESHLLLELDEKGEPVSFISLLGGFNGLDSRIPRAEGVAIDDD
FT                   GTIYMVSEPNLFYVFRKKSGERLATSDAD"
FT   gene            422765..423115
FT                   /locus_tag="PSPA7_0413"
FT   CDS_pept        422765..423115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0413"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04076"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85664"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC3"
FT                   /protein_id="ABR85664.1"
FT                   /translation="MKLRHLPLIAAIGLFSTVTLAAGYTGPGATPTTTTVKAALEAADD
FT                   TPVVLQGTIVKRIKGDIYEFRDATGSMKVEIDDEDFPPMEINDKTQVKLTGEVDRDLVG
FT                   REIDVEFVEVIK"
FT   gene            complement(423196..424230)
FT                   /locus_tag="PSPA7_0414"
FT   CDS_pept        complement(423196..424230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0414"
FT                   /product="putative acetylpolyamine aminohydrolase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82793"
FT                   /db_xref="GOA:A6UYC4"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC4"
FT                   /protein_id="ABR82793.1"
FT                   /translation="MLTIYSDDHRLHHGRHELIGGQFTPCFEKPSRADMVLDRIRAVGL
FT                   GDVRAPRDFGLEPIRRVHSEGFVRFLQNAWQDWLASGRSHDMLPIAWPTRRLRQTEPDN
FT                   IDGRLGYYSFDAGAPITAGTWQAITSSANVALSGQSELAGGARSVFSLCRPPGHHAAAD
FT                   YMGGYCFLNNAAIAAQAFLDRGAGRVAILDVDYHHGNGTQDIFYDRADVLFTSIHGDPR
FT                   FEYPYFLGYADEKGKGVGEGYNCNYPLASGSDWATWSLALQAAIRQIQAYAPDVLVVSL
FT                   GVDTFKEDPISQFRLDSPDYLRMGEAIGKLGLATLFVMEGGYAVEEIGINAVNVLQGFE
FT                   GVHR"
FT   gene            complement(424246..425640)
FT                   /locus_tag="PSPA7_0415"
FT   CDS_pept        complement(424246..425640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0415"
FT                   /product="putative transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84711"
FT                   /db_xref="GOA:A6UYC5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC5"
FT                   /protein_id="ABR84711.1"
FT                   /translation="MASERNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYMV
FT                   PLTMFTTYGVVTEMTGGRTAGAYLITLAAMLFTAFSYSFMVRKYPIAGSAYSYTSLSFG
FT                   PCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLAAIALVTLLNVIGIS
FT                   SVAGMSNVIVGAQFVFALVFIAMAIKHLAGIPSLDFSLPFVGDGSQPGFTPLMAGAAVL
FT                   CLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSVFQDAE
FT                   SAANEVMLAAGGQFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPRRVFGGL
FT                   SERFQTPVIAILVVSLISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSYLLLDGRR
FT                   APRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLAWFAAGLAYLAFHTGGFRRKAPSV
FT                   TFSEQN"
FT   gene            426440..427405
FT                   /locus_tag="PSPA7_0418"
FT   CDS_pept        426440..427405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0418"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81679"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC8"
FT                   /protein_id="ABR81679.1"
FT                   /translation="MNIHARTPEPFSMSRAFTPRRLLLAVLLVALAALALLGQNFRVFD
FT                   RAWFAVQEWRHADAWKERSIWLPDYRVRVEAQPIEGLSDDVSALTFDPDRRTLFTVTNQ
FT                   PAQIIELSLQGKVLRTIPLTGFGDAEAIEYISRGVYVITDEREQRLVKVRLEDDTRFID
FT                   AADAQQLSLGIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAV
FT                   HVVDDPGRDRRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSLLRGMH
FT                   GLKRSVPQAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP"
FT   gene            complement(427435..429378)
FT                   /locus_tag="PSPA7_0419"
FT   CDS_pept        complement(427435..429378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0419"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83845"
FT                   /db_xref="GOA:A6UYC9"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYC9"
FT                   /protein_id="ABR83845.1"
FT                   /translation="MFKPLAVAVSLGCAALSSGANAYQYGEYAGETLERLITDYPGRYR
FT                   GTASFAGATELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKVLVLGAHYDTY
FT                   YGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVESLDA
FT                   SQRANLLGMINLDSLVTGDRMYAHAGSNSVANPALGAYREQILRIARELDIPLFTNPGL
FT                   NAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTWHDPAE
FT                   DNKEVLTGAFGQERIDQRMRDFSRLLTRLVLELTNADLLASTASGGALARQMEDQLQRQ
FT                   HQALTRLHDRRWLTLLGSSRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRAGVHLLGD
FT                   YRYSEALTLGASLAFQRSRDKLDHGGRIEGDTWQLGLFGLYHDGGPQWLAGELNLGHTR
FT                   YDSKRPVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGPLAGLDYMRY
FT                   RIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYASLRWVRELAD
FT                   GRLDDIDLTSRGDGRIRVADMGDVDKDFGRAQFGAQLAITEQLGIFAEANSRFAHSEGN
FT                   QAGYSLGVNWQF"
FT   gene            429669..430394
FT                   /locus_tag="PSPA7_0420"
FT   CDS_pept        429669..430394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0420"
FT                   /product="putative acetyltransferase"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85205"
FT                   /db_xref="GOA:A6UYD0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD0"
FT                   /protein_id="ABR85205.1"
FT                   /translation="MNIFREALLNRRLRKALARHGCRMASGVETLRDGTLVTLEPNVKL
FT                   GKAKIYSPALEIGAYTDVVSGCEFMEVASIGRFCSIAAGVVIGQPRRSHPMHWLSTHAF
FT                   TANPKLLRKPLQPEREATPARIGHDVWIGRDALILDGVEIGTGAVVGAQSLVNRDVPPY
FT                   AVVAGSPARVIRYRFEPELIERLLASRWWELPLDLLGELPLDDPRACVEALERQPPKAR
FT                   QETRRLRIRHKPFAIEWLD"
FT   gene            complement(430431..430763)
FT                   /locus_tag="PSPA7_0421"
FT   CDS_pept        complement(430431..430763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0421"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF07411"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81531"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD1"
FT                   /protein_id="ABR81531.1"
FT                   /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALNGIDS
FT                   VRKNAQRDGAFEVKPASNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAPEA
FT                   GLSDES"
FT   gene            complement(430887..431558)
FT                   /gene="rpiA"
FT                   /locus_tag="PSPA7_0422"
FT   CDS_pept        complement(430887..431558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="PSPA7_0422"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF06026; match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82238"
FT                   /db_xref="GOA:A6UYD2"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYD2"
FT                   /protein_id="ABR82238.1"
FT                   /translation="MNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALAR
FT                   HKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGAAL
FT                   TREKIVAAVARTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVYREG
FT                   VLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGVQTLK
FT                   A"
FT   gene            431817..433331
FT                   /gene="ilvA2"
FT                   /locus_tag="PSPA7_0423"
FT   CDS_pept        431817..433331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA2"
FT                   /locus_tag="PSPA7_0423"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00291; match to protein family HMM PF00585; match to
FT                   protein family HMM TIGR01124"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86813"
FT                   /db_xref="GOA:A6UYD3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD3"
FT                   /protein_id="ABR86813.1"
FT                   /translation="MLEQYVKKILTSRVYDVAVETPLQPARQLSERLGNQVLLKREDLQ
FT                   PVFSFKIRGAYNKVAQLTEEEKARGVIAASAGNHAQGLALAAKRQGIRAVIVMPKTTPE
FT                   IKVQAVRAHGAKAVLHGDAFPEALAHALKLVDEKGYTFVHPYDDPDTIAGQGTVAMEIL
FT                   RQQPGRLDAIFVPVGGGGLVAGIAAYVKYLRPEIKVIGVEPDESNCLQAAMAAGERVVL
FT                   GQVGLFADGVAVAQIGQHTFDICKDHVDEVITVSTDEICAAIKDIYDDTRSITEPAGAL
FT                   AVAGIKKYVERERAEGQTLVAIDSGANVNFDRLRHVAERAELGERREAIIAVTIPERPG
FT                   SFKAFCEAVGKRQITEFNYRYHSGSEAHIFVGVQTHPENDPREALVAYLREKGFPVLDL
FT                   TDNELAKLHIRHMVGGHAVKVSDEMVFRFEFPERPGALFNFLTKLGGRWNISMFHYRNH
FT                   GAADGRVVAGLQVPEDERQLIPQTLEAIGYPYWDETDNPAYQLFLG"
FT   gene            433450..433917
FT                   /locus_tag="PSPA7_0424"
FT   CDS_pept        433450..433917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0424"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81239"
FT                   /db_xref="GOA:A6UYD4"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD4"
FT                   /protein_id="ABR81239.1"
FT                   /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRSADAARIARGF
FT                   RRIRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLLLAGRL
FT                   ARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
FT   gene            433968..435239
FT                   /locus_tag="PSPA7_0425"
FT   CDS_pept        433968..435239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0425"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82343"
FT                   /db_xref="GOA:A6UYD5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD5"
FT                   /protein_id="ABR82343.1"
FT                   /translation="MRILLVGAGGFVGRHLLPALLAAGHELLLTARRPPADAPAGARWL
FT                   ALDLERLAERPDSFAWPAGVDLLVNAAGVMSLDEASMARVQDSGARALFDLAAGHGAKI
FT                   LQISALGAGEHPDVPFLASKAAADRHLLGLGIAALVLRPSLLLGPGGASSAWLERLSPL
FT                   PLIPLLDNRARLQPLHVDDLVGAVLALLRDWPERAQVIPLVGPQALTQGELLDRLRRAQ
FT                   GWPRGRYLVPPAALLDALGGLGRRLGWRVLSPPMLKLVRQDNLADPAILQAACGYRCAP
FT                   LSSRLLGWPQAQNALASLLRPLMLAALVLIWLGTLVACLGPGYAWGLSILGEAGIHGWP
FT                   ASLAVIAGALLDGALGVGLLLRRWRRRALLAQFWLMLGYSLVISLILPHYWYDPYMAVG
FT                   KNLVLMVATLWLLGGEPRAKEARG"
FT   gene            435236..435703
FT                   /locus_tag="PSPA7_0427"
FT   CDS_pept        435236..435703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0427"
FT                   /product="integral membrane protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82491"
FT                   /db_xref="GOA:A6UYD6"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD6"
FT                   /protein_id="ABR82491.1"
FT                   /translation="MNLYLLLKTLHILSSTILFGTGLGSAYYALRAWRSGQLPVIAVTF
FT                   RHLVTADWLFIATTAVFQPLSGLAMVHVAGWPLTQGWLLWSLGLYVFAGLCWLPVVWLQ
FT                   IRVRDMAESALREARPIEPLAHRYMRAWFILGWPAFIAFMAIFYLMVNKPV"
FT   gene            complement(435676..436917)
FT                   /locus_tag="PSPA7_0426"
FT   CDS_pept        complement(435676..436917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0426"
FT                   /product="putative MFS transporter"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86326"
FT                   /db_xref="GOA:A6UYD7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD7"
FT                   /protein_id="ABR86326.2"
FT                   /translation="MPHTAPAPGSLRPVVIVALVTALCLAGDSMLYIALPIYWREVGLE
FT                   ALWQVGVLLSINRLIRLPFNPLIGRLYKHLALKTGLLLAVVIGVLSTAGYGLASGFLAW
FT                   VLLRGLWGIGWSFFRIGGLSAVVYCAADHQRGRAMGLYNGLYRLGSLVGMLLGGLLVPV
FT                   LGLPALALSFAILALLGLPLLAKGFVLPENPAGHARPPAATASTSVARLPPPRGLVILS
FT                   GFGTALLIQGVLAATLSALIARSFGTEVSLLGLALSAAGLSGIIQALRWSWEPWLAGRF
FT                   GAWSDGPRGRQGYYVAALLAGALGFGLLSTALPILAWLALALLVMLVATALTTLTDALA
FT                   ADVARAGDVVGFMTRYSIVQDLGAALGPALAFLLLERPGGFAWLYWGGSLAFLLLALLW
FT                   LRRTNPQTGLLTIR"
FT   gene            complement(436967..437620)
FT                   /locus_tag="PSPA7_0428"
FT   CDS_pept        complement(436967..437620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0428"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86169"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYD8"
FT                   /protein_id="ABR86169.1"
FT                   /translation="MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFYA
FT                   DYVAGKLDVLAYQAFTQAILGRTEMAQLETWHRQFMREVIEPIVLAKGEALLAEHRAAG
FT                   DRLVIITATNRFVTGPIAERLGVDTLIATECEMRDGRYTGQTFDVPCFQGGKVVRLQRW
FT                   LDENGLDLEGASFYSDSLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPIISLR"
FT   gene            437824..438303
FT                   /locus_tag="PSPA7_0429"
FT   CDS_pept        437824..438303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0429"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85746"
FT                   /db_xref="GOA:A6UYD9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYD9"
FT                   /protein_id="ABR85746.1"
FT                   /translation="MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRET
FT                   PEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRL
FT                   MSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD"
FT   gene            438327..440606
FT                   /gene="ptsP"
FT                   /locus_tag="PSPA7_0430"
FT   CDS_pept        438327..440606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="PSPA7_0430"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase
FT                   PtsP"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00391; match to protein family HMM PF01590; match to
FT                   protein family HMM PF02896; match to protein family HMM
FT                   PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81926"
FT                   /db_xref="GOA:A6UYE0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYE0"
FT                   /protein_id="ABR81926.1"
FT                   /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLDT
FT                   ETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAETGE
FT                   ERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIALFKQA
FT                   LEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQGALRQ
FT                   VVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVSEELSPA
FT                   MLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDLIVDGYHG
FT                   EVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTGLLADVARA
FT                   QERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTLDIGGDKALS
FT                   YFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPMISGTHELEEA
FT                   LHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDPAAAVLLMAMGFD
FT                   SLSMNATNLPKVKWLLRQISLDKARDLLGQLLTFDNPQVIHSSLHLALRNLGLGRVINP
FT                   AATVQS"
FT   gene            440724..441761
FT                   /locus_tag="PSPA7_0431"
FT   CDS_pept        440724..441761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0431"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85130"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYE1"
FT                   /protein_id="ABR85130.1"
FT                   /translation="MDERASKPPGLLPLSREDLEKTLRYALEIVSDGIWDWNIATNQVS
FT                   RSAGWYLMLGYPPNSLPESVDTWKGIIHPEDYPGVMASFQAYLDGESPEYCEEYRCRTY
FT                   SGDYLWISDRGRFVEFDERGEPRRMIGAHHEIHQRKLVELELQQRNEELFDWNLRLEEL
FT                   VAERTEALHRVNQALALKMAEAQRLSEIDPLTGLYNRRKFEQCLHQEWMRRQRHGRSTA
FT                   LVMIDIDHFKRINDLFGHSIGDSVLVDFGHLIAGELREVDVLARWGGEEFILLLPETAL
FT                   EAAAALAERLRQRVRGQPFEVCGRLTASFGVGVLDDGETLDLLLCRVDDALYRAKQRRD
FT                   CVTCC"
FT   gene            complement(441766..442521)
FT                   /locus_tag="PSPA7_0432"
FT   CDS_pept        complement(441766..442521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0432"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84194"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYE2"
FT                   /protein_id="ABR84194.1"
FT                   /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFAG
FT                   RDLEAGGTWLGLGPAGRFAALTNVRDPSQPLGKRSRGELVADFLRDGGNPADYLARVAE
FT                   RAADYSGFNLLVGDRHQLWHYNPRVGPPLLLPAGVYGLSNAALDSPWPKLLKARAALAE
FT                   RLAEPHPHALLELLADPQPATDGQLPDTGVGLATERLLSSVFIASPSYGTRASTALRVH
FT                   ADGSREIVERSFGPSGARLGEVSLVLPPD"
FT   gene            442643..443425
FT                   /locus_tag="PSPA7_0433"
FT   CDS_pept        442643..443425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0433"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83113"
FT                   /db_xref="GOA:A6UYE3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYE3"
FT                   /protein_id="ABR83113.1"
FT                   /translation="MEFLLYIVLGACAGVLAGLFGVGGGLIIVPALVFSFTAHGFGGDV
FT                   LTQMAVGTSLATIVFTSINSILEHHRRGAVRWPVFAWMTLGILIGSALGALTAAQIKGP
FT                   LLQKIIGVFAILVALQMTLDLKPRGRHEVPGKGGLTVAGAVIGWASAIFGIGGGSLTVP
FT                   FLSWRGVPMQQAVATSSACGLPIAISGALSFIAVGWHNPQLPEWSLGYVYLPALVGIAA
FT                   TSMLFARFGARLAHRLSPRGLKRLFALLLFSVGVSFLI"
FT   gene            443449..444249
FT                   /gene="lgt"
FT                   /locus_tag="PSPA7_0434"
FT   CDS_pept        443449..444249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="PSPA7_0434"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01790; match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84025"
FT                   /db_xref="GOA:A6UYE4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYE4"
FT                   /protein_id="ABR84025.1"
FT                   /translation="MLTYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRMKRFD
FT                   PSWTKERLSDLVFWVACGVILGGRLGYVLFYNLDEYIANPTLIFEVWKGGMSFHGGLLG
FT                   VMLAVWWFGKRHGKSFFQLMDFIAPLVPIGLGAGRIGNFINSELWGKVSDVPWAMVFPN
FT                   GGPLPRHPSQLYQFALEGVALFVILWLFTRKPRPTASVSGLFVLCYGIFRFVVEFVRVP
FT                   DAQLGYLAWGWLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKAA"
FT   gene            444458..445252
FT                   /gene="thyA"
FT                   /locus_tag="PSPA7_0436"
FT   CDS_pept        444458..445252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="PSPA7_0436"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00303; match to protein family HMM TIGR03284"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85376"
FT                   /db_xref="GOA:A6UYE6"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYE6"
FT                   /protein_id="ABR85376.1"
FT                   /translation="MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGYQMRFDLAAGFPLV
FT                   TTKKCHLKSIVHELLWFLQGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAP
FT                   DGRHIDQIANLMTMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQL
FT                   YQRSADIFLGVPFNIASYALLTLMVAQVAGLRPGEFIWTGGDCHLYANHLEQADLQLTR
FT                   EPLPLPSMKLNPEVKDLFDFRFEDFELVGYQAHPHIKAPVAV"
FT   gene            complement(445289..446665)
FT                   /locus_tag="PSPA7_0437"
FT   CDS_pept        complement(445289..446665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0437"
FT                   /product="integral membrane protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01926"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86370"
FT                   /db_xref="GOA:A6UYE7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYE7"
FT                   /protein_id="ABR86370.1"
FT                   /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVEG
FT                   ARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGRFE
FT                   QESKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPRHREEE
FT                   WRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHEAQAAARL
FT                   RAGQRLIAELLVDVAACRRLVASAESAVQEATRDLHQQVRKREQACVEALLRLYAFARD
FT                   DARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVTLGAAAA
FT                   LGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQTRGHAALE
FT                   AIRLETPEDRQWREGKLPEALRKARAHPEWSSLNGRRAGGGDRQEQIDALAEHLADSGE
FT                   "
FT   gene            complement(446658..448037)
FT                   /locus_tag="PSPA7_0438"
FT   CDS_pept        complement(446658..448037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0438"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86584"
FT                   /db_xref="GOA:A6UYE8"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYE8"
FT                   /protein_id="ABR86584.1"
FT                   /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEAVRQALAQGGSLP
FT                   RRILTRAHWLGRREGLLEAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPVNV
FT                   FWALASLLGLHLLTLLGWAIGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPALLVL
FT                   LGRRRLARWGLGALVHGLWLLGLLAALALLLGLLATRRYGFVWETTILGSDTFVGLTQA
FT                   LGALPALLGFPLPDAELIRASGDAALAGETARHAWAGWLVGVLLVYGVLPRLLLGLFCL
FT                   WRWKRGLAGLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSAQEAAGAV
FT                   LVAVDDRRPWPPKLAEGIADAGILDDGQQRRRLLEQLTRYPPARLAIACDPRRSPDRGS
FT                   LALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHAALERLQLPHGETSPLAWLETGH
FT                   D"
FT   gene            448225..448587
FT                   /locus_tag="PSPA7_0439"
FT   CDS_pept        448225..448587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0439"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80964"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYE9"
FT                   /protein_id="ABR80964.1"
FT                   /translation="MKVVRRWPLALWLAMTGTLADELPDGSLLQRYGVAADQLPALTAE
FT                   PQPRKEKVEAPARFRLAPEQPLVTFGVKEPQDAEPTGNPSIDAMHERDRRLCRRIRQEA
FT                   LEKGKASPFDSYIGCP"
FT   gene            complement(448624..449781)
FT                   /gene="glpQ"
FT                   /locus_tag="PSPA7_0440"
FT   CDS_pept        complement(448624..449781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="PSPA7_0440"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   periplasmic"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83952"
FT                   /db_xref="GOA:A6UYF0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF0"
FT                   /protein_id="ABR83952.1"
FT                   /translation="MQSAFLRRQLGAACLLLAAGLASAASASADTGNVQRAIDWAQGQA
FT                   SARHPAGQERSPLVIAHRGASGYVPEHTLGAYALAVMMGADYIEPDLVMTRDGKMVARH
FT                   DNELGLTTDVARHPEFADRKRTQKVDGVELTGWFSEDFTLAELKTLRAIERIPTIRPGN
FT                   ARLDGTFEIPTLQEIIDLVKSLQISQQRSIGLYPEIKHGTHFQRLGLAMERPLVKTLHR
FT                   NGYLGPSAPVFIQSFEVNNLKELKRLTGIRLIQLYGSGQPYDQQATGGSLTYAEMATAK
FT                   GLRQVARYAYGVGPDKSYVIPRDANDNLGQPTRFVGDAHAAGLKVHPYTFRAENSFLPA
FT                   EFRSADGNPQSRGDLAGEIRAYLDAGIDGLFSDQPDVAVRLREQR"
FT   gene            449992..451086
FT                   /locus_tag="PSPA7_0441"
FT   CDS_pept        449992..451086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0441"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86190"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF1"
FT                   /protein_id="ABR86190.1"
FT                   /translation="MASPQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARAEA
FT                   RVPTAATDDWGRQPDSLMSGVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGFFI
FT                   RRMLIRMEPSRPGTPLLLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVRNLR
FT                   MSTRKDGQEVRGELLRKGRWRPLRMLTEIEPSGPLEVTLIPRRIFVDGVEVTSSLAAAS
FT                   IEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGLQLALGDPLDSL
FT                   QWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPERPLLFNLYDYRRQLQNGVIR
FT                   LREDGMVQIAVSPVKAPAPLEARL"
FT   gene            451083..452126
FT                   /locus_tag="PSPA7_0442"
FT   CDS_pept        451083..452126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0442"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86695"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF2"
FT                   /protein_id="ABR86695.1"
FT                   /translation="MSRRPWGVPLLGCCLLAAGAAQAESAIDRQQRELALLREGWYRQV
FT                   PPAPLPLPMRAAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPVDF
FT                   DRPQDMHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRVRPF
FT                   GVGPWLPLRLGGGVEVDAGSGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLDRPGA
FT                   SLVGSAMRLDYRKVFPLLGIDGQVQEAWLDDQGLHLRFSQAPGRPSPVFSPPAVAGPSF
FT                   LWLQSGDLKIFEILITYAQVLLKTEKPEQVLTFNLRDYRKVLATGTTQVNEDGTFFMQV
FT                   PPYANPL"
FT   gene            452209..452715
FT                   /gene="folA"
FT                   /locus_tag="PSPA7_0443"
FT   CDS_pept        452209..452715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="PSPA7_0443"
FT                   /product="dihydrofolate reductase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81570"
FT                   /db_xref="GOA:A6UYF3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF3"
FT                   /protein_id="ABR81570.1"
FT                   /translation="MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIM
FT                   GRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALVRAEEWAQAEDADELMLI
FT                   GGAQLYAEALPRAERLYLTRVGLAPEGDAFFPEIDDAGWRLASSIEHAAADDAPAYAFE
FT                   VWERR"
FT   gene            complement(452731..453204)
FT                   /locus_tag="PSPA7_0444"
FT   CDS_pept        complement(452731..453204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0444"
FT                   /product="phosphodiesterase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85248"
FT                   /db_xref="GOA:A6UYF4"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF4"
FT                   /protein_id="ABR85248.1"
FT                   /translation="MPQSRRPLRIGLIADTHGLLRPEALERLRGCDQLIHAGDIGKPEI
FT                   LAELERLAPLSVVRGNNDTQDWAADIPERLLLKIGRLTLYVLHDLKRLDLDPAAEGIDV
FT                   VVAGHSHKPLKEERDGVLYLNPGSAGPRRFSLPIGIGVLEVAGKKVEAQLITL"
FT   gene            complement(453342..454727)
FT                   /locus_tag="PSPA7_0445"
FT   CDS_pept        complement(453342..454727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0445"
FT                   /product="putative transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00860; match to protein family HMM TIGR00801; match to
FT                   protein family HMM TIGR03173"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85054"
FT                   /db_xref="GOA:A6UYF5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF5"
FT                   /protein_id="ABR85054.1"
FT                   /translation="MSSLQSPSDASPRNDLVYGLDDRPSAPIALLAALQHLLAIIVPIV
FT                   TPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFVGP
FT                   LIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVVLMI
FT                   GLTLIKVGLISMGGGFSAMSDGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCAIVIA
FT                   LAVGYALAGYLGRLDFTGMHQAELFQVPTPLHFGLDFSWPLFIPMLVIYLVTSLEAIGD
FT                   VTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVIQLTGVA
FT                   SRYIGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINILAGIQLDR
FT                   RALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWFLPESPAQR
FT                   AEQ"
FT   gene            complement(454951..456789)
FT                   /gene="ilvD"
FT                   /locus_tag="PSPA7_0446"
FT   CDS_pept        complement(454951..456789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="PSPA7_0446"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00920; match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86669"
FT                   /db_xref="GOA:A6UYF6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYF6"
FT                   /protein_id="ABR86669.1"
FT                   /translation="MPDYRSKTSTHGRNMAGARALWRATGMKDEDFKKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKTKLASHGLDLV
FT                   DAMVVAADDSCSDEKVAEYERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLAT
FT                   HADREQLFLRAGRLAVELCQRYYGEGDDSVLPRNIANFKAFENAMTLDIAMGGSTNTIL
FT                   HLLAAAQEAEVPFDLRDIDRLSRKVPQLCKVAPNIQKYHMEDVHRAGGIFSILGELARG
FT                   GLLHTDVATVHSPSMADAIARWDITQTRDEAVHTFFKAGPAGIPTQTAFSQNTRWPSLD
FT                   DDRAEGCIRSVEHAYSKEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGRAKIFESQDA
FT                   AVKGILGDEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALLTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLVQDGDKVLIDIPNRSINLLVSDEELAARRAEQDRKGWK
FT                   PAAPRARRVSTALKAYALLATSADKGAVRNKALLDG"
FT   gene            complement(457117..458313)
FT                   /locus_tag="PSPA7_0447"
FT   CDS_pept        complement(457117..458313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0447"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02475; match to protein family HMM PF03602; match to
FT                   protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85294"
FT                   /db_xref="GOA:A6UYF7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF7"
FT                   /protein_id="ABR85294.1"
FT                   /translation="MTLPSLRLKANAERRLRAGHLWVYSNEVDVAATPLNAFAAGDQAV
FT                   LEMANGKPLGVVALSPNNLICGRLISRDTKHVLDKSLLVHRINIALSLRERLFDKPFYR
FT                   LVYGDSDLLPGLVVDRFGDVLVVQLASAAMELRKDEVLAALLQVLKPAAVLWKNDSSAR
FT                   DAEGLERYVANAYGEVPEWVALEENGVRFEAPVLAGQKTGWFYDHRMNRARLAPYVQGK
FT                   RVLDLFSYIGGWGIQAAAFGASEVMCVDASAFALDGVERNAALNGVAEKVACVEGDVFE
FT                   ALRELKAADERFDVVIADPPAFIKRKKDLKNGEAAYRRLNEQAMRLLSKDGILVSASCS
FT                   MHLPENDLQDILIGSARHLDRNIQLLERGGQGPDHPVHLAIPETRYIKSLTCRLLPNG"
FT   gene            complement(458386..458925)
FT                   /gene="pfpI"
FT                   /locus_tag="PSPA7_0448"
FT   CDS_pept        complement(458386..458925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="PSPA7_0448"
FT                   /product="protease PfpI"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01965; match to protein family HMM TIGR01382"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86042"
FT                   /db_xref="GOA:A6UYF8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF8"
FT                   /protein_id="ABR86042.1"
FT                   /translation="MTQSLHGKVVAALVTDGFEQVELTGPKKALEDAGATVRILSDKSG
FT                   EVRGWNHHQPADAFRVDGTFEDASLDDYDALLLPGGVVNSDQIRSLAKAQELVIRAEQA
FT                   SKPVAVFCHGAWLLISAGLVQGRTLTSWPSLKDDINNAGGHWVDQEVAVDGKLVSSRKP
FT                   DDIPAFSRRFIDILAG"
FT   gene            459088..459966
FT                   /locus_tag="PSPA7_0449"
FT   CDS_pept        459088..459966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0449"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81715"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYF9"
FT                   /protein_id="ABR81715.1"
FT                   /translation="MVQELTAEQIRQALQGISVPPQPQIMVDLQMEQVMPNPDLKNIAR
FT                   LISQDPGLSGALLKLVNSPFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSDDT
FT                   IVTLNRFWDTAQDVAMSCLSLAKRIGYESVDEAYALGLFHNCGIPLMLKRFPHYMAVLE
FT                   EAYAAASDERRVVDTENRVLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIFGDES
FT                   ARDTQLKNLLAILKMAEHICGSHRILGNQPEDHEWNSIGALVLDYVGLTDYDFENLKSS
FT                   ILELGVGQGSY"
FT   gene            460025..460837
FT                   /gene="mutM"
FT                   /locus_tag="PSPA7_0450"
FT   CDS_pept        460025..460837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="PSPA7_0450"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01149; match to protein family HMM PF06831; match to
FT                   protein family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83299"
FT                   /db_xref="GOA:A6UYG0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYG0"
FT                   /protein_id="ABR83299.1"
FT                   /translation="MPELPEVETTRRGIAPYLEGQRVERVIVRERRLRWPIPEDLDVRL
FT                   SGQRIVSVERRAKYLLLGAEAGTLISHLGMSGSLRLVESGTPASRHEHVDIELASGMSL
FT                   RYTDPRRFGAMLWSLAPLEHELLRNLGPEPLTDAFAGQRLFELSRGRSMAVKPFIMDNA
FT                   VVVGVGNIYASEALFAAGIDPRKPAGSISKARYLRLAEEIKRILAIAIERGGTTLRDFV
FT                   GGDGQPGYFQQELFVYGRGGEFCKVCGSTLREIRLGQRASVYCPRCQR"
FT   gene            460914..461492
FT                   /locus_tag="PSPA7_0451"
FT   CDS_pept        460914..461492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0451"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85356"
FT                   /db_xref="GOA:A6UYG1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG1"
FT                   /protein_id="ABR85356.1"
FT                   /translation="MSGNYLPRNTLVESLGHAMLKLSGWKIEGQLPALDKFVVIGAHHT
FT                   SNWDFVAFLAAKFVLRLNARWFGKHTLFNGPLGGLMRRWGGIPIQRHLKLNTVDQAIQA
FT                   FGEHREFMLIIAPEGTRKKVDRWRMGFYHIARGAGVPVVPAALDYENRRIVIGEPFWPT
FT                   GNEDADLRGLIGFYRPFIPKKPHYAFLGD"
FT   gene            461576..461920
FT                   /locus_tag="PSPA7_0452"
FT   CDS_pept        461576..461920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0452"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81407"
FT                   /db_xref="GOA:A6UYG2"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG2"
FT                   /protein_id="ABR81407.1"
FT                   /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTADAPPAY
FT                   AMIGDLLIARPFLIAATAIGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGC
FT                   TTSGYNHDES"
FT   gene            462190..463179
FT                   /locus_tag="PSPA7_0453"
FT   CDS_pept        462190..463179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0453"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82398"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG3"
FT                   /protein_id="ABR82398.1"
FT                   /translation="MFSQWVFLSVLALAVPSFAWAEDAVSDLAKEQSKAEQGDKRGDEL
FT                   FAEFTRLRQAAETGEPQALFDFGAYFYQQQNYVSAREWWGKAAGAGMARAQIQLAMLYR
FT                   DGDGGREDKTEAARWFRKAAEQGDAGAQNEMGVLYWRGEGVDQDRVKAGSWFERAAASG
FT                   SEDAETNLGWFYLDDLQSDSAVPSSDEEAALLDRYAASREKAFQWFCKAASQGDARAQF
FT                   KVGEAYWNGSGAGMNKLQARLWLEKAAQQQDADAIAWLESADQAAWYTRLENWVHAALD
FT                   GELSGIADCSGVADRRHSGRGVESAPSEPEAVEIGAEDAIQAAEAASQ"
FT   gene            complement(463292..463723)
FT                   /locus_tag="PSPA7_0454"
FT   CDS_pept        complement(463292..463723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0454"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84191"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG4"
FT                   /protein_id="ABR84191.1"
FT                   /translation="MSLFRPLLIASTLALASGCASGLNSQQTAELEYYEARNLAVIEKS
FT                   PGTGAALGLLPGGGSFYGRSYGLGVVNLLFWPLSILWDPVSGYDASQRINYTATRVHLE
FT                   KLRQRDFDELQRLADNGALDGATLARKRQDVETKYRYAP"
FT   gene            complement(463875..465608)
FT                   /gene="ggt2"
FT                   /locus_tag="PSPA7_0455"
FT   CDS_pept        complement(463875..465608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt2"
FT                   /locus_tag="PSPA7_0455"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82549"
FT                   /db_xref="GOA:A6UYG5"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG5"
FT                   /protein_id="ABR82549.1"
FT                   /translation="MSFLNLPVRTLVAACSLTLLSLAAQADSLRGDARPPQQAAVATPH
FT                   PAATVAGLETLANGGNAFDAAVAIAAALAVAEPYGSGLGGGGFFLLRQAGAQPTYRFLD
FT                   ARERAPKAAYADMYRRNGKVDPRLSVNGPLAAAIPGLPAALVELNGRYGRQPLADNLVP
FT                   AIRLAVDGVSVDRIYRDRASMRLEAMRKDPETARIFLDKGGIPDEWNLLRQPQLARTLE
FT                   RLGRYGRIGFYEGETADKLLAGVRAGGGVWSAADLRDYRVIERRPLEVKLANGRELISA
FT                   PPPSAGGVALAQSLQMLEQLPWQKAEPVQRAHYVLEVLRRAYRDRGLLGDPDFVANPLP
FT                   RLLAPDYLKRLAAGIDPRRATPSAALPEAPAWREGDHTTHFAVIDAQGNAVAATLSVNL
FT                   PFGAAFTVPGTGVVLNNEMDDFAADTQGANSYGLAGSQANAVAAGKRPLSSMSPSFLES
FT                   PTDFAAFGTPGGSRIPSMVLISMLQYFDGRPVGQWVAAPRYHHQYKPDVVEYEPRAFSD
FT                   AEAAELRRRGYQLKRLERSYGNQQVLYWDKRSGRVDAASDPRGIGYSAFSPEMQAQPQT
FT                   H"
FT   gene            complement(465736..465987)
FT                   /gene="fdx1"
FT                   /locus_tag="PSPA7_0456"
FT   CDS_pept        complement(465736..465987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx1"
FT                   /locus_tag="PSPA7_0456"
FT                   /product="ferredoxin (4Fe-4S)"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83455"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG6"
FT                   /protein_id="ABR83455.1"
FT                   /translation="MSLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHY
FT                   DEPQCQQVCPVDCIPLDEANVESKDQLMEKYRKITGKA"
FT   gene            complement(466107..466586)
FT                   /gene="coaD"
FT                   /locus_tag="PSPA7_0457"
FT   CDS_pept        complement(466107..466586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="PSPA7_0457"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84621"
FT                   /db_xref="GOA:A6UYG7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG7"
FT                   /protein_id="ABR84621.2"
FT                   /translation="MNRVLYPGTFDPITKGHGDLIERASRLFDHVIIAVAASPKKNPLF
FT                   SLEQRVALAQEVTKHLPNVEVVGFSTLLAHFVKEQKANVFLRGLRAVSDFEYEFQLANM
FT                   NRQLAPDVESMFLTPSEKYSFISSTLVREIAALGGDISKFVHPAVADALAERFKR"
FT   gene            complement(466716..468308)
FT                   /locus_tag="PSPA7_0458"
FT   CDS_pept        complement(466716..468308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0458"
FT                   /product="putative oxidoreductase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00732; match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86585"
FT                   /db_xref="GOA:A6UYG8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG8"
FT                   /protein_id="ABR86585.1"
FT                   /translation="MPVPDLFAEGLARGWKTYNGSRLDHDLELEADVVVVGTGAGGGTT
FT                   AEILSAAGLKVLLVEEGPLKTSSDFRMQEADAYPELYQEGIGRMSKDGAITILQGRAVG
FT                   GTTLINWTSSFRTPEPTLQHWAQVYGVKGHSAEDMAPWFEKMEQRLHVAPWALPPNANN
FT                   DVIRLGCEKLGYHWKVIPRNVLGCWNLGYCGMGCPVNAKQSMLVTTIPATLDKGGELLY
FT                   LARANRLLLEGDKVTGLECLGMDERCVAPNGRKVKVRARHYVLSGGGINTPAILLRSKA
FT                   PDPSQRVGKRTFLHTVNFSAALFDRVINPFYGAPQSIYSDHFQWDDGVTGRMSYKLEVP
FT                   PLQPSLASVLLGGFGSDNALRMEQLPHTNMMLALLRDGFHPDSAEGSVGLRGDDTPVLD
FT                   YRMTDYTWDGIRRAFHTMAEIQFAAGAREVRPVHSDAHNAKNLQEAREIIDGLRLEIYR
FT                   TRLGSAHVMGGCAMGEDPAVAVADSLGRHHHLQNLSIHDGSLFPTSIGANPQLSVYGLT
FT                   AQLASALAERLKA"
FT   gene            complement(468363..468911)
FT                   /locus_tag="PSPA7_0459"
FT   CDS_pept        complement(468363..468911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0459"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86814"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYG9"
FT                   /protein_id="ABR86814.1"
FT                   /translation="MSDTTLESAGLSRRSLMKVGLIGGAFLATAGVAASLTGCSAEKPA
FT                   SGLEKVRESDLPFLRALLPVMLLGAVSAEQMPKAVEGAIQSLDHNLARLSPEMFKLTRQ
FT                   LFDVLALPLTRGPLTGIWGSWENASGDDVRAFLSRWENSFIGLLRMGHSSLMQLAMMAW
FT                   YARPEAWAHCGYPGPPKIA"
FT   gene            complement(468966..470396)
FT                   /locus_tag="PSPA7_0460"
FT   CDS_pept        complement(468966..470396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0460"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82405"
FT                   /db_xref="GOA:A6UYH0"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH0"
FT                   /protein_id="ABR82405.1"
FT                   /translation="MVADIAYLQQSQQEINQLEALFARQRAAYLAQPMPDATQRVEWLK
FT                   ALRDLLFKEQKALIEAIDRDFSARSADETLLAEIMPSLHGIHYAAKRVKKWMKPARRAV
FT                   GLQFQPASAQVVYQPLGVVGVIVPWNYPLFLSIGPLTGALAAGNRVMIKMSESTPATGR
FT                   LLKDLLARIFPEDQVAVVLGEVDVGVAFSKLPFDHLLFTGATSVGKHVMRAAAENLTPV
FT                   TLELGGKSPAIVSDSVPMKDAAERIAFGKSLNAGQTCVAPDYVLVPSRRVEEFVSRYKE
FT                   VVQGFFPRLSDNPDYTAIINERQLGRLQGYLDDAREKGATLVPLFAEGQQRRLPQTLLL
FT                   NVSDDMKVMQEEIFGPLLPVIPYERLEDALAYVNQRPRPLALYYFGYDKAQQRRVLHET
FT                   HSGGVCLNDTLLHVAQDDIPFGGVGPSGMGHYHGHEGFLTFSKAKGVFSKPRFNAARMI
FT                   YPPYGKSIQKLVYKLFVR"
FT   gene            470685..471332
FT                   /locus_tag="PSPA7_0462"
FT   CDS_pept        470685..471332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0462"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85206"
FT                   /db_xref="GOA:A6UYH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH1"
FT                   /protein_id="ABR85206.1"
FT                   /translation="MAPRIKTRDRIAQASLELFNAQGERSVTTNHIATHLGISPGNLYY
FT                   HYPNKQAIIAELFAEYESHVESFLRLPEGRGVTVDDKTFYLEALLAAMWRYRFLHRDLE
FT                   HLLESDPELAARYRAFAQRCLVNAKAIYRGFTEAGILRMNETQLEALTLNAWIILTSWV
FT                   RFLCTTLDLDGDLSEAQLRRGIYQVLALESGHIEAQAQEAVDGISERLYVPL"
FT   gene            complement(471317..471727)
FT                   /locus_tag="PSPA7_0461"
FT   CDS_pept        complement(471317..471727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0461"
FT                   /product="putative acetyltransferase"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84825"
FT                   /db_xref="GOA:A6UYH2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH2"
FT                   /protein_id="ABR84825.1"
FT                   /translation="MDLKLRHNPVLDDIDCEAILAIHAAVGWDRRMPAAELRTLYQHSS
FT                   YYLLAERDGRLVGLLRAEEETPIRVWLAEIAVLPGAQSSGVGAALLRRFAEDHRGAFLF
FT                   TDATLGTEAFFRRHGIHIQQVLEKTPRDQSGT"
FT   gene            complement(471790..472788)
FT                   /locus_tag="PSPA7_0463"
FT   CDS_pept        complement(471790..472788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0463"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85696"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH3"
FT                   /protein_id="ABR85696.1"
FT                   /translation="MSALPTFQPAWWLPNPHLQTLWSPFFRRGPALERQRERLWLADGD
FT                   FIDLDWAGPHEADTPLVLALHGLTGSSSSHYILGLQRALLERGWASVALNWRGCSGEPN
FT                   RLPRGYHSGVSDDLAEVVAHLRARRPQAPLYAVGYSLGGNVLLKYLGETAGDCPLLGGV
FT                   AVSVPFRLDECADRIGLGFSRVYQAHFMKAMLAYVQDKQRLFGEQGQAEGLAALQRLGP
FT                   LEGMRTFWDFDGRVTAPLHGFADARDYYRRASSRYYLPDIRTPSLIIHSSDDPFVFARS
FT                   LPERSELAPCTELELHARGGHVGFVGGSPRQPSYYLERRIPDWLEARLRQR"
FT   gene            complement(472823..473386)
FT                   /locus_tag="PSPA7_0464"
FT   CDS_pept        complement(472823..473386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0464"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84828"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH4"
FT                   /protein_id="ABR84828.1"
FT                   /translation="MNPASHAIRQRLLALGERSVAQPASDWQGDIALPAELERFYREVG
FT                   PLDCTLETAGNPFFLPSLARLWQRQAGYRWHGLSGERLAGWQDDWLVVADQGADPFILE
FT                   TGSGRVLFDLHGGAWDPAPCFDDLWQMAASLACFGQVWSDAGEDILLEDCSVAPCYRHQ
FT                   LIDELLPILGSRQRAEDLADEFGW"
FT   gene            complement(473383..473985)
FT                   /locus_tag="PSPA7_0465"
FT   CDS_pept        complement(473383..473985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0465"
FT                   /product="putative methyltransferase"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF03602; match to protein family HMM TIGR00095"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82693"
FT                   /db_xref="GOA:A6UYH5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH5"
FT                   /protein_id="ABR82693.1"
FT                   /translation="MRKPTAKVPGRHGGQGQLRIIGGEWRSRRFAFPDGPGLRPTPDRV
FT                   RETLFNWLAPHIEGARVLDPFAGSGALFLEALSRGAREGLALDTNGEAVAALRSHLDVL
FT                   KCGTAQLILGDALRYLENQVASAFDLVFLDPPFHQNLLQDACRLLETRGWLNAEAWIYT
FT                   ESESPPSSLGLPGNWRLHREKKAGNVHYALWQRSDRP"
FT   gene            complement(473985..475472)
FT                   /locus_tag="PSPA7_0466"
FT   CDS_pept        complement(473985..475472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0466"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85593"
FT                   /db_xref="GOA:A6UYH6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH6"
FT                   /protein_id="ABR85593.1"
FT                   /translation="MSERTGLRYGLLGLIVIALLAALAYFVARPTQTPAAAHAAAVAEN
FT                   QLQSLKDVAKQAPVHRKLDIQEWKTAEGAKVLFVEAHELPMFDLRLTFAAGSSQDAGSP
FT                   GLSMLTNAMLNEGVPGKDTTAIAAGFEDLGASFSNGSYRDMAVAGLRSLSDADKRTQAL
FT                   KLFEQVIGQPTFPEEALARIKNQVLAGFEYQKQNPGKLAGLELFKRLYGEHPYAHSSDG
FT                   DEKSIPPITREQLQAFHKKAYAAGNVVIALVGDLSRQDAEAIAAEVSKALPQGPALAKT
FT                   AQPEAPKPGLTHIEFPSEQTHLMLAQLGIDRQDPDYAALYLGNQILGGGGFGTRLMDQV
FT                   REKRGLTYGIYSGFTAMQARGPFMINFQTRAELSEGALKLVQDIVRDYLANGPTQKELD
FT                   DAKRELAGSFPLSTASNADIVGQLGAIGFYGLPLDYLESFLKQVEGLSVEQVRTAMARH
FT                   LDADAFVIVSAGPSVPQKPLPPPTAKPAQQPSGVPEH"
FT   gene            complement(475465..476835)
FT                   /locus_tag="PSPA7_0467"
FT   CDS_pept        complement(475465..476835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0467"
FT                   /product="putative zinc protease"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82919"
FT                   /db_xref="GOA:A6UYH7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH7"
FT                   /protein_id="ABR82919.2"
FT                   /translation="MKTPARRRVGLLLASLCLPLFAQAAETQPTHEFSLDNGLKVIVRE
FT                   DHRAPVVVSQLWYRIGSSYETPGLTGLSHALEHMMFKGSRKLGPGEASRVLRDLGAEEN
FT                   AFTTDDYTAYYQVLARDRLPVALEMEADRMAHLSLPADQFKSEIEVIKEERRLRTDDNP
FT                   NALAFERFKAAAYPASGYHTPTIGWMADLQRMTIDDLRHWYESWYAPNNATLVVVGDVT
FT                   ADEVKTLAKRYFGEIPWRQLPPARKPLELAEPGERRLKLYVRTQLPNLIMGFNVPSLGS
FT                   SENPREVNALRLIGALLDGGYSARLASRLERGEELVAGASTYYDAFNRGDSLFVLSATP
FT                   NVQKGKTLEQVEAGLWKQLDDLKQNPPSAAEIERVRAQMIAGMVYEKDSIAAQASSIGQ
FT                   LESVGLSWKLIDQDLEALKAVTPDDIQKAARTYFTPSRLTLAQVLPVKAEEKEARHE"
FT   gene            476983..478326
FT                   /locus_tag="PSPA7_0468"
FT   CDS_pept        476983..478326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0468"
FT                   /product="cell division protein FtsY"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00448; match to protein family HMM PF02881; match to
FT                   protein family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84289"
FT                   /db_xref="GOA:A6UYH8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH8"
FT                   /protein_id="ABR84289.1"
FT                   /translation="MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPVEPVSETT
FT                   AAEQRTPADDAAPALTEQPVRQEPPAAVPAMPPAPVAEAPLAHGEPATPVEAPVAQPEP
FT                   ILAAEPEPEPEPEPEPEPAAPVAAAPAASEPAARPGFFARLRQGLSKTSASIGEGMASL
FT                   FLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEEL
FT                   ASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFR
FT                   AAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDN
FT                   LMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQARQFNLAVELTGLALTKLDGT
FT                   AKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA"
FT   gene            478323..478994
FT                   /gene="ftsE"
FT                   /locus_tag="PSPA7_0469"
FT   CDS_pept        478323..478994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PSPA7_0469"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86784"
FT                   /db_xref="GOA:A6UYH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYH9"
FT                   /protein_id="ABR86784.1"
FT                   /translation="MIRFEQVGKRYPNGHVGLHEVSFRVHRGEILFVTGHSGAGKSTLL
FT                   RLILAMERPTSGKLLLGGQDLGRITTAQIPFLRRQIGVVFQNHQLLTDRTVAGNIALPL
FT                   QILGMPKPEIAKRVASALERVNLKEKGEALPSDLSTGQQQRVGIARAIVHQPALLLADE
FT                   PTGNLDPRLASEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRIIADREDE
FT                   A"
FT   gene            478994..480001
FT                   /gene="ftsX"
FT                   /locus_tag="PSPA7_0470"
FT   CDS_pept        478994..480001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PSPA7_0470"
FT                   /product="cell division protein FtsX"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84394"
FT                   /db_xref="GOA:A6UYI0"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI0"
FT                   /protein_id="ABR84394.1"
FT                   /translation="MSANDLPRGPEEGAPERKTREKPSQEQTDWSGSFGAYLESHRASL
FT                   VDSLRRLFGHPFGSFFTCLVMGITLSLPMGLSLLLNNVERLGGSWQRAAQISLFLDLKT
FT                   SEDQGQDLRERIERLPDVIEAQLISREQALSELQEQSGLGEALKELPENPLPPVISVTP
FT                   KQIDRAGLEALRQQLAELPHVQQAQLDLVWVERLSAILKLGERFVFGLTILLVLTLLLV
FT                   VGNTIRLHIENRRNEIEVIKLVGGTDGYVRRPFLYMGALYGLGAGILSWALLAYSLNWL
FT                   NGSVVNLSGLYGSDFGLQGVPLDDGLSLTVGAVLLGWVGAWLAVARHLRELAPR"
FT   gene            480115..480969
FT                   /gene="rpoH"
FT                   /locus_tag="PSPA7_0471"
FT   CDS_pept        480115..480969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="PSPA7_0471"
FT                   /product="alternative sigma factor RpoH"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF04542; match to protein family HMM PF04545; match to
FT                   protein family HMM TIGR02392; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86298"
FT                   /db_xref="GOA:A6UYI1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI1"
FT                   /protein_id="ABR86298.1"
FT                   /translation="MTTSLQPVHALVPGANLEAYVHSVNSIPLLSPEQERELAERLFYQ
FT                   QDLEAARQMVLAHLRFVVHIAKSYSGYGLAQADLIQEGNVGLMKAVKRFNPEMGVRLVS
FT                   FAVHWIKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSQKKRLAWLNNEEVHRVAESLG
FT                   VEPREVREMESRLTGQDMAFDPAADADDESAYQSPAHYLEDHRYDPARQLEDADWSDSS
FT                   SANLHEALEGLDERSRDILQQRWLSEEKATLHDLAEKYNVSAERIRQLEKNAMSKLKGR
FT                   ILA"
FT   gene            481034..481639
FT                   /locus_tag="PSPA7_0472"
FT   CDS_pept        481034..481639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0472"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83767"
FT                   /db_xref="GOA:A6UYI2"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI2"
FT                   /protein_id="ABR83767.1"
FT                   /translation="MPRNTRWLFYLSLAVLTFVVGAWLVRTPEPARPLPWLADWREQVL
FT                   APLADNALTLRELHDAVDGELWVDPRLDGVRLAFRGRLLGDGGPWQVEGELGLSAEEQL
FT                   SLQRASALKPGSAPQPLSAGLEGQLGDKPIVALSMIPDGRVGAERLLASLGQPRLRLQL
FT                   AQGEAWVYPQLGLTAHLPDDDLRLMLAVPRQALEKPLK"
FT   gene            481729..482604
FT                   /locus_tag="PSPA7_0473"
FT   CDS_pept        481729..482604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0473"
FT                   /product="IS3 family transposase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81266"
FT                   /db_xref="GOA:A6UYI3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI3"
FT                   /protein_id="ABR81266.2"
FT                   /translation="MSKRKRYSPEFKREAIELVRRSGASCRQVALEIGVAPDLLTRWVR
FT                   EAQSGVEKAFLGTGSPRDEELARLKRELARVLRSVIFKRRGSVLCQGVIERHTVIQRCR
FT                   NEYPVRLMCRCLKVSANGYYAWQDRAPSPRARANARLVKRIREIHEHSRGMIGAPRMHE
FT                   DLLDEGETVSPEPRCPPEGSRAHSRLAAPEEVCFGRSASSLQPPASSLQPPAGVSNLLE
FT                   RVFTALEPERKWVTDITEISTLEGKLFLCVVLDLYSKLVIGWSMHHRQDRQMVIRAVEM
FT                   VIWQRRGTGR"
FT   gene            483568..484791
FT                   /locus_tag="PSPA7_0474"
FT   CDS_pept        483568..484791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0474"
FT                   /product="6-aminohexanoate-dimer hydrolase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85553"
FT                   /db_xref="GOA:A6UYI4"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI4"
FT                   /protein_id="ABR85553.2"
FT                   /translation="MIKKYTNKKIVIVLSAALVILTATYIGSKGVRFWKLHTLFNSNKI
FT                   NENFRSMPDMFESLPVIKDSETNQFQTELANMPVSFSFQGRQILFDDWIKSSNTTGIIV
FT                   FSNDRIAYERYFQGNSSQSLAIGWSLSKSIMSLLIGMAVDDGSIHSLLDPVNLYAPQLS
FT                   TSGYAGVSLRDVLEMSSGIAFNEDYGDPDSDINQLGRTIALGGSVNETVSSLRRGDAPG
FT                   RVHHYVSADTQVLGMVLLGSTGMGPSKFMSKRLWSKLGAECKGEWLTDDKGTELAFGGV
FT                   NLCLRDFARIGLLYLRNGKSLNGNQIVSSAWVTASTKPRSDHLRPGRFKESGEPNLGYG
FT                   YQWWIPEGMEGEFLAIGVYGQFIYVNPKRGVVIAKTSAYSNYNVDGISMEHEAIAAFRA
FT                   ISRTVGVK"
FT   gene            484794..485777
FT                   /gene="vqsM"
FT                   /locus_tag="PSPA7_6386"
FT   CDS_pept        484794..485777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vqsM"
FT                   /locus_tag="PSPA7_6386"
FT                   /product="AraC-type transcriptional regulator VqsM"
FT                   /note="manually annotated"
FT                   /db_xref="GOA:A0A4D6FTR4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FTR4"
FT                   /protein_id="QCB64560.1"
FT                   /translation="MDLTTEHILDFEWRPLQNYLRDRGIPTPPIETSQQLRSDRLYNWI
FT                   VSKGYSGEEGLNLGTYYHISDYGVIGLALQCAENVVDLLKVIRAYVKLFNRDIADVRVN
FT                   AGEHYEVEVHVLVNFKPEWTAASRQFHVNVIASASYKLMMDLLGTDFPISALTVPVYIS
FT                   DKTNYEHFFSLPVSHELSEIVFKFPAQQMSKTLVTANPAVFQSALAMASETFNALLEIE
FT                   MGGLRQRIELFLESIPDCYPSLVTTAKHLRMNERTIRRRLADEGCSYRQIVDTARKSRA
FT                   ISLLLNSSIPVERISDILGYSEPACFRHAFRRWTGKSTTSFRNKSH"
FT   gene            485809..486297
FT                   /locus_tag="PSPA7_6387"
FT   CDS_pept        485809..486297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_6387"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4D6FV11"
FT                   /protein_id="QCB64561.1"
FT                   /translation="MNYNNRNNQIQAMIAETQFDAYVLGYIAKARTNSAPDESLRIEAE
FT                   GSAMLAGLISDSCRKRRTPTPPFPYLLLQIAHEALDRTKSNLAKARDTSRADSSCLEIL
FT                   NQAVWDTAVAMDNISEFVEPDQGSVSLIKKLVEFAQKSGTKEGQALALQALAVLGVNY"
FT   gene            complement(486779..488374)
FT                   /locus_tag="PSPA7_0476"
FT   CDS_pept        complement(486779..488374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0476"
FT                   /product="VgrG protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF04524; match to protein family HMM TIGR01646; match to
FT                   protein family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84174"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI6"
FT                   /protein_id="ABR84174.1"
FT                   /translation="MSIRCDLRFTFTAGAGAGADAFEVVEFHLVESLSETFHLDVQLSC
FT                   ANPAVDFGQILDRPALLTIWQGGQPVRYVHGSVTSFQQGNTGFRRTRYRAIVEPRLARL
FT                   QLASDWRIFQALSVPDIATAVLKKHAITLDYEQKVTNPHAPREYCVQAGGTDYHFVERI
FT                   MREEGFFYGFLHNAEGHRLIHCDRLWIFGKQPGLPVEYNPQAGGDRPGPALRSFTYGEN
FT                   VRTARQTQRDYNFKNPLYNQQTKRAGEGEGEGEGEEIYCDEFGRVKVQFPWDREGRHDE
FT                   HSSCWIRVSQKIAGALWGHMAIPRIGQEVIISNFDGDPDQPVITGRSFNANQRPPYELP
FT                   RHKTRMPLKSQTHKGEGFNELRFEDEAGQEEILIHAQEDQNNIVNHDETTFVGHDRKEQ
FT                   VEHDEIIDIGHDRTETVGNDEQVTIGQDRRHDIDRDDYLTIERNHTITTGKTAPNRWAT
FT                   TAATRPPPTNGWRLAGTWSNGWRAMRCWKRASQLSSARALSSYRLVKSSACTAPAEPSR
FT                   CTTEASHWRGSPSP"
FT   gene            complement(488633..489331)
FT                   /gene="mtgA"
FT                   /locus_tag="PSPA7_0477"
FT   CDS_pept        complement(488633..489331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="PSPA7_0477"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84827"
FT                   /db_xref="GOA:A6UYI7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI7"
FT                   /protein_id="ABR84827.2"
FT                   /translation="MLRSLLRRLFKYLLWFMAASVVLVAVLRWVPPPGTMVMLERKVGS
FT                   WVDGQPIDLQRDWRSWEQLPDSLKVAVIAGEDQHFAEHHGFDLPAIQQALAHNERGGSI
FT                   RGASTLSQQVAKNVFLWSGRSWLRKGLEAWFTLLIETLWTKQRILEVYLNSAEWGPGVF
FT                   GAQAAARYHFGLDAERLSRAQASQLAAVLPSPLKWSAARPGPYVRQRAAWIRQQMWQLG
FT                   GEDYLLRLER"
FT   gene            489401..489778
FT                   /locus_tag="PSPA7_0478"
FT   CDS_pept        489401..489778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0478"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04241"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81813"
FT                   /db_xref="GOA:A6UYI8"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI8"
FT                   /protein_id="ABR81813.1"
FT                   /translation="MLRPFLLLAAFFGFTGVALGAFAAHGLKKQLSAEHLAVFQTGVHY
FT                   QLIHALALFGVALLATRLDGRLVSAAGGLFTLGILLFSGSLYLLTLSGIGKLGIITPFG
FT                   GVSFLAGWLCLGLAAWRLGNA"
FT   gene            489881..490081
FT                   /gene="thiS"
FT                   /locus_tag="PSPA7_0479"
FT   CDS_pept        489881..490081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="PSPA7_0479"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02597; match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83145"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYI9"
FT                   /protein_id="ABR83145.1"
FT                   /translation="MQIQLNGEAFELPDAQSVADLLARLELGGRRVAVELNLDIVPRSQ
FT                   HASTALKDGDRVEIVHAIGGG"
FT   gene            490135..490932
FT                   /gene="thiG"
FT                   /locus_tag="PSPA7_0480"
FT   CDS_pept        490135..490932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PSPA7_0480"
FT                   /product="thiamine biosynthesis protein, thiazole moiety"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85522"
FT                   /db_xref="GOA:A6UYJ0"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYJ0"
FT                   /protein_id="ABR85522.1"
FT                   /translation="MSQASSTDTPFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAE
FT                   IVTVAVRRTNIGQNPGEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHN
FT                   LVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPL
FT                   AGLIGSGLGICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHA
FT                   RDPVMMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGLID"
FT   gene            491023..491757
FT                   /gene="trmB"
FT                   /locus_tag="PSPA7_0481"
FT   CDS_pept        491023..491757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="PSPA7_0481"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02390; match to protein family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85594"
FT                   /db_xref="GOA:A6UYJ1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYJ1"
FT                   /protein_id="ABR85594.1"
FT                   /translation="MSDTPQSPAQDSLAEHDEARPMRTVKSFVMRAGRMTEGQQRGLDL
FT                   GWPKFGLELSDEVQDFDAIFGRQAPRTFEIGFGMGHSTLEMAAAAPDLDFIGVEVHKPG
FT                   VGALLNGLLTQGLGNVRVYSCDALEVLRHCVADASLDRLLLFFPDPWHKKRHHKRRIVQ
FT                   PEFAELVRRKLKVGGVLHMATDWEPYAEHMLDVMSAAPGYRNQAEDGRFVPRPQERPVT
FT                   KFERRGERLGHGVWDLKFERVD"
FT   gene            491920..493266
FT                   /locus_tag="PSPA7_0482"
FT   CDS_pept        491920..493266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0482"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF07044"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86165"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYJ2"
FT                   /protein_id="ABR86165.1"
FT                   /translation="MLKKLGILLLGAGCAWAAQAKVDEVQAARLDQDLTPLGAERAGNA
FT                   DGSIPPWTGGITQAPAGYRPGMHHLDPFAADRPRLVLDSRNMAAYQALLTPGTQALLQA
FT                   NPDYHLRVFPTRRSASLPQRLYDATRANASRAELIADGNGVQGAAAGVPFPLPQSGQEA
FT                   IWNHIMRYRGEQLHLQTNQAAVLANGSYNLLKLDRYLYFVYGREGMIPENLDNTLFYYK
FT                   YKVVAPARLAGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPTLAYDSLQPDTNGMAT
FT                   ADTVDVYNGAPDHYEWALLGKREMLVPYNSYAVHQKGLAYGDILKSRFINPDLLRYELH
FT                   RVWVVEATLRKGFSHPYAKRRFYLDEDSWQILAADIYDKDGVLTRAQEVHPINYYDVPL
FT                   VSSTLEAIYDFKGGRYFVDGLDNNEPMYDFGVQVGPRDFTPQALRREGN"
FT   gene            complement(493279..493536)
FT                   /locus_tag="PSPA7_0483"
FT   CDS_pept        complement(493279..493536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0483"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83519"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYJ3"
FT                   /protein_id="ABR83519.1"
FT                   /translation="MKPIKHLYLHFTDGQRLSLRFPRQQDDPAEVARSIRQQLDTPYLS
FT                   VEVDGDLLLIPRDSIKYLQISPAPARLDDDGTLRGAELIV"
FT   gene            complement(493598..493921)
FT                   /locus_tag="PSPA7_0484"
FT   CDS_pept        complement(493598..493921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0484"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80657"
FT                   /db_xref="GOA:A6UYJ4"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYJ4"
FT                   /protein_id="ABR80657.1"
FT                   /translation="MDYALDLIATLSRWSRSHLSDISLAIMATLLVLFGPAINAWVQQR
FT                   IGSLNFVFRTLLFVLICAVGYGLAMVFVTPWLAKGLGYFNNYTLAPVLLLVFFVIGMIA
FT                   DRS"
FT   gene            complement(494002..495156)
FT                   /locus_tag="PSPA7_0485"
FT   CDS_pept        complement(494002..495156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0485"
FT                   /product="putative oxidase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04055; match to protein family HMM PF06969; match to
FT                   protein family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82080"
FT                   /db_xref="GOA:A6UYJ5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYJ5"
FT                   /protein_id="ABR82080.1"
FT                   /translation="MTQAAPFQLPPLALYVHIPWCVRKCPYCDFNSHAAGPELPEEAYV
FT                   DALLADLEQDLRHVHGRRLGSIFFGGGTPSLFSAKALGRLLEGVERRVGFADGIEITLE
FT                   ANPGTFEQAKFADYRRLGINRLSIGVQSFQADKLQALGRIHDGDEAVRAADMARQAGFD
FT                   NFNLDLMHGLPGQSLDDALADLRQALALAPTHLSWYQLTMEPNTVFWSQPPELPEDDIL
FT                   WDIQEAGQALLDEHGYRQYETSAYARDGLRARHNLNYWSFGDFLGIGAGAHAKLSAPDG
FT                   RIVRTWKTRLPKDYLNPQKAFQAGERPLEAADLPFEFMMNVLRLVDGVPAALYPQRTGQ
FT                   PLAALADACAAARDAGLLAEDPQRLRPSERGQLFLNDLLQHFLP"
FT   gene            complement(495278..495871)
FT                   /gene="rdgB"
FT                   /locus_tag="PSPA7_0486"
FT   CDS_pept        complement(495278..495871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="PSPA7_0486"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01725; match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84863"
FT                   /db_xref="GOA:A6UYJ6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYJ6"
FT                   /protein_id="ABR84863.1"
FT                   /translation="MIKLEQLVLASHNAGKLKELQAMLGASVKVRSIGEFSQVEPEETG
FT                   LSFVENAILKARNAARISGLPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAKLL
FT                   EALKDVPDAGRGAQFVSVLALVRHADDPLPILCEGIWEGRILREARGAHGFGYDPLFWV
FT                   PERDCSSAELAPEEKNRLSHRARAMALLKQRLGL"
FT   gene            complement(495868..496287)
FT                   /locus_tag="PSPA7_0487"
FT   CDS_pept        complement(495868..496287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0487"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84141"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYJ7"
FT                   /protein_id="ABR84141.1"
FT                   /translation="MRRFTAFVLGLCLSLPVLAEQVQRFGDLDVHYNVFNSSFLQPNVA
FT                   SAVGLVRSKAQGVINVVPMEKGKPVEASVTGSARDLTGKVIPLEFRRVSEEGAIYNLAQ
FT                   FPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE"
FT   gene            complement(496417..497037)
FT                   /gene="metW"
FT                   /locus_tag="PSPA7_0488"
FT   CDS_pept        complement(496417..497037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="PSPA7_0488"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF07021; match to protein family HMM PF08241; match to
FT                   protein family HMM PF08242; match to protein family HMM
FT                   TIGR02081"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83932"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYJ8"
FT                   /protein_id="ABR83932.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLAWLRDHKQVSGYGLEI
FT                   DPDNIARCIENGVNVIEQDLDKGLGNFASDSFDVVVMTQALQAVHYPDKILEEMLRVGK
FT                   TCIITFPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFQDFERLCRQLRMRV
FT                   LDRLAVDRDHRHGWASRLWPNLLGEIGIYRVTGPGVQTRSLAV"
FT   gene            complement(497045..498184)
FT                   /gene="metX"
FT                   /locus_tag="PSPA7_0489"
FT   CDS_pept        complement(497045..498184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="PSPA7_0489"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00561; match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86723"
FT                   /db_xref="GOA:A6UYJ9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYJ9"
FT                   /protein_id="ABR86723.1"
FT                   /translation="MPTVFPDDSVGLVSPQTLHFNEPLELTSGKSLAEYDLVIETYGEL
FT                   NATQSNAVLICHALSGHHHAAGYHSAEDRKPGWWDSCIGPGKPIDTRRFFVVALNNLGG
FT                   CNGSSGPASINPATGKVYGADFPMVTVEDWVHSQARLADRLGIRQWAAVVGGSLGGMQA
FT                   LQWTISYPERVRHCLCIASAPKLSAQNIAFNEVARQAILSDPEFLGGYFQEQGVIPKRG
FT                   LKLARMVGHITYLSDDAMGAKFGRVLKTEKLNYDLHSVEFQVESYLRYQGEEFSTRFDA
FT                   NTYLLMTKALDYFDPAAAHGDDLVRTLEGVEADFCLMSFTTDWRFSPARSREIVDALIA
FT                   AKKNVSYLEIDAPQGHDAFLMPIPRYLQAFSGYMNRISV"
FT   gene            complement(498274..500241)
FT                   /locus_tag="PSPA7_0490"
FT   CDS_pept        complement(498274..500241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0490"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80684"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK0"
FT                   /protein_id="ABR80684.1"
FT                   /translation="MSMERLSHQIDAYVAWKRELMREITRYRGWLERSRLNSPAVEAKL
FT                   ERALRQLRADHITLAFVGEFSRGKTELINSLFFAGYGQRMLPSHAGRTTMCPTELFHDP
FT                   RAERSYIRLLPIETRLADASVAQFKRVPRHWVNIPLDTSDPEGMAQAFAQVAKTKALPV
FT                   EQAIQLGFHPDALEAADEPDQVRVPAWRHALVNFDHPLLRQGLRILDTPGLNALGSEPE
FT                   LTLSMLPNAQAILFLLSADAGVTASDMEIWQKYIQPLREDGHSSLFAVLNKIDVLWDDL
FT                   SGERFVQNAIRLIQDGTARQLGLQRGDVLPLSAKQALLAKVRGEPALLERSRLDRLEAL
FT                   LCERIVAQKEALLENAVLGQVLGLLHNSQHLLRLRLEKVEEQRALLDDKQRDSGQLLFE
FT                   LTAKTKDDHGRHHRRLLNLKTNQRLLQHQGATLRETIRSERMEQHLQKVRRNLNGSLTT
FT                   VGINQAILAFFRAVEHDLDNLEHEAGMANRMVAAIYRRHNEENPLYALDAPQLRVQRYQ
FT                   HELLQLKKKGDQFRLQLKTVLTEQRLLTRRFFATLVQEVVGLYQRLREETERWAGDALL
FT                   PLMQHTLENKQLLESHMLRLKGLAQETQQVRQRSQAFAGFAEELQEQMREAGDILRQLR
FT                   RPSPLQRQAKVVNLPGSQRA"
FT   gene            complement(500349..500645)
FT                   /locus_tag="PSPA7_0491"
FT   CDS_pept        complement(500349..500645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0491"
FT                   /product="YggU family protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82868"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK1"
FT                   /protein_id="ABR82868.2"
FT                   /translation="MSFYRWDGEDLLLDCHLQPKASRDEFAGLHGERLKIRLTAPPVEG
FT                   KANAHLLAFLGKAFGVAKSLVSLESGELNRQKRVRIRRPTRLPEELGIAARPA"
FT   gene            complement(500642..501235)
FT                   /locus_tag="PSPA7_0492"
FT   CDS_pept        complement(500642..501235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0492"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82230"
FT                   /db_xref="GOA:A6UYK2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK2"
FT                   /protein_id="ABR82230.1"
FT                   /translation="MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFIV
FT                   RATKPLLNPLRRIIPGFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIWSI
FT                   IAVTSLFLKVFFFALIISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGGLDI
FT                   SPIFAFLALKLIDMLVINNLAAMTGMPQQLSIFL"
FT   gene            complement(501246..502067)
FT                   /gene="proC"
FT                   /locus_tag="PSPA7_0493"
FT   CDS_pept        complement(501246..502067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="PSPA7_0493"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01210; match to protein family HMM PF03807; match to
FT                   protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83951"
FT                   /db_xref="GOA:A6UYK3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK3"
FT                   /protein_id="ABR83951.1"
FT                   /translation="MSTPRIAFIGAGNMAASLIGGLRAQGVPAERIRASDPGAEQRAKI
FT                   AGEFAIDVVESNAEAVTGADVVVLAVKPQAMKAVCQALAPALQAEQLIVSIAAGIPCAS
FT                   LEAWLGQPRPVVRCMPNTPALLRQGASGLYANAQVSAVQREQAGQLLSAVGIALWLDDE
FT                   AQIDAVTAVSGSGPAYFFLLMQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSDAG
FT                   PAELRRRVTSPNGTTEAAIKSFQANGFEALVEQALNAASQRSAELAEQLGQ"
FT   gene            complement(502079..502771)
FT                   /locus_tag="PSPA7_0494"
FT   CDS_pept        complement(502079..502771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0494"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01168; match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83256"
FT                   /db_xref="GOA:A6UYK4"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK4"
FT                   /protein_id="ABR83256.1"
FT                   /translation="MSTIAENIAKVAARIREAAQAAGRDPATVGLLAVSKTKPAAAVRE
FT                   AHAAGLRDFGENYLQEALGKQAELADLSLNWHFIGPIQSNKTRPIAEHFQWVHSVDRLK
FT                   IAQRLSEQRPAGLPPLNICLQVNVSGEASKSGCAPEDLPALAEAVKLLPNLRLRGLMAI
FT                   PEPTVERAAQHAAFARLRELLLGLNLGLDTLSMGMSDDLEAAIAEGATWVRIGTALFGA
FT                   RDYGAPTS"
FT   gene            502986..504020
FT                   /gene="pilT"
FT                   /locus_tag="PSPA7_0495"
FT   CDS_pept        502986..504020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="PSPA7_0495"
FT                   /product="twitching motility protein PilT"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00437; match to protein family HMM TIGR01420"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85188"
FT                   /db_xref="GOA:A6UYK5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK5"
FT                   /protein_id="ABR85188.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHK
FT                   QVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKIGGGRVAAHE
FT                   IMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKI
FT                   PENF"
FT   gene            504200..505348
FT                   /gene="pilU"
FT                   /locus_tag="PSPA7_0496"
FT   CDS_pept        504200..505348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilU"
FT                   /locus_tag="PSPA7_0496"
FT                   /product="twitching motility protein PilU"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86329"
FT                   /db_xref="GOA:A6UYK6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK6"
FT                   /protein_id="ABR86329.2"
FT                   /translation="MEFEKLLRLMVEKGGSDLFITAGVPPSMKVNGRVMPVTKTPLSPE
FT                   QTRETVLGVMNEQQRRDFAENHECNFAISARGIGRFRVSAFYQRNLVGMVLRRIETNIP
FT                   TLDELKLPEILKKLALTKRGLVIFVGATGTGKSTSLAAMIGYRNKNSTGHIISIEDPIE
FT                   YIHQHQGCIVTQREVGLDTDSFEVALKNTLRQAPDVIMIGEVRSRETMDHAVAFAETGH
FT                   LCLATLHANNANQALERIIHFFPADRHGQVWMDLSLNLKAIVAQQLVPTPDGKGRRAVI
FT                   EVLLNTPLAADLIRKGEVHELKPLMKRSTEQGMQTFDQALYQLYTQGEITYEDALAHAD
FT                   SANDLRLMIKLGSESDADHLSSMTQGLSLEITDDDPAGRRFR"
FT   gene            complement(505356..506255)
FT                   /locus_tag="PSPA7_0497"
FT   CDS_pept        complement(505356..506255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0497"
FT                   /product="putative cation efflux system protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01545; match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85449"
FT                   /db_xref="GOA:A6UYK7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK7"
FT                   /protein_id="ABR85449.1"
FT                   /translation="MSAGHEHSFAQTNETRLKWALLLTGSFLVAEVVGGILTGSLALIS
FT                   DAAHMLTDAMALVIALAAINIAKRPTNDRLTYGYHRFEILAAAFNAILLFGVAFYILYA
FT                   AYERLSQPAEIQSVGMLVIAVLGLLVNLASMRLLAPAQGNSLNVKGAYLEVWSDMLGSL
FT                   GVIVAAIVIRVTGWAWVDSLVAVLIGFWVLPRTWILLRESLHVLLEGVPKEIQLAELRE
FT                   ALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPNQVDAEALLGTVKALLHDRYEIEHS
FT                   TLQLETSACAQAEEPLAY"
FT   gene            506408..506812
FT                   /locus_tag="PSPA7_0498"
FT   CDS_pept        506408..506812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0498"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81933"
FT                   /db_xref="GOA:A6UYK8"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK8"
FT                   /protein_id="ABR81933.1"
FT                   /translation="MTQQHDTHSKAIGYLLWIFGFTGSHRFYYGKPITGTIWFFTFGLF
FT                   FIGWIVDLFLIPSMDREADRRFQGGNLDYNVAWILLTFLGALGVHRMYMGKWITGIIYL
FT                   FTGGLFFLGVLYDFWTLNGQVSERNGPQRI"
FT   gene            507054..508427
FT                   /locus_tag="PSPA7_0499"
FT   CDS_pept        507054..508427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0499"
FT                   /product="cystathionine beta-synthase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00291; match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81918"
FT                   /db_xref="GOA:A6UYK9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYK9"
FT                   /protein_id="ABR81918.1"
FT                   /translation="MTSDSRPAVLDLIGNTPLVRVTRFDTGPCTLFLKLESQNPGGSIK
FT                   DRIGVAMIEAAERDGRLRPGGTIVEATAGNTGLGLALVGRAKGYRVVLVVPDKMSTEKV
FT                   LHLRAMGAEVHITRSDVGKGHPEYYQDVAARLAQDIPGAFFADQFNNPANPLAHECGTG
FT                   PELWAQTGHDLDAVVVGVGSSGTLTGLTRFFQKVQPDLEMVLADPQGSIMAEYSRSGTL
FT                   GTPGSWAVEGIGEDFVPAIADLSSVRHAYSIGDEESFAMARELLRVEGIPGGSSTGTLL
FT                   AAALRYCREQTEPKRVVSFVCDTGTRYLSKIYNDQWMTDQGLLQRKHYGDLRDIIARRF
FT                   EEGRVISVGPDDTLLTAFQRMRLADVSQLPVLDNGKLVGVIDESDILLGVHADAPRFRD
FT                   AVSSAMNAAPETLAPGASLGELQAVLDRGLVAIVADASGFHGLITRFDLLNHLRRKLT"
FT   gene            508424..509608
FT                   /locus_tag="PSPA7_0500"
FT   CDS_pept        508424..509608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0500"
FT                   /product="putative cystathionine gamma-lyase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01053; match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84536"
FT                   /db_xref="GOA:A6UYL0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYL0"
FT                   /protein_id="ABR84536.1"
FT                   /translation="MSQHDQNPDAPAQAFATRVIHAGQAPDPSTGAIMPPIYANSTYIQ
FT                   ESPGVHKGLDYGRSHNPTRWALERCVADLEGGAQAFAFASGLAAISSVLELLDAGSHIV
FT                   SGNDLYGGTFRLFERVRRRSAGHRFSFVDPTDLSAFEAALTPETRMIWVETPSNPLLRL
FT                   TDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLNGHSDVIGGIAI
FT                   VGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRMERHCSNALALAQWLERQP
FT                   QVARVYYPGLASHPQHELAKRQMRGFGGMISLDLRCDLAGARRFLENVRIFSLAESLGG
FT                   VESLIEHPAIMTHASIPAETRAELGIGDSLIRLSVGVEALEDLQADLAQALAKI"
FT   gene            complement(509855..511126)
FT                   /locus_tag="PSPA7_0501"
FT   CDS_pept        complement(509855..511126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0501"
FT                   /product="noncatalytic dihydroorotase-like protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01979; match to protein family HMM TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83451"
FT                   /db_xref="GOA:A6UYL1"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYL1"
FT                   /protein_id="ABR83451.1"
FT                   /translation="MTISIRGARVIDPASGLDQVGDLHIEAGRIVAIGAAPAGFSAQKT
FT                   LDGAGLVAAPGLVDLSVALREPGYGRKGNVESETRAAAAGGTTSLCCPPYTRPVLDTPA
FT                   VAELILDRAREAGNAKVYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRIL
FT                   RRALEYAATFDLTVIFTSQDPDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLV
FT                   EQSGVRAHFSQLTSARGIELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPP
FT                   LRTRADREALREAVKSGVVQAIASHHQPHEADAKNAPFAATEPGISGAELLLPLALTLV
FT                   QDGLLDLPTLLARLAHGPAQALRLPAGRLAVGQTADLVLFDPQGSTLAGESWYSKGQNS
FT                   PFIGHCLPGRVRYTLVDGHLTHEG"
FT   gene            complement(511123..512127)
FT                   /gene="pyrB"
FT                   /locus_tag="PSPA7_0502"
FT   CDS_pept        complement(511123..512127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="PSPA7_0502"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00185; match to protein family HMM PF02729; match to
FT                   protein family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82166"
FT                   /db_xref="GOA:A6UYL2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYL2"
FT                   /protein_id="ABR82166.1"
FT                   /translation="MPTDAKRPLQLNDQGQLRHFISLDGLPRELLTEILDTADSFLEVG
FT                   ARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLTD
FT                   TLRNLEAMAADMFVVRHSDSGAAHFIAEHVSPNVAVINGGDGRHAHPTQGMLDMLTIRR
FT                   HKGNFEQLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPRTLLPVGLEEQYGVRVF
FT                   TNADEGLKDVDVVIMLRLQRERMQGGLLPSEGEFFRLYGLTEKRLKLARPDAIVMHPGP
FT                   INRGVEIESAVADGAQSVILNQVTYGIAIRMAVLSMAMSGQNTQRQLEQEDAE"
FT   gene            complement(512151..512663)
FT                   /gene="pyrR"
FT                   /locus_tag="PSPA7_0503"
FT   CDS_pept        complement(512151..512663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="PSPA7_0503"
FT                   /product="transcriptional regulator PyrR"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85272"
FT                   /db_xref="GOA:A6UYL3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYL3"
FT                   /protein_id="ABR85272.1"
FT                   /translation="MSLPNPAELLPRMASDLRAHLAERGIERPRYVGIHTGGIWVAEAL
FT                   LKALGNEEPLGTLDVSFYRDDFTRNGLHPQVRPSALPFEIDGQHLVLVDDVLMSGRTIR
FT                   AALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGQTLSLGRDERVKLVGPAPLALER
FT                   KVLSPAS"
FT   gene            complement(512764..513198)
FT                   /locus_tag="PSPA7_0504"
FT   CDS_pept        complement(512764..513198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0504"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03652; match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85203"
FT                   /db_xref="GOA:A6UYL4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYL4"
FT                   /protein_id="ABR85203.1"
FT                   /translation="MAADKPLRLLLGFDYGTRQIGVAVGQAVTGQARELCVLKAQNGVP
FT                   DWNRVEALIKEWQPDAIVVGLPLNMDGSPSEMSERAEKFGRRLNGRFNLPVFTHDERLT
FT                   TYAAKGERLAQGQRDGYRERPVDALAAALLLEGWLAEHPN"
FT   gene            complement(513198..513767)
FT                   /locus_tag="PSPA7_0505"
FT   CDS_pept        complement(513198..513767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0505"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02622"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81019"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYL5"
FT                   /protein_id="ABR81019.1"
FT                   /translation="MKQSSPTYLKHHFLIAMPHMADPNFAQTVTYLVEHNDQGAMGLVI
FT                   NRPSGLNLAEVLEQLKPDVLPPARCQHIEIYNGGPVQTDRGFVLHPSGLAYQSTLELGE
FT                   LAMSTSQDVLFAIAAGTGPEKSLISLGYAGWEAGQLEAELSDNAWLTCPADPAILFDLP
FT                   AEERLSAAAACLGVNLSLLTAQAGHA"
FT   gene            complement(513816..514709)
FT                   /locus_tag="PSPA7_0506"
FT   CDS_pept        complement(513816..514709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0506"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83223"
FT                   /db_xref="GOA:A6UYL6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYL6"
FT                   /protein_id="ABR83223.1"
FT                   /translation="MNAAVLKSPSAVAGVRPADRLGFTLFIAAILHVALILGVGFSMPA
FT                   PSQISKTLEITLATFKSDKTPEKADYLAQMNQQGSGTLEHKAAPKTTEVAPFQDNQVKK
FT                   VAPPATPKQARSEEAPKAAVTTTRQRQQKAPSKTQAQKAEQVAKPAPQFDSSQLSAEIA
FT                   SLEADLAKEQQAYAKRPRIHRLSAASTMRDKGAWYKEDWRKKIERIGNLNYPDEARRQK
FT                   LYGSLRLLVSINRDGTIYEVQVLESSGEPILDQAAQRIVRLAAPYAPFSGDLADIDRLE
FT                   IIRTWRFERGDRLSSK"
FT   gene            complement(514845..515798)
FT                   /gene="gshB"
FT                   /locus_tag="PSPA7_0507"
FT   CDS_pept        complement(514845..515798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="PSPA7_0507"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02951; match to protein family HMM PF02955; match to
FT                   protein family HMM PF08443; match to protein family HMM
FT                   TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81024"
FT                   /db_xref="GOA:A6UYL7"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYL7"
FT                   /protein_id="ABR81024.1"
FT                   /translation="MSVRLGIVMDPIARINFKKDSSLAMLLAAQARGWSLFYMEQQDLY
FT                   QKAGVARGRMRPLKVFNDASRWFELEAESDQPLHELDVILMRKDPPFDNEFVYSTYLLE
FT                   QAERAGALVVNRPQSLRDCNEKFFATQFTQCTPPTMVSRRSDILREFAAEHRDIILKPL
FT                   DGMGGSSIFRHREGDPNLSVILETLTRHGSQQIMAQRYLPEIKDGDKRILMIDGEAVPY
FT                   CLARIPAQGETRGNLAAGGRGVAQPLSERDRWIAAEVGPHLRERGLLFVGLDVIGDYLT
FT                   EINVTSPTCIREIDQAFDTRIGDKLMDAIAAQLAAR"
FT   gene            516053..516460
FT                   /gene="pilG"
FT                   /locus_tag="PSPA7_0508"
FT   CDS_pept        516053..516460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilG"
FT                   /locus_tag="PSPA7_0508"
FT                   /product="twitching motility protein PilG"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85806"
FT                   /db_xref="GOA:A6UYL8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYL8"
FT                   /protein_id="ABR85806.1"
FT                   /translation="MEQQSDGLKVMVIDDSKTIRRTAETLLKKVGCDVITAIDGFDALA
FT                   KIADTHPNIIFVDIMMPRLDGYQTCALIKNNSAFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQYLTKPFSKEELLGAIKAHVPSFTPLDAAS"
FT   gene            516507..516872
FT                   /gene="pilH"
FT                   /locus_tag="PSPA7_0509"
FT   CDS_pept        516507..516872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="PSPA7_0509"
FT                   /product="twitching motility protein PilH"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84931"
FT                   /db_xref="GOA:A6UYL9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYL9"
FT                   /protein_id="ABR84931.1"
FT                   /translation="MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQEK
FT                   PDVVLMDIVMPGLNGFQATRQLTKDAETSAIPVIIVTTKDQETDKVWGKRQGARDYLTK
FT                   PVDEETLLKTINAVLAG"
FT   gene            516922..517458
FT                   /gene="pilI"
FT                   /locus_tag="PSPA7_0510"
FT   CDS_pept        516922..517458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="PSPA7_0510"
FT                   /product="twitching motility protein PilI"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85912"
FT                   /db_xref="GOA:A6UYM0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM0"
FT                   /protein_id="ABR85912.1"
FT                   /translation="MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGR
FT                   FFVAPMGEVGEVLHEPRYTQLPGVKTWVRGVANVRGRLLPIMDLCGFLGTELSPLRKQR
FT                   RVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFS
FT                   PHALAQHQGFLDVAI"
FT   gene            517544..519592
FT                   /gene="pilJ"
FT                   /locus_tag="PSPA7_0511"
FT   CDS_pept        517544..519592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilJ"
FT                   /locus_tag="PSPA7_0511"
FT                   /product="twitching motility protein PilJ"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80655"
FT                   /db_xref="GOA:A6UYM1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM1"
FT                   /protein_id="ABR80655.1"
FT                   /translation="MKKINAGNLFAGMRSSSVIAGLFIVLIVSIVLLFANFAYLNTQSN
FT                   HDKQYIGHAGELRVLSQRIAKNATEAAAGKGEAFKLLKDARNDFEKRWNILVNGDESTS
FT                   LPPSPEAVKPQMDVVQQDWDGLRKNADSILASEQTVLSLHQVASTLAETIPQLQVEYEE
FT                   VVDILLENGAPADQVAVAQRQSLLAERILGSVNKVLAGDENSVQAADSFGRDASLFGRV
FT                   LKGMQEGNAAMSISKVTNAEAVDRLNEIAELFEFVSGSVDEILETSPDLFQVREAANHI
FT                   FSVSQTLLDKASRLADGFENLAGGRSINLFAGYVLGALALASIILIGLVMVRETNRRLA
FT                   ETAEKNDRNQAAILRLLDEIADLADGDLTVAATVTEDFTGAIADSINYSIDQLRELVET
FT                   INQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMAVSIDQVSANASESSA
FT                   VAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIAD
FT                   QTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAV
FT                   ISMEQTTSEVVRGARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTM
FT                   NVIQEITSQTSAGTTATARSIGNLAKMASEMRNSVSGFKLPEGVEQA"
FT   gene            519653..520528
FT                   /gene="pilK"
FT                   /locus_tag="PSPA7_0512"
FT   CDS_pept        519653..520528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilK"
FT                   /locus_tag="PSPA7_0512"
FT                   /product="methyltransferase PilK"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01739; match to protein family HMM PF03705"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84147"
FT                   /db_xref="GOA:A6UYM2"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM2"
FT                   /protein_id="ABR84147.1"
FT                   /translation="MQANGVWSLQPLADMSAAEFRDWQVLLENRTGVVLNEQRRTFLQT
FT                   SLTARMRELGIGDYHSYYRQVTDGPRGAVEWAILLDRLTVQETRFFRHPPSFELLERYL
FT                   GERLGREGMPRPWALWSVGCSSGEEPYSMAMCAAQALRGWQRGDFFGVTGTDISLHALQ
FT                   RARAANYPARKLEQLPAEMVERYCERQADGSFSVKTILTGRVCCARLNVLDLAKAPWSG
FT                   MDVIFCQNLLIYFRRWRRREILNRLAERLAPGGLLVIGVGEVVDWSHPELEPVADERVL
FT                   AFTRKGYSGT"
FT   gene            520540..527916
FT                   /locus_tag="PSPA7_0513"
FT   CDS_pept        520540..527916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0513"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01584; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81091"
FT                   /db_xref="GOA:A6UYM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM3"
FT                   /protein_id="ABR81091.1"
FT                   /translation="MGDRHDYVALEWVKGEIAETLKQARQALEAFVENPQDPTRMRFCL
FT                   TYVHQGQGTLQMVEFYGAALLAEEMEQLVQALLDGRVPNQGEALEVLMQAILQLPVYLD
FT                   RIQTARRDLPMVVLPLLNDLRAARGEKLLSETSLFAPDLSRRQPQLDGEAIAQLRTDEL
FT                   GGLLRKLRQTQQMALVGLLRNQDVATSLGYLARVYARLEGLCREAPLGPLWSIASGLVE
FT                   GLANGSVVNSASVRTLLRQLDRELKRLVEQGADGLNQAAPDELIKNLLFYVAKAPSQSP
FT                   RIRALKEQYRLDEALPDHETVDAERARLAGPDRDAMRSVVGALCEELVRIKDSLDLFVR
FT                   SDRAHPAELDALLAPLKQIADTLAVLGFGQPRKVILDQLDVVHALAQGRREPSDATLMD
FT                   VAGALLYVEATLAGMAGPGDERNSEESRLPTTDVAQIHQLVIKEARNGLEQAKDAIIEF
FT                   IASQWNHEHLARVPELLTQVRGGLAMIPLERAASLLETCNRYIQEQLLARRAVPDWQSL
FT                   DTLADAITSVEYYLERLSEDHESQSDLILDVAEDSLANLGYTLKPHSSAPAEPSLSEPG
FT                   AVESPIAEPEMPEVIAEAAEAPLQPPADTASAEATREDAPQLASDDNRTLGEVAPDAGE
FT                   ASLDLALDLSLDGSSDVPPALPEVVEESGQSQSTPAPARSLEDFNLDEIDLSGLDLPAD
FT                   AAPASEPAPLADWSLPEQWGLGDDLAQPALVFDAPLESLEPLPAPEPFDGPAEQELALD
FT                   SFDPLPLDVALPEAEVEVSAWEGSSLEELDLSDLDLPEVQLPEVETPPAAEALASEAPA
FT                   LSLAEVMAAPVQPINPPAQNVPVSLLPPPADEEPVDEELREVFIEEAGEVLETIGQYLP
FT                   AWKADQDDREALTEVRRAFHTLKGSGRMVRALVIGELAWSIENLFNRVLDRSIAASEPV
FT                   RSVVDQVVALLPELVEEFAANAQRQRDDVDLLAATAHALARGEPLPEPPAPDDRGVPPE
FT                   VEAQQPVAPEDGAPALPLADAPQAAAEAESDVELLDPQLLEIFTNEAETHLEALVGFLA
FT                   DCARELPQPVTDALQRALHTLKGSAHMAGILPIAEIATPLEKLVKEYKSNLLAFDLREA
FT                   ELLHDAEQLFRIGLEQVGERRPLNPIPGSVALLERIEALHQERIASLEADRYSDAGERR
FT                   DPLLIEAFLAEGMDILLDAEDLLERWHEHPQERQELSALREELSALGRGAQHAELPQVE
FT                   ELCQALLTLYEAVEQGRLAVSPAFFEEARQAHEALIGMMDQVAAGLQVTPRPERVAALQ
FT                   ELLETPAAETVPFIDPESLDADDFPPEDQESTLPGAVFEETGVPVEETVSAAPAPAPGR
FT                   ELDEEMVSIFLEEAVDILESAGQALAQWQAEPGALSSLNALQRDLHTLKGGARMAQIAE
FT                   IGDLAHELESLYEGLVDRRYQHSPRLSELLQACHDRLAEQLEQLSAGRALADPEDLILA
FT                   IRQFRQGPLAEAAQGEAQSPAEEPVAPAGEEPAETPQPAAEAFEERDPELVEIFLEEGF
FT                   DILDSAAAALQRWIDDVDNTIELEALQRDLHTLKGGARMAEIAEIGDLAHELEFLYEGL
FT                   CGGRLRASPPLFGLLQRCHDELAEMLEAVRGQRELPDGQALIAEIRRLRSDPEEQLSVP
FT                   TSVSLKPLAGKGAAADESEILDIFLEEADDLLENLELALGRWDGGSGDAQPLDDLLRIL
FT                   HTLKGGARLAGQTELGNLAHDLEQHLTDAQQQGAPWPDSLLLDAQSGLEGLQRQVDLLR
FT                   ERLAEDDEAGERPEAAQAPVQADDTDRAVASALAELTRLAPAAGAIMAAEAAPPAAPAT
FT                   TLPFVRKAREAAQEAASRRAPQELVKVPAELLENLVNLAGETSIFRGRVEQQVSDVGFT
FT                   LGEMESTIERVRDQLRRLDTETQAQILSRHQADAERAGYEEFDPLEMDRYSQLQQLSRA
FT                   LFESASDLLDLKETLAAKNRDAETLLLQQARVNTELQEGLMRTRMVPFDRLVPRLRRIV
FT                   RQVAGELGKQVEFVVGNADGEMDRTVLERIVAPLEHMLRNAVDHGIESGETRRAAGKPE
FT                   HGTIRLNIGREGGDILLTLSDDGAGIRLDAVRRKAIERGLMSADSDLSDHEVLQFVLES
FT                   GFSTAEKVTQISGRGVGLDVANSEVKQLGGSVSIQTEPGQGTRFNVRLPFTVSVNRALM
FT                   VLSGEDLYAVPLNTIEGIVRVSPYELEALYEQRGEAGLDTPSFEYAGQSYELKYLGELL
FT                   NNGQEPKLVGQSLPLPVILVRSSEHAVAVQVDSLAGSREIVVKSLGPQFAGVAGISGAT
FT                   LLGDGRVVVILDLLATIRSRHALLGQESRRERLALRQETAASESEQQRPPLVMVVDDSV
FT                   TVRKVTTRLLERNGMNVLTAKDGVDAIAQLQEHRPDILLLDIEMPRMDGFEVATLVRHD
FT                   ERLGNLPIIMITSRTGEKHRERALGIGVNQYLGKPYQETELLEAIQSLVGQHD"
FT   gene            527909..528940
FT                   /locus_tag="PSPA7_0514"
FT   CDS_pept        527909..528940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0514"
FT                   /product="putative methylesterase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82392"
FT                   /db_xref="GOA:A6UYM4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM4"
FT                   /protein_id="ABR82392.1"
FT                   /translation="MTERATPRVAVIADTSLQRHVLQQALLGHGYEVVLNADPARVDDA
FT                   ALECAPDLWLVDLTQQDDSPLLDSLLEQDRAPVLFGEGHAPERHTEHYPRWERRLIAKL
FT                   KRLIGDPSDGVGDSLGALLDEERPARLEIPGDLAAMPLQAGEPAREVWLLAASLGGPAA
FT                   VKAFLDALPGGLPIAFLYAQHIDASFEQSLPQAVGRHSQWHVKNVRDGEALRCGEVQVV
FT                   PVLHELGFHHDGRLKCSQRPWPEPYTPSIDQMMLNLAQQFGPDCGVIVFSGMGSDGSAA
FT                   AAYVRRQGGEVWTQRADSCVCSSMPDSLREAGYSSFNASPRELAEALVKHLAARCAPTG
FT                   VET"
FT   gene            528937..529443
FT                   /locus_tag="PSPA7_0515"
FT   CDS_pept        528937..529443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0515"
FT                   /product="putative chemotaxis protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86499"
FT                   /db_xref="GOA:A6UYM5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM5"
FT                   /protein_id="ABR86499.1"
FT                   /translation="MNQAVIEQDGMSRKPLAAPTPDSLTGLLLPLSDRTLLLPNVAVAE
FT                   LIAYRNPQVAAGLPQWYLGQVAWRDLRLPLLSFETASSGERQPVLGSSARVVVINALGG
FT                   RPHVKFLALLVQGIPRSVRLDANLAATAAPLAALELAAVDIGGETARIPDLAGLEEKLA
FT                   DAGLI"
FT   gene            529451..530245
FT                   /locus_tag="PSPA7_0516"
FT   CDS_pept        529451..530245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0516"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00165; match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83540"
FT                   /db_xref="GOA:A6UYM6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM6"
FT                   /protein_id="ABR83540.1"
FT                   /translation="MAGLQHARIGASLEVACASLAGHRFEKHSHDEFVISANLCGLEEI
FT                   WLDGRTFQADSGDLTLYNPGQIQGGGVRDGQPWRFASLYLPAAELANSLDLSSVEFDRP
FT                   LLRSPALGRELAASIEALLASDRFARERGEERLLEFLGRLLAASGTRLPRRADPGRPAV
FT                   VRLQALLAEHLAEPPDLDGMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRALGLL
FT                   RRGLAVGEVAHALGFADQSHLTRYFSSAYGISPGRYQRAVRG"
FT   gene            530322..530933
FT                   /locus_tag="PSPA7_0517"
FT   CDS_pept        530322..530933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0517"
FT                   /product="chemotactic transduction protein ChpE"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82127"
FT                   /db_xref="GOA:A6UYM7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM7"
FT                   /protein_id="ABR82127.1"
FT                   /translation="MLAIFLAALLFGFAFNISPGAVFSETLRRGLTGGFRPALLVQLGS
FT                   LIGDAVWALLGLTGLALLLGYEQVRMPLTLVCAVYLAWLGVQGLRDAWNPPLAAENVGE
FT                   QGRNAFGAGAAISLSNPKNLVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCF
FT                   CCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL"
FT   gene            complement(530938..532311)
FT                   /locus_tag="PSPA7_0518"
FT   CDS_pept        complement(530938..532311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0518"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85788"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM8"
FT                   /protein_id="ABR85788.1"
FT                   /translation="MDTPVTFDWKIRLPDVLGVLRRDYAGRFPQLASAALETLLERLRD
FT                   DLPEDFLPALGQELESLGLALVERLDEDDSLNLYVIGAPHSQRLLDALAAQGHNARTLR
FT                   QEDAAEGAPATLPAATPAGLAAASAYICLERTEHLAPGLATGRLPGEDSSDLLDLRQWP
FT                   RLRRLPDGAEETRGALLCRASSADGLHAWVRMTGSGSPYAWLQRSRDLASLTPELPPLP
FT                   LPPAQSLRQRRTPELAIGLAGEDLLLVDRGLVFLYPGFARGNGEPRLLFEVPQARRSIE
FT                   NPPAVFTTPDERVCLLSRGQFFEWREARIQPLPFPVGKDLPADPAQPTSVAPGSIVWLE
FT                   RETLCEGRLDSGEIRSHSLDGLAEGPYLKLQALDGGWLLLAPWLEPHRSRDLAQLWHPE
FT                   SGRALRIRYGELDLEGGLQHWAKLPDGRIVVGDHARHVDLGTFESLRQRLLRRRPALA"
FT   gene            complement(532388..533110)
FT                   /locus_tag="PSPA7_0519"
FT   CDS_pept        complement(532388..533110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0519"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04452; match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81684"
FT                   /db_xref="GOA:A6UYM9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYM9"
FT                   /protein_id="ABR81684.1"
FT                   /translation="MRLSRFFVDQPLALGQHDLPEAQAHYIGRVLRHATGDAVQLFDGS
FT                   GREYLGELIEVGKKNVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVA
FT                   EITPIVSERCEVRLKDERADKRLQHWRQVAISACEQCGRSSLPRIHPPLALEDWLRQRD
FT                   DELRLVLHPVAAPLASHARPASLAFLVGPEGGLGDAEVEQAQAAGFHSARLGPRVLRTE
FT                   TAPVVALAVAQQLWGDFA"
FT   gene            complement(533203..534606)
FT                   /gene="bioA"
FT                   /locus_tag="PSPA7_0520"
FT   CDS_pept        complement(533203..534606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="PSPA7_0520"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   transaminase"
FT                   /EC_number="2.6.1.62"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00202; match to protein family HMM TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85848"
FT                   /db_xref="GOA:A6UYN0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN0"
FT                   /protein_id="ABR85848.1"
FT                   /translation="MGLNADWMQRDLNVLWHPCTQMKDHERLPVIPIRRGEGVWLEDFE
FT                   GKRYIDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHQPVIELSERLVKITP
FT                   PGLDRVFYADSGSAGIEVALKMSYHFWLNSGRPRKKRFVTLTNSYHGETIAAMSVGDVA
FT                   LFTETYKSLLLDTIKVPSPDCFLRPDGMCWEEHSRNMFAHMERTLAEGHDEIAAVIVEP
FT                   LIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFACEQAGIAPDFLC
FT                   LSKALTGGYLPMSAVLTTETVYRGFYDDYQTLRAFLHSHTYTGNPLACAAALATLDIFE
FT                   EDKVIEANRALSTRMARATAHLADHPHVAEVRQTGMVLAIEMVQDKASRTPYPWQERRG
FT                   LKVFQHGLERGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRDAVSVAVSD
FT                   FHPDHRDPG"
FT   gene            534781..536271
FT                   /locus_tag="PSPA7_0521"
FT   CDS_pept        534781..536271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0521"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81782"
FT                   /db_xref="GOA:A6UYN1"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN1"
FT                   /protein_id="ABR81782.1"
FT                   /translation="MSLRWLRAAAFLVLGVFSAVALGKDKQPTAIVVGAGLAGLSAAYE
FT                   LQKDGWQVTVLEARPQVGGRSGLATSEWVGNQKVQPNLNGYLDTFKLKSVPAPDFVRTP
FT                   SYLIDGLYYSSSDLALKQPNVAADLKRFEQTLDDLSASISDPLNPASNNTLFALDQMNA
FT                   ARWLDKLNLSPTARLLVNQRIRSRYDEPSRLSLLYLAQQGRAYRGVDDRDLRAARLPGG
FT                   SQVLAEAFVKQLKTIKTKAKVSSIVQARDGVTVKAGSQTYKADYVVLAVPLKALAQIQM
FT                   TPALSGTQMSALKGTNYGWRDQILLKFKRPVWDDKSRLSGEIFSDQGLGMIWVEPALKG
FT                   GANVLINLSGDNARVLQAFGDRQMVDQVLIRMNKFYPKMRGAFAGYEIRRYSADPGTGG
FT                   SYLAYGPGQVTRFWRIWEQPLARVAFAGEHTDALYPGTIEGALRSGKRAASQVRDLYAG
FT                   KTPVIEGAPMVAKAEKVAAPKADGEKKNPFAWFTRLFD"
FT   gene            536453..537022
FT                   /locus_tag="PSPA7_0522"
FT   CDS_pept        536453..537022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0522"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01292"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85630"
FT                   /db_xref="GOA:A6UYN2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN2"
FT                   /protein_id="ABR85630.1"
FT                   /translation="MQWRNTSSRYGVFSLFLHWGSALVVFGLFGLGLWMRELSYYDPWY
FT                   HPAPALHKSIGILLAIALLVRIVWRFVSPPPPAPANHGPATRVASKLGHLALYALLVAV
FT                   IVAGYLISTADGEPISVFGWFSVPATLSGLPDQADVAGEIHLYLAWALVVFAVLHAFAA
FT                   LKHHFVDRDPTLKRMLGRSSNEQQPR"
FT   gene            537034..537609
FT                   /locus_tag="PSPA7_0523"
FT   CDS_pept        537034..537609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0523"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83198"
FT                   /db_xref="GOA:A6UYN3"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYN3"
FT                   /protein_id="ABR83198.1"
FT                   /translation="MLKKTLAALALGSALFTAGQAMAADYKIDKEGQHAFIEFRIKHLG
FT                   YSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVGKNP
FT                   TATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLLGQGNDPWGGYRAGFEGSATLK
FT                   LKDFGIKMDLGPASQEVELLLSVEGIRQ"
FT   gene            complement(537679..538122)
FT                   /gene="mexR"
FT                   /locus_tag="PSPA7_0524"
FT   CDS_pept        complement(537679..538122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexR"
FT                   /locus_tag="PSPA7_0524"
FT                   /product="multidrug resistance operon repressor MexR"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82147"
FT                   /db_xref="GOA:A6UYN4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN4"
FT                   /protein_id="ABR82147.1"
FT                   /translation="MNYPVNPDLMPALMAVFQHVRTRIQSELDRQRLDLTPPDVHVLKL
FT                   IDEQRGLNLQDLGRQMCRDKALITRKIRELEGRSLVRRERNPSDQRSFQLFLTDEGLAI
FT                   HRHAEAIMSCVHDELFAPLTPEEQATLVHLLDQCLAAQPLEDI"
FT   gene            538397..539548
FT                   /gene="mexA"
FT                   /locus_tag="PSPA7_0525"
FT   CDS_pept        538397..539548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexA"
FT                   /locus_tag="PSPA7_0525"
FT                   /product="RND multidrug efflux membrane fusion protein MexA
FT                   precursor"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86572"
FT                   /db_xref="GOA:A6UYN5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN5"
FT                   /protein_id="ABR86572.2"
FT                   /translation="MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEA
FT                   QTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQ
FT                   SAQANLASTQEQAQRFKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSP
FT                   ISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERA
FT                   GDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQ
FT                   LQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNA
FT                   GDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG"
FT   gene            539564..542704
FT                   /gene="mexB"
FT                   /locus_tag="PSPA7_0526"
FT   CDS_pept        539564..542704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexB"
FT                   /locus_tag="PSPA7_0526"
FT                   /product="RND multidrug efflux transporter MexB"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00873; match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86780"
FT                   /db_xref="GOA:A6UYN6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN6"
FT                   /protein_id="ABR86780.1"
FT                   /translation="MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYPAIAPPAIAV
FT                   QVSYPGASAETVQDTVVQVIEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDIAQ
FT                   VQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQ
FT                   DPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSAAIQAQNVQISSGQLGGL
FT                   PAVKGQQLNATIIGKTRLQTAEQFEKILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
FT                   NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEV
FT                   VKTLGEAILLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAF
FT                   FGGSTGVIYRQFSITIVSAMALSVIVALILTPALCATMLKPIEKGDHGEHKGGFFGWFN
FT                   RMFLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQV
FT                   QTPPGSTAERTQVVVDSMREYLLEKESSSVSSVFTVTGFNFAGRGQSSGMAFIMLKPWE
FT                   ERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPSVLELGNATGFDLFLQDQAGVGHEV
FT                   LLQARNKFLMLASQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTISIAW
FT                   GSSYVNDFIDRGRVKRVYLQGRPDARMNPDDLSKWYVRNDKGEMVPFNAFATGKWEYGS
FT                   PKLERYNGVPAMEILGEPAPGLSSGDAMAAVEEIVKQLPKGVGYSWTGLSYEERLSGSQ
FT                   APALYALSLLVVFLCLAALYESWSIPFSVMLVVPLGVIGALLATSMRGLSNDVFFQVGL
FT                   LTTIGLSAKNAILIVEFAKELHEQGKGIVEAAIEACRMRLRPIVMTSLAFILGVVPLAI
FT                   STGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYVAVSTLFKDEASKQQAEAEKGQ"
FT   gene            542706..544163
FT                   /gene="oprM"
FT                   /locus_tag="PSPA7_0527"
FT   CDS_pept        542706..544163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="PSPA7_0527"
FT                   /product="outer membrane protein OprM precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02321; match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82805"
FT                   /db_xref="GOA:A6UYN7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN7"
FT                   /protein_id="ABR82805.1"
FT                   /translation="MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNT
FT                   GAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPR
FT                   IGVDGSGTRQRLPGDLSTTGNPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLAT
FT                   EQAQRSAQTTLVASVATAYLTLKADQAQLQLTRDTLGTYQKSFDLTQRSYDVGVASALD
FT                   LRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLDQTLLTEVPAGL
FT                   PSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGS
FT                   WLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQ
FT                   LQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVN
FT                   LYKALGGGWNQQTVTQQQTAKKEDPQA"
FT   gene            complement(544256..546163)
FT                   /locus_tag="PSPA7_0528"
FT   CDS_pept        complement(544256..546163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0528"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00270; match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85367"
FT                   /db_xref="GOA:A6UYN8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN8"
FT                   /protein_id="ABR85367.1"
FT                   /translation="MSFSSLGLSEALARAVEAAGYSQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPVLERLFPAGHPDREHRHGPRQARVLVLTPTRELAAQVHDSFKVYAR
FT                   DLPLNSTCIFGGVGMNPQIQALAKGVDVLVACPGRLLDLAGQNKVDLSHVEILVLDEAD
FT                   RMLDMGFIHDVKKVLAKLPPKRQNLLFSATFSKDIVDLANKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLPAPQKRALLAHLVTVGAWEQVLVFTRTKHGANRLAEYLTKHGLPAAAIHG
FT                   NKSQNARTKALADFKANDVRILVATDIAARGLDIDQLPHVVNYELPNVEEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKAIEKMTRQRIPDGDPQGFDPEAVLPEVAQPEPREAPQ
FT                   KQPRRDKERRSRERKPKEAQAPAENAAVAGQDGAEKPAGKRRRRGGKNKENREAGQAQQ
FT                   PRQSREARPAKPNRPPEIDGNRDPEEFLDDDFDNFGNRADYVSPYQGQENKGRGRRGGQ
FT                   QKSQGGAGQQGRGQGQGRGKSQGSAQGGARGQGAGQGKAKKPRAGKPRGQGRDNPSRMS
FT                   DAPLREPSEYGVGKQPSRQPVVINKRDLVRMDRFPTAEQLDELEPRRKGERPALLTRNR
FT                   "
FT   gene            complement(546414..547484)
FT                   /locus_tag="PSPA7_0529"
FT   CDS_pept        complement(546414..547484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0529"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80836"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYN9"
FT                   /protein_id="ABR80836.1"
FT                   /translation="MANSRKHLIYLVYGRQTYHQEALFSIASAFAHLRDEPAHGLTVRV
FT                   YTDDPSPYAGLPVQVRPLTAEELVAWCQPHGYHFRAKHVALREALEDADQALLIDTDTF
FT                   FHSSPLRLFERIQPGRLLCNAIGARYGEHRNFPLYRDLSAYLFERGWADDEMHQLNSGV
FT                   IGLPREEAKILDRSLELMDELYPIANGAYTLEEFVLAVAAHKRLELVGCTDLIHHYWSR
FT                   KQLFRAKIQAWLCKHGSSLLSAAALDDTLKVTDRLPRPPRAKRLLYKLGTLPLPAPMRQ
FT                   FSIELLYGCHEYSNEFDRACGPVWWEKAATNAIERYPREPIAEQIEDWLNHSLLRNLLG
FT                   SRANEIRQHLRQRDLL"
FT   gene            complement(547555..548403)
FT                   /gene="metF"
FT                   /locus_tag="PSPA7_0530"
FT   CDS_pept        complement(547555..548403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="PSPA7_0530"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02219; match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85402"
FT                   /db_xref="GOA:A6UYP0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP0"
FT                   /protein_id="ABR85402.1"
FT                   /translation="MSQSERRFSFEFFPAKTEAGHEKLLATARNLAGYKPDFFSCTYGA
FT                   GGSTRDRTLHTVLQLDGEVKVPTAPHLSCVGDSKAELRELLGQYRAAGIRRIVALRGDL
FT                   PSGMGMASGELRYANELVEFIRAETGDHFHIEVAAYPEVHPQARSFEDDLANFVRKVKA
FT                   GASSAITQYFFNADAYFYFVERVAKLGVDIPVVPGIMPITNYSKLARFSDACGAELPRW
FT                   IRKQLEAYGDDSRSIQAFGEQVISEMCERLLQGGAPGLHFYTLNQADPSLAIWKNLQLP
FT                   R"
FT   gene            complement(548468..549007)
FT                   /locus_tag="PSPA7_0531"
FT   CDS_pept        complement(548468..549007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0531"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86663"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP1"
FT                   /protein_id="ABR86663.1"
FT                   /translation="MSTHLADRYNQAWLFAARAHRNQTLSGSPLPYLVHLGMVANELLA
FT                   ADRQGAVERLAETLQIAVLHDTLEDTATSPEELRQQFGEFVHDGVLALSKRVGDGPKRS
FT                   PDDYFQALAEGPAQYALVKLCDRITNLQPPPQTWNPDKIADYHQESRLILARLGHAHAA
FT                   TARRLREKIEHYRQYY"
FT   gene            complement(549062..550471)
FT                   /gene="ahcY"
FT                   /locus_tag="PSPA7_0532"
FT   CDS_pept        complement(549062..550471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="PSPA7_0532"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80993"
FT                   /db_xref="GOA:A6UYP2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP2"
FT                   /protein_id="ABR80993.2"
FT                   /translation="MSAVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKY
FT                   AGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIP
FT                   VFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHKKYPQMLERIHGITE
FT                   ETTTGVHRLLDMLKNGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSSQSLRQEGMIVKVSEVDPICAMQACMDGFEVVSPYKNGINDGTEA
FT                   SIDAALLGKIDLIVTTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGKDGFDAHNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   HLFEQKYADLPAAEKAKRLTVEVLPKKLDEEVALEMVKGFGGVVTQLTPKQAEYIGVSV
FT                   EGPFKPDAYRY"
FT   gene            550778..551194
FT                   /locus_tag="PSPA7_0534"
FT   CDS_pept        550778..551194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0534"
FT                   /product="hypothetical protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80867"
FT                   /db_xref="GOA:A6UYP4"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP4"
FT                   /protein_id="ABR80867.1"
FT                   /translation="MRIAPISRSPLLQWLSFALCACVLVNALACGVLHLQALGVGSDKG
FT                   QKASVGLFCVAGASQWLSLDPDDGSAGDPVPVNPQLPVSCPMCSALVLFVALGVIWSWR
FT                   LQRQRQARFRPPATREPVPPRYVWPPANPRASPA"
FT   gene            551320..553512
FT                   /locus_tag="PSPA7_0535"
FT   CDS_pept        551320..553512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0535"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86314"
FT                   /db_xref="GOA:A6UYP5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP5"
FT                   /protein_id="ABR86314.1"
FT                   /translation="MKKHSTARRVLALGLNLTLAGVPALLWADEEPTELPALTVSAGAA
FT                   GETPPALDLDDSAGGGSRLGLSLRETPGSVSVANRASFERRGLRSTQDIANSLPGVNAS
FT                   APPGFGGFVTYRGFSSNQVNQLFNGIPVQYSSAMRPLDDWIVDRVELVGGPSSFLNGAG
FT                   AVGGSLDYISKLADRYGDFMEGRVRYGSYDDSEVAFGFNQALGIGPEPKHFVRLDVSRS
FT                   GGNGYVDRNSRESWNVAFSLLSDLTPDLSHTLALEYQDEQEDSPYWGTPVLNPYAGELK
FT                   IDKSRRRENYNVADGRYEQRVRWLRSILEYRVSDSTRWRNTFYHYDAERDYRNLETYRY
FT                   NADNSGVVRSNAFLQRHDQQLDGNRFELQHSQPLFGLASDWALGFDYSINKQTRFPSTA
FT                   SGPFGTVDPASFEPGHFYDLPGMRPGHRKDRSNEVRTSALFAENRLGLTDELSLVTGLR
FT                   YDHLDLDVRNHRVPDKDNPAHFERRWDVLTGRAGLVYQFTPHANVYLQYSTAADPPGGV
FT                   LTSASFAQVRDYDLSTGDQWELGSKFDFLDGRGSATLAAYRIVRRDFSVADPNDPNLSV
FT                   PVGQQTSRGIEAAASLRITPKLLVEGNFAWVDAQYDEFTENVGGVAVSRKGKTPPNVPE
FT                   RVGNLWLTYDFDPAWQGGVDARYVSSVYANNANTWHVPSYTVYGTFLSYRLDERTRITG
FT                   RVRNLTDEVYARFVQSTPLYYVGDPRTFELSVQTRF"
FT   gene            553523..555001
FT                   /locus_tag="PSPA7_0536"
FT   CDS_pept        553523..555001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0536"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85715"
FT                   /db_xref="GOA:A6UYP6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP6"
FT                   /protein_id="ABR85715.1"
FT                   /translation="MKRYLYLWHRWLGIGCCLLMVLWFVSGMVMLYVGYPKLTPLERLA
FT                   HLPGLEGCEACMPLRTALADGAGKAPRSIRLASVGGLPTYLLDDADGRTRALAARNGRP
FT                   LAVDADRVLASARAFSGEVPMQLQGRIEEDAWTHTRNLDPHRPLWRVQTADAEGRLLYL
FT                   SSQTGEVVRDASRRERAWNWLGAWLHWLYPLRGGWFDGQWANLVIGLSLLATLATVLGI
FT                   LVGLLRWRFRKPYRSGSRSPYAGGFQRWHHLAGLLFGALVLSWIFSGLMSMNPWNLFGR
FT                   GTPLDLAAYQGASWDQALPAGLEADAALRRFRGAGLRVRELEWRMLGGAPYVVGRSGSG
FT                   ASLLLTADGETLRELPEERLLASARALLPGVPMQAERLDRYDFHYYPREEHSMMGYLER
FT                   RLPVWRLRFDDSRHTWVHLDPYSGAVVGVLDDARRGSRWLFSLLHSWDWLPLLTRRPLW
FT                   DLWMLGGSLGGLVVCASGCWIGWRRLRGRRPKRR"
FT   gene            555085..555705
FT                   /locus_tag="PSPA7_0537"
FT   CDS_pept        555085..555705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0537"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00440; match to protein family HMM PF08362"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85740"
FT                   /db_xref="GOA:A6UYP7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP7"
FT                   /protein_id="ABR85740.1"
FT                   /translation="MGTHKIEIRRRNVEKILLAAEKVFAEKGYAGTSMGNIAEEAELPR
FT                   SNLHYYFSTKDELYRDVLLGLLEVWKQDALCFEMFDDPRVVLTSYIRAKMNHSRTRPHG
FT                   SKVWANEIMHGAPLLGATLDDSLYEWAKMKEAKIRQWVEEKRILPIEPSSLLYLIWAST
FT                   QHYADFGYQVEVLNGHQPLSDMQFERAVQTVTSVVLRGIGLEP"
FT   gene            complement(555743..557014)
FT                   /gene="codA"
FT                   /locus_tag="PSPA7_0538"
FT   CDS_pept        complement(555743..557014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="PSPA7_0538"
FT                   /product="cytosine deaminase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01979; match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84441"
FT                   /db_xref="GOA:A6UYP8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP8"
FT                   /protein_id="ABR84441.1"
FT                   /translation="MLIDNLRLRGREGLWQLRVADGRIAALVPMEQAADDAGERLDGAG
FT                   GLAVPPFIEPHIHLDTTQTAGQPEWNRSGTLFEGIERWAQRKALLSHEDVKQRAWQTLK
FT                   WQIANGVQHVRSHVDVSDPTLTALKAMLEVRGEVAPWVDLQIVAFPQEGILSYPNGLEL
FT                   LEESLRLGADVVGAIPHFEFTRELGVESLHKAIDLARRYDLPVDVHCDEIDDEQSRFLE
FT                   TLAMLAHRDGLGARVTASHTTAMHSYNGAYTSRLFRLLKLSGINFVANPLVNIHLQGRF
FT                   DDYPKRRGITRVKELLGAGINTCFGHDDVFDPWYPLGTANMLQVLHMGLHVTQMMGYDE
FT                   IDGGLDLITRNSARTLGLREYGIEVGHPANLLVLPARDGFDAVRRQVPVRYSIRGGRLL
FT                   AETLPAQTTVFLEQAEAVDFTRAS"
FT   gene            complement(557004..558254)
FT                   /gene="codB"
FT                   /locus_tag="PSPA7_0539"
FT   CDS_pept        complement(557004..558254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="PSPA7_0539"
FT                   /product="cytosine permease"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81949"
FT                   /db_xref="GOA:A6UYP9"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYP9"
FT                   /protein_id="ABR81949.1"
FT                   /translation="MSADSNYSQQPVPLAARKSALALSVVMLGLTFFSASMWTGGTLGT
FT                   GLSYDDFFLAVLLGNLMLGLYTAILGFIGARTGLSTHLLAHYSFGSKGSWLPSALLGGT
FT                   QVGWFGVGVAMFAIPVAKASGLDVNLLILVSGALMTLTVFFGIAGLTLLSAIAVPAIVV
FT                   LGSYSVWLAVRDAGGLAALQQVTPSAPLSLSAAIALVVGSFVSAGTLTADFVRFGRSAR
FT                   TAVVVCLVAFFLGNSLMFIFGAAGAAAVGKSDISDVMIAQGLLIPAILVLGLNIWTTND
FT                   NALYASGLGFANITGLSSRFLAMLNGALGTLAALWLYNHFVGWLTFLSAAIPPIGGVII
FT                   ADYLSRRRRYRQHPCADIQAINWAAILAVACGTAAGHWLPGIVPVNAVLGAAIAYLLLN
FT                   PLLSRSPNKPEEVLHAD"
FT   gene            complement(558436..559710)
FT                   /locus_tag="PSPA7_0540"
FT   CDS_pept        complement(558436..559710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0540"
FT                   /product="putative oxidoreductase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00037; match to protein family HMM PF01180; match to
FT                   protein family HMM TIGR01037"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83605"
FT                   /db_xref="GOA:A6UYQ1"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYQ1"
FT                   /protein_id="ABR83605.1"
FT                   /translation="MADLSIEFAGIKSPNPFWLASAPPTDKAYNVVRAYEAGWGGVVWK
FT                   TLGEDPAAVNVSSRYSAHFGPNRQVQGINNIELITDRSLEINLREIAQVKKDWPDRALI
FT                   VSLMVPCVEESWKYILPLVEATGADGIELNFGCPHGMPERGMGAAVGQVPEYVEMVTRW
FT                   CKTHCSLPVIVKLTPNITDIRQSARAAQRGGADAVSLINTINSITSVDLERMVALPVVG
FT                   TQSTHGGYCGSAVKPIALNMVAEIARDPQTRGLPICGIGGIGSWRDAAEFVALGCGAVQ
FT                   VCTAAMLHGFRIVEDMQDGLARWMDSQGYQRLADFSGAAVGNTTDWKYLDINYQVIARI
FT                   DQDACIGCGRCHIACEDTSHQAIASLPRADGTHRYEVIDAECVGCNLCQITCPVENCIE
FT                   MVPQDTGKPYLNWTQDPRNPYREAS"
FT   gene            complement(559710..561077)
FT                   /locus_tag="PSPA7_0542"
FT   CDS_pept        complement(559710..561077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0542"
FT                   /product="putative oxidoreductase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00070; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84715"
FT                   /db_xref="GOA:A6UYQ2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYQ2"
FT                   /protein_id="ABR84715.1"
FT                   /translation="MIDSLNHLPRPDAGADTLAERFADLAPPLNARQADLESARCLYCY
FT                   DAPCVNACPTGIDIPGFIRSIAQENVQGAAQKILSANILGGSCARVCPTEILCQQACVR
FT                   NNAQECAPVLIGQLQRYALDHAGFSEHPFKRSPATGKRIAVVGAGPAGLSCAHRLAMHG
FT                   HEVVLFEARAKAGGLNEYGIARYKLVDDFARREVEFLLQIGGIELRHGQRLGDNLALGA
FT                   LHEEYDAVFLGIGLAASKRLGLEDEDAPGLLAATDYIRELRQSDDLLDLPVADRCIVIG
FT                   AGNTAIDMAVQMSRLGARDVNLVYRRGFEEMGATGHEQEIAKASQVRLLTWARPERVLL
FT                   DEHGRVRGMRFARTRLENGRLGDTGDHFELAADAIFKAIGQAFDDASLGDPLAAQLRRD
FT                   GGRIQVDGQMRTSIPGIYAGGDCVALGEDLTVQAVQHGKLAAEAIHAQLMLNVEAA"
FT   gene            complement(561172..562611)
FT                   /gene="hydA"
FT                   /locus_tag="PSPA7_0543"
FT   CDS_pept        complement(561172..562611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydA"
FT                   /locus_tag="PSPA7_0543"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80679"
FT                   /db_xref="GOA:A6UYQ3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYQ3"
FT                   /protein_id="ABR80679.2"
FT                   /translation="MSLLIRGATVVTHEESYRADVLCANGLIQAIGENLDPPSGCDVLD
FT                   GGGQYLMPGGIDPHTHMQLPFMGTVASEDFFSGTAAGLAGGTTSIIDFVIPNPQQSLLE
FT                   AFHTWRGWAQKSAADYGFHVAITWWSDEVAREMGELVAQHGVNSFKHFMAYKNAIMAAD
FT                   DTLVASFERCLELGAVPTVHAENGELVFHLQRKLLAQGLTGPEAHPLSRPPQVEGEAAS
FT                   RAIRIAETLGTPLYLVHISSREALDEIAYARAKGQPVYGEVLAGHLLLDDSVYRHPDWA
FT                   TAAGYVMSPPFRPVEHQEALWRGLQSGNLHTTATDHCCFCAEQKAMGRDDFSKIPNGTA
FT                   GIEDRLALLWDAGVNSGRLSMHEFVALTSTNTAKIFNLFPRKGAIRVGADADLVLWDPQ
FT                   GSRTLSAATHHQRVDFNIFEGRTVRGVPSHTISQGKLLWAAGDLRAEPGAGRYVERPAY
FT                   PSVYEVLGRRAERQRPVAVER"
FT   gene            563227..564717
FT                   /locus_tag="PSPA7_0546"
FT   CDS_pept        563227..564717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0546"
FT                   /product="putative transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83465"
FT                   /db_xref="GOA:A6UYQ6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYQ6"
FT                   /protein_id="ABR83465.1"
FT                   /translation="MQQSRSEVTERDGLVELSAGSDVLDSPRYNHDIAPTRVEQRTWNK
FT                   WHITALWIGMSICVPTYTLGGVLTAYFGLSVGEALLAILLANLVVLIPLTLNAFAGTRY
FT                   GIPFPVLLRASFGIIGSNVPCLIRAVVACGWLGIQTLFGGLAIHLFLGSLFPAWKALGG
FT                   TGEVIGFLLFWGLNLWVVLRGAESIKWLETLSAPLLVLVGLGLLVWALPHISVSELLAQ
FT                   PPKRPEGASVTGYFMAGLTAMVGFWATLSLNIPDFSRYARSQKDQILGQIFGLPLTMFL
FT                   FAALGVVMTAASASLVGETVSDPVSLIGHIPSPGWVAVAMALIIVATLSTNTAANIVSP
FT                   TNDFQNIAPKLIGRTRAVWLTGFIGLALMAHELLKKLGWIVSDLSLESVYSNWLLGYSS
FT                   LLGPIAGIMVVDYFLVRRQRLDLAGLYRDDVYPAWNWPGFAAFAVPVALTVMAIGNRQF
FT                   HWFYDYGWFTGSLLGGALYYGLCGRRARSPAALAKPLP"
FT   gene            564776..566059
FT                   /locus_tag="PSPA7_0547"
FT   CDS_pept        564776..566059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0547"
FT                   /product="N-carbamoyl-beta-alanine amidohydrolase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01546; match to protein family HMM PF07687; match to
FT                   protein family HMM TIGR01879"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84786"
FT                   /db_xref="GOA:A6UYQ7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYQ7"
FT                   /protein_id="ABR84786.1"
FT                   /translation="MSTARNVLQSTQRHIDGQRLWQSLMDLARLGATAKGGVCRLALTD
FT                   LDRQARDLFVQWCEAAGCTVSVDRVGNIFARRPGRNPELPPVMTGSHIDTQPTGGKFDG
FT                   CFGVMAGLEVIRTLNDLGVETEAPLEVVVWTNEEGSRFAPCMMGSGVFAGKFTLEETLA
FT                   KRDADGVSVGEALDAIGYAGARDCLGHPVGAYFEAHIEQGPILEDEEKTIGVVLGALGQ
FT                   KWFDLSLRGVEAHAGPTPMHLRKDALVGAAAVVEAVNRAALGHQPHACGTVGCLHAYPG
FT                   SRNVIPGEVKMTLDFRHLQPERLDAMIAEVRQVIAATCEKHGLQYELVPTADFPPLYFD
FT                   QGCVGAVREAAQALGMPHMDIVSGAGHDAIFLAELGPAGMIFVPCENGISHNEIENASL
FT                   DDLAAGCAVLLRAMLKASEAIAGGRLAA"
FT   gene            complement(566259..567482)
FT                   /locus_tag="PSPA7_0548"
FT   CDS_pept        complement(566259..567482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0548"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85508"
FT                   /db_xref="GOA:A6UYQ8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYQ8"
FT                   /protein_id="ABR85508.1"
FT                   /translation="MPGALSHIRVLDLSRVLAGPWAGQILADLGAEVIKIERPGSGDDT
FT                   RAWGPPFLKDAEGNDTGEAAYYLSANRNKKSVTVDFTQPEGQRIVRELAAKADILLENF
FT                   KVGGLKAYGLDYESLKQVNPKLIYCSITGFGQSGPYAKRAGYDFMIQGLGGLMSLTGRA
FT                   DNEEGAGPVKVGVALTDILTGLYSSTAVLAALAHRDVSGIGQHIDMALLDVQVACLANQ
FT                   TLNYLTTGVPPRRLGNAHPNIVPYQDFPTADGDMILTVGNDSQFRKFAELADHPEWADD
FT                   PRFATNKARVANREVLIPLIRQATVLHSTAEWILSLERAGVPCGPINDLAQVFADPQVQ
FT                   ARGLRVELPHPLGGTVPQVASPIRLSETPVEYRNPPPTLGQHTDDVLETLLGLDAAALE
FT                   RLRDGKVI"
FT   gene            complement(567602..568783)
FT                   /gene="gcdH"
FT                   /locus_tag="PSPA7_0549"
FT   CDS_pept        complement(567602..568783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="PSPA7_0549"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00441; match to protein family HMM PF02770; match to
FT                   protein family HMM PF02771; match to protein family HMM
FT                   PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83906"
FT                   /db_xref="GOA:A6UYQ9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYQ9"
FT                   /protein_id="ABR83906.1"
FT                   /translation="MATKASFNWEDPLLLDQQLTEEERMVRDSAQQFAQAKLAPRVLEA
FT                   FRHEQTDPKIFREMGETGLLGATIPEAYGGSGLNYVCYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPIHEFGNEATRQKYLPKLASGEYIGCFGLTEPNHGSDPGSMVTRAKKVDGGYR
FT                   LSGSKMWITNSPIADVFVVWAKDDEGQIRGFVLEKGWEGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPEENAFPEVRGLRGPFTCLNSARYGISWGALGAAEFCWHTARQYVLDRQQFG
FT                   RPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIA
FT                   RLARDMLGGNGISDEFGIARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFF"
FT   gene            569004..569912
FT                   /locus_tag="PSPA7_0550"
FT   CDS_pept        569004..569912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0550"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85518"
FT                   /db_xref="GOA:A6UYR0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR0"
FT                   /protein_id="ABR85518.1"
FT                   /translation="MRRKIPSTAALVSFESAARHESFTKAAEELSLTQSAICRQIATLE
FT                   EFLGVELFRRSRRGVKLTEAGLSYSRRVAVRLDAVERDTLAVMGHQGGGAIELAVVPTF
FT                   GTQWLLPRLKRFQRLHPEVTVNLTNRTRPFLFADTEFDAALYFGDADWSGTVSHFLMRE
FT                   NPVPVCSPELLGGRRTLSAEQIAGLPLMQQSTRPYGWRQWFHSQGLNVAHDMSGPRYEL
FT                   FSMLAQAAMHGMGVALVPPFLIQEELADGRLIVPMQHAYLSENAYYLIIPERRVESAML
FT                   NAFRDWLVEEARQYREANGLG"
FT   gene            570064..570468
FT                   /locus_tag="PSPA7_0551"
FT   CDS_pept        570064..570468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0551"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83045"
FT                   /db_xref="GOA:A6UYR1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR1"
FT                   /protein_id="ABR83045.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIIQLGNQR
FT                   VVTKYVSEINFVSSARQGDIIELGITATDFGRTSLTMTCHVRNKITRKSILTIDKMVFV
FT                   NLGPDGLPAPHGKTEITYIKDQFKEDEVLP"
FT   gene            complement(570511..572121)
FT                   /locus_tag="PSPA7_0552"
FT   CDS_pept        complement(570511..572121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0552"
FT                   /product="putative phosphate transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84207"
FT                   /db_xref="GOA:A6UYR2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR2"
FT                   /protein_id="ABR84207.1"
FT                   /translation="MTTDVLPADAIASAGKPQLEHKPGRLAAIVFFAALAIGLLFSAYS
FT                   LVQDIDDVGSAVTTWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPHFAV
FT                   VWSGCFNFLGVLLSSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAILWNLGTWW
FT                   LGLPASSSHTLIGSIIGVGVANALMHGRDGTSGVDWGQASKVGYSLLLSPLIGFACAAL
FT                   LLLALRLLVKNRALYKAPKGKAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLIL
FT                   VGTLPMAYALNRTMPADQAVQFAAVAEVTRQALVKSAPQPAPADPRQVLSEYVRSKQAS
FT                   PELIPALAALTGSIGREVKGYGAFSRVPAEAMGNVRNDMYLTSEAIRLMDQDGVGRFDA
FT                   DTRGKLQAFKQKIDDATKFIPLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYA
FT                   QGASAETVAMLTIGAADLYGLPVSTTHVLSSGVAGTMAANGSGLQWRTIRNLLMAWVLT
FT                   LPAAILLSASLYWLLTRLF"
FT   gene            572500..573831
FT                   /locus_tag="PSPA7_0553"
FT   CDS_pept        572500..573831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0553"
FT                   /product="peptidase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80678"
FT                   /db_xref="GOA:A6UYR3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR3"
FT                   /protein_id="ABR80678.1"
FT                   /translation="MRMPWRLALALWLCLAGQACLAASATVRVLSVDGAIGPASADYLV
FT                   RGIQRAAEDGAQLVVLEMDTPGGLDPSMRRIVKAILASRVPVAGFVAPAGARAASAGTY
FT                   ILYACHVAAMAPGTNLGAATPVALGAPDEAEGKPPARGAGPMARKQVNDAAAYIRGLAQ
FT                   LRGRNAEWAERAVREAVSLAASEAAAQKVIDLQARDLPDLLRQLDGRSLRVGERALTLA
FT                   TTGATVERQAPDWRARLLAVLTDPSVALILMMIGIYGLIFELANPGMALPGVLGGICLL
FT                   LGLYALQMLPVNYAGLALIALGLAFMVGEAFVASFGVLGIGGIVSFVAGALILIDTEVP
FT                   GYGIPPGLVVALALLSAALIVGLLGMALRARRQAVVSGTAGLVGSLATVAAVDPEQPCA
FT                   GWVLLQGERWRVLATRPLAVGQPVWVLARKGLLLEVALADEGGG"
FT   gene            573828..574622
FT                   /locus_tag="PSPA7_0554"
FT   CDS_pept        573828..574622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0554"
FT                   /product="putative stomatin-like protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86604"
FT                   /db_xref="GOA:A6UYR4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR4"
FT                   /protein_id="ABR86604.1"
FT                   /translation="MMGISYGLAMLLAFLALLLFSALRILREYERGVVFQLGRFWKVKG
FT                   PGLVLVIPALQQMVRIDLRTIVLDVPPQDVISRDNVSVKVNAVVYFRVLDPQKAIIQVE
FT                   NYLAATSQLAQTTLRAVLGKHELDEMLAERERLNLDIQQVLDAQTDAWGIKVANVEIKH
FT                   VDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGRQSGAMQLRYMQT
FT                   LGAIAGDKSTTIVFPMPIELFGGKYPGAAPRNEKAAGEDQER"
FT   gene            574731..575462
FT                   /locus_tag="PSPA7_0556"
FT   CDS_pept        574731..575462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0556"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84209"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR5"
FT                   /protein_id="ABR84209.2"
FT                   /translation="MLRCALLLLSLLLSCASPAANLRLVGDAWPPFVDARLPGNGLAVE
FT                   LVTTALKRAGFDASFQQVPWSRALYGVRSGDYDIALSAWYEPARSLYGQFSRAYLTNRI
FT                   RLLQRKGRGIEFTRLSDLRPYRIAVVRDYAYAPEFDRDSGLQKVNVTSFANAARMLEAG
FT                   RVDLAVEDELALGFALNGELAYLRDKLEVLPTPLGENGLHLLVSLRNPRHEEIVDGFDL
FT                   AIRGMRDDGSYQRLLQRYGAR"
FT   gene            complement(575459..577660)
FT                   /locus_tag="PSPA7_0555"
FT   CDS_pept        complement(575459..577660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0555"
FT                   /product="membrane protein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF05976; match to protein family HMM TIGR01666; match to
FT                   protein family HMM TIGR01667"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86794"
FT                   /db_xref="GOA:A6UYR6"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR6"
FT                   /protein_id="ABR86794.1"
FT                   /translation="MPPTSLTHTLRRLWALDKFAYSLRVFLALAGAMLLCWWQGRIELL
FT                   IPLFLGIIASALAETDDNWLGRLQALLVTLLCFSVAAFAVELLFPYPWLFVSGMALSAF
FT                   GMILLGALGERYAAIASATLILSIYTMIGVDQRGGEVADVWHEPLLLVAGAAWYGLLSV
FT                   LWNALFSNQPVQQSLARLYFELGEYLRIKSSLFEPLRQLDVEGQRLALARQNGKVVVAL
FT                   NQAKETILNRLGHGRPGPKVSRYLKLYFIAQDVHERASSSHYPYNRLAEAFFHSDVLFR
FT                   CQRLLNQQGKACQALARAIRLRQPFDYDDSEQALEDLQASLEHLRQQSNPAWKGLLRSL
FT                   GALAANLATLDRKLAGASNPDAIADEQDSALLDRSPRSLKDAFERLRQQLTPTSLLFRH
FT                   GLRMALALTAGYGVLHWIHPTQGYWILLTTVFVCQPNYGATRLRLVQRILGTLVGLVAG
FT                   WALIDLFPNPLVQSLFAVAAGVAFFATRSSRYTLATAAITLLVLFCFNQVGDGYGLILP
FT                   RLFDTLLGSLIAGLAVFLVLPDWQGRRLNRMLANTLACNSRYLRQIMQQYATGKRDDLD
FT                   YRTARRNAHNADAALSTTLSNMLLEPGHFRKDAEIGFRFLVLTHTLLSYLSGLGAHREN
FT                   LPEDASDGLLQRAAERLSASLEEIAACLEQKRPVAIYSEEEEALAKELEQMPEEMDDGH
FT                   RLVQTQLAHICRQLAPLRTLAAHLLKKELAGEQPLPGQP"
FT   gene            complement(577878..579254)
FT                   /locus_tag="PSPA7_0558"
FT   CDS_pept        complement(577878..579254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0558"
FT                   /product="DEAD/DEAH box heliCase domain/helicase conserved
FT                   domain/dbpa rna binding domain protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00270; match to protein family HMM PF00271; match to
FT                   protein family HMM PF03880"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83410"
FT                   /db_xref="GOA:A6UYR8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR8"
FT                   /protein_id="ABR83410.1"
FT                   /translation="MTSTVFSSLPLSADLLANLDSLGYREMTPIQAQSLPLILQGRDLI
FT                   AQAKTGSGKTAAFGLGLLAPLNPRYFGCQALVLCPTRELADQVAKEIRRLARAADNIKV
FT                   LTLCGGVPYGPQVASLEHGAHVVVGTPGRIQEHLRKGTLVLDGLNTLVLDEADRMLDMG
FT                   FYDSIAEIIGQLPERRQTLLFSATYPDGIEKLAKAFMRDPQQVKVESLHTDSQIEQRFF
FT                   EIDPKQRMDAVVRLLQHFRPQSCVAFCQTRQQCQELADALKAHRISALALHGDLEQRER
FT                   DQVLTVFANRSCTVLVATDVAARGLDIAALETVINVELARDPEVHIHRIGRSGRAGEKG
FT                   LALSLVAPAEASRAQAIEDLQKQPLAWYALGQLKANPEPLLPPMSTLCIAGGRKDKVRP
FT                   GDLLGALTGDAGLPGSAVGKIAIFDFQAFVAIERGLAHQALKRLSEGRIKGRSFKVRLL
FT                   "
FT   gene            579602..579811
FT                   /locus_tag="PSPA7_0559"
FT   CDS_pept        579602..579811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0559"
FT                   /product="putative cold-shock protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81234"
FT                   /db_xref="GOA:A6UYR9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYR9"
FT                   /protein_id="ABR81234.1"
FT                   /translation="MSRQNGTVKWFNETKGYGFITPESGPDVFVHFRAIEGNGFKTLAE
FT                   GQKVSFEVVQGQKGMQAERVQVIN"
FT   gene            579961..580485
FT                   /locus_tag="PSPA7_0561"
FT   CDS_pept        579961..580485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0561"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF05618"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80981"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS0"
FT                   /protein_id="ABR80981.1"
FT                   /translation="MKPVQSRRLAFAALLSLSFSSASCHAAAEHWGWIEQSWLMPERMQ
FT                   AKAKLDTGALTSSLDAKNIHRYKKDGERWVRFEVVLPTAGSKAPVSVTFERKVLRVIKV
FT                   RGAGGSDSRPVVAMDICLGDKLLREQFSLRDRGNMNYPVLLGRRTLDHLGAVDVSRTFT
FT                   RKPSCGALAAQ"
FT   gene            complement(580479..580853)
FT                   /locus_tag="PSPA7_0560"
FT   CDS_pept        complement(580479..580853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0560"
FT                   /product="putative membrane spanning protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF06803"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80697"
FT                   /db_xref="GOA:A6UYS1"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS1"
FT                   /protein_id="ABR80697.1"
FT                   /translation="MAWLATLRRWARGLKTEVIALWLCSRHPHMPWPARLVALLVVAYA
FT                   LSPIDLIPDFIPLLGYLDDLLLVPLGIWLAIRLTPPALLAECRARAREVEARPRNPWMT
FT                   ALIVLLWLALAAGLLRWFFY"
FT   gene            complement(580855..582288)
FT                   /locus_tag="PSPA7_0562"
FT   CDS_pept        complement(580855..582288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0562"
FT                   /product="putative MFS transporter"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF07690; match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82134"
FT                   /db_xref="GOA:A6UYS2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS2"
FT                   /protein_id="ABR82134.1"
FT                   /translation="MSEPFQLTPRIARQLPWLVAVAFFMQALDGTILNTALPSMATSLN
FT                   ENPLRMQAVVIAYLLTVALLIPASGWIADRFGTRRVFLGAVLLFSLGSLLCALSPSLEL
FT                   LVGARIVQGVGGALMMPVGRLVILRVYPRQDLVRVLSFVTIPGLLGPLAGPTLGGWLVE
FT                   YASWHWIFLINLPVGLLGCLVAMKLMPDLRSPLPSRFDSIGFLLFGGSMVLISIALEGL
FT                   GELHLSHLRVVLLLVGGLVLLTAYWLRALRIDKPLFPPSLFQARTFAVGILGNLFARLG
FT                   SGALPFLTPLLLQVGLGYPPSTAGMTMIPLALFAMVAKPLAKPLLDFFGYRKLLVGNTL
FT                   ILGCLIAGFGLVDQDTPYVWLLLHLSLLGAVNSLQFTAMNTLTLIDLQDSNASSGNSLM
FT                   SVVVQLSISLGVACAAALLGGFQTDLDTGQDTVLGAFHATYVSVGLMSMLAAAIFFQLG
FT                   SEDGRTSPRRVDPEKDPDL"
FT   gene            582664..585462
FT                   /locus_tag="PSPA7_0564"
FT   CDS_pept        582664..585462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0564"
FT                   /product="putative ClpA/B protease ATP binding subunit"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00004; match to protein family HMM PF02861; match to
FT                   protein family HMM PF07724; match to protein family HMM
FT                   PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85757"
FT                   /db_xref="GOA:A6UYS4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS4"
FT                   /protein_id="ABR85757.1"
FT                   /translation="MAQELCAICHERPAVARVSLVQNGQRRELALCELHYRQLMRQQRM
FT                   RSPLESLFGGGSPFDEIFSGFGEQSPVSPVRAREPEAVDIAEYFSKQTTEYLQRAAQVA
FT                   AEFGKREVDTEHLLYALADADVVQAVLKQFGLSPADLKQYIEANAVRGAGKGEASEDMT
FT                   ISPRVKSALQHAFGLSRELGHSYVGPEHLLLGLAAVPDSFAGTLLKKYGLTEQALRQKA
FT                   VKVVGKGAEDGRVDGPSSTPQLDKFSRDLTRLAREGKLDPVIGRSKEVETTIEVLARRK
FT                   KNNPVLIGEPGVGKTAIVEGLAQRMVQGEVPEVLRDKRLVELNINAMVAGAKYRGEFEE
FT                   RLKQVMDELQAAQSEIILFIDEVHTIVGAGQGGGEGGLDVANVLKPAMARGEMNLIGAT
FT                   TLNEYQKYIEKDAALERRFQPVFVPEPTVEQTISILRGLRDKLEGHHKVTIRDEAFVAA
FT                   AELSDRYIGNRFLPDKAIDLIDQAAARVRIASTSRPAEIQELEAELAQLKREQDYAASR
FT                   KWYDEAKVFEKRIQERKEHLEQITERWQQTQGSKTEEVRVEDIAEIISRLTGIPVTELT
FT                   AEEREKLLRMEERLHQRVIGQQEAITAVSDAVRLARAGLRQGSRPIATFLFLGPTGVGK
FT                   TELAKALAEVVFGDEDAMIRIDMSEYMERHAVSRLIGAPPGYVGYEEGGQLTERVRRRP
FT                   YSVILLDEIEKAHADVNNILLQVFDDGRLTDGKGRVVDFTNTIIIATSNLGSDLIMKNA
FT                   QAGEFAQPPEKLKRELMNTLRGHFRPEFLNRLDEVIVFESLSKAQIEDIVRLQLERVKR
FT                   AAHAQDIHLHIDDSLVGHLAEEAYQPEFGARELKRQIRQQLETRLATAMLKGDVKEGET
FT                   ITFFHDARDGVGYRKGAAPKPAARKKAGAGETSKGRATATRKPAAKKGAAAKGKADKPK
FT                   AK"
FT   gene            585564..586142
FT                   /locus_tag="PSPA7_0565"
FT   CDS_pept        585564..586142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0565"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84649"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS5"
FT                   /protein_id="ABR84649.1"
FT                   /translation="MRVTTHATLAAALLLSAASAFAFNLGDAAKAVAGASQGDSAQVAT
FT                   TPQTSGLLGALTGQLGVSQEQAVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKLSGNN
FT                   ALAGLGGLGNMLGKNAGADKGLGSLLGNADSMGDVDKAFNTLGMDSGMTEKFAQVLVDY
FT                   FGKQGANSELLGSLSNLWGVSKAGGSSLL"
FT   gene            complement(586372..587259)
FT                   /locus_tag="PSPA7_0566"
FT   CDS_pept        complement(586372..587259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0566"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84761"
FT                   /db_xref="GOA:A6UYS6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS6"
FT                   /protein_id="ABR84761.1"
FT                   /translation="MRELLTGLTSSLLLLLNTLILIGPMMLIALLKLVLPGQRLKDLCS
FT                   RGVMWIAETWAEIDKWIFATCTPTVWDVRGAGDLRQDTSYLVVSNHQSWVDIPALIQVF
FT                   NRRTPYFKFFLKKELIWVPFLGLAWWALEYPFMKRYSKAFLEKHPELKGKDLEITKAAC
FT                   EKFKRIPVTVVNYLEGTRFSEQKKARQQSPYRHLLKPKAGGVAFVLAALGEQLDALLDV
FT                   TVVYPSDKVPGFWDLLCGRVPKVIVDIQTRPIDPALWQGDYENDPVFRQYVQEWVSRMW
FT                   EEKDERIARLRQLR"
FT   gene            587402..587911
FT                   /locus_tag="PSPA7_0567"
FT   CDS_pept        587402..587911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0567"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85373"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS7"
FT                   /protein_id="ABR85373.1"
FT                   /translation="MKRVLALLSLFALPVLAAEPNLYGRYEWVSLPELDRTLQAKMDTG
FT                   AYTSSLSAKDIELFQRDGEEWVRFRLATKEADGSVFEHKLARIGKIKNRADNRSGEDED
FT                   EDRLSERPVIDLQVCLGGEMKTIEVNLTDRSAFNYPFLMGTKGLRKFHVAVDPAERFVA
FT                   GKPACK"
FT   gene            587996..588685
FT                   /gene="creB"
FT                   /locus_tag="PSPA7_0568"
FT   CDS_pept        587996..588685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creB"
FT                   /locus_tag="PSPA7_0568"
FT                   /product="two-component response regulator CreB"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00072; match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86365"
FT                   /db_xref="GOA:A6UYS8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS8"
FT                   /protein_id="ABR86365.1"
FT                   /translation="MPHILIVEDEAAIADTLLYALQAEGFATTWVPLAGEALALQERQP
FT                   ADLLILDVGLPDISGFEACKRLRRFSEVPVIFLTARDAEIDRVVGLEIGADDYVVKPFS
FT                   PREVAARVKAILKRMAPRPAPLEEAALHGPFQVDAERVRIHYHGAPLNLTRHEFRLLQT
FT                   LLGQPERVFSREQLLDALGVASEAGYERNIDSHIKSLRAKLRQVNARGEAIQTHRGLGY
FT                   SYSPDHA"
FT   gene            588685..590109
FT                   /gene="creC"
FT                   /locus_tag="PSPA7_0569"
FT   CDS_pept        588685..590109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /locus_tag="PSPA7_0569"
FT                   /product="two-component sensor CreC"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00512; match to protein family HMM PF00672; match to
FT                   protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83991"
FT                   /db_xref="GOA:A6UYS9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYS9"
FT                   /protein_id="ABR83991.1"
FT                   /translation="MPLGVRIFLVYFLFVGLTGYFVLSTVMDEVRPGVRQSTEETLVDT
FT                   ANLLAEILRQDVKNGTLAQSDLPEMLEDYGKRVPQADIWGLRKEAVNHRIYVTDASGKV
FT                   LLDSTGIAVGQDYSRWNDVYRTLRGQYGARSSREDPDDPDSSVMYVAAPIKDAGKIIGV
FT                   VSVAKPNSSLQPYIDRSQRRLAWLGAGLIALGLLVGGLLSWWLSGALRRLTRYAQAISE
FT                   GRRAELPRYRGGEMAQLAGAVERMRTQLEGKDYVERYVHTLTHELKSPLAAIRGAAELL
FT                   DGEMPAEQRARFVANIAGESERLQQLIERLLSLAQVEQRQGLEEVGPVDLREVAEALLE
FT                   GQAARIQRQGLTVEKRLDGPCAIRGERFLVRQALANLLDNALDFTPPGGRLRLSAEVDG
FT                   KGVALRLFNQGPAIPDYALARLTERFYSLPRPASGRKSTGLGLNFVAEVAQLHGGRLQV
FT                   GNHEDGVEALLWLPRG"
FT   gene            590210..591568
FT                   /gene="creD"
FT                   /locus_tag="PSPA7_0570"
FT   CDS_pept        590210..591568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creD"
FT                   /locus_tag="PSPA7_0570"
FT                   /product="inner membrane protein CreD"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF06123"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83282"
FT                   /db_xref="GOA:A6UYT0"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT0"
FT                   /protein_id="ABR83282.1"
FT                   /translation="MNRTLAYKLGAIALLILLLLIPLLMIDGLIRDRQEARDGVLQDIA
FT                   RSSSYSQRLTGPLLVVPYRRTVREWVTEEKTQKRVLQEREQRGELYFLPDRFALDGQMR
FT                   TELRYRGIYQARLYHVDNKVGGYFQVPAHYGIEEDLEDYQFETPFLAMGISDIRGIENA
FT                   LRLSLNGAGVDFEPGSRVGLLGSGVHAPLQGVDGRQAQRLEYAFDLTLLGSERLDIVPV
FT                   GRDSQVILKADWPHPSFGGEFLPSEREITAEGFTARWQTSFFATNMEEALRSCVQEQRC
FT                   DGFQARAFGVGLVDPVDQYLKADRAIKYALLFITLTFAGFFLFEVLKRLAVHPIQYALV
FT                   GLALAFFYLLLLSLAEHVGFELAYLASAGACVGLIGFYLCFVLRSVTRGLGFSAGLAGL
FT                   YGLLYGLLSAEDYALLMGSLLLFAVLAAVMVLTRRLDWYGVGRKDLPAVPAKA"
FT   gene            591618..591920
FT                   /locus_tag="PSPA7_0571"
FT   CDS_pept        591618..591920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0571"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81964"
FT                   /db_xref="GOA:A6UYT1"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT1"
FT                   /protein_id="ABR81964.1"
FT                   /translation="MRLFFEFTLCAALGLLVSGVILIFLLFFGKFGLIEYWIASGKPLA
FT                   HAMLVLMPGGFWEGLSGIEDAAGNPHVRSFLELCMGLGQSALLLGLLLFRLVCWK"
FT   gene            591917..592102
FT                   /locus_tag="PSPA7_0573"
FT   CDS_pept        591917..592102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0573"
FT                   /product="hypothetical protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80818"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT2"
FT                   /protein_id="ABR80818.1"
FT                   /translation="MNGYVGLRDDRRDGERLAARIGLLFPGPSAAWLQRAERLRRQQAS
FT                   AGPGVRRGSPASTGAG"
FT   gene            complement(592065..592685)
FT                   /locus_tag="PSPA7_0572"
FT   CDS_pept        complement(592065..592685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0572"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85751"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT3"
FT                   /protein_id="ABR85751.1"
FT                   /translation="MNATHTLFYAAASPFVRKVLVLLHETGQRERVVLEEAMPTPVAPI
FT                   RQLNASNPAGKIPALRLPDGQVLHDSRVICDYFDQQHVGEPLIPREGSARWRRLTIASL
FT                   ADAILDAAVLVRYEAFVRPEEKRWDAWLDAQREKIARSLAWLESDCIAELRARFDIAAI
FT                   GVACALGYLDLRQPEWDWRGHYPQLAAWFAEVSQRPSMQATRA"
FT   gene            complement(592704..593654)
FT                   /locus_tag="PSPA7_0574"
FT   CDS_pept        complement(592704..593654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0574"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84651"
FT                   /db_xref="GOA:A6UYT4"
FT                   /db_xref="InterPro:IPR011217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT4"
FT                   /protein_id="ABR84651.1"
FT                   /translation="MRCLSSPLLGLLVGLSLNGAALAGEQYYPLDKGSAPYAVAPTAQG
FT                   PVWFGAAGGHALGRLDPTSGASVQVPLGEGARPRAIVSDESGNAWVLDSGLDAILRVGG
FT                   ERLGSERFALPAKAAPVGLEAAAFDDDGRLWFTGSRGFHGRLDPQRRVVEVWPAPQGKA
FT                   ASGICVTPDGEVWYAQDDALVHVDPLDGSAERLPAPEGTKALRGLGADSIGRLWASDSG
FT                   GARLYRYDPSDASWQSWPLPDSQARPDSLRVDAMDRVWLHDAASGALLRFDSEQATFRV
FT                   LPSDRPAPGNALLGGRPGETWSAEPATDRLRVVRD"
FT   gene            593740..594597
FT                   /locus_tag="PSPA7_0575"
FT   CDS_pept        593740..594597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0575"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85681"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT5"
FT                   /protein_id="ABR85681.1"
FT                   /translation="MPTVEILGAECRAGGAVNDDALGCTAQAAWVIDGATSIGRSVLGV
FT                   ESDARWLAQAVDRHLRLLLEVEPEQSSETLLRRLLNDIQGDFRAQSGRDWHDLEDMPAA
FT                   CLSLLRIRGGEVELLNIGDSRILVEGADGQVRSFGESALHELDRQSLAHFCRMREEHPQ
FT                   WDHAELFKASRPRVRQNRQLMNKPEGYWALDISDRWLGQVQRETLPLAALRSFVLMTDG
FT                   FDRLVEPFRRYTDEQLLRRLEEVGVSALLDELRQIEQGDDQALAFPRFKIHDDASALWG
FT                   RIAG"
FT   gene            complement(594767..597187)
FT                   /locus_tag="PSPA7_0576"
FT   CDS_pept        complement(594767..597187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0576"
FT                   /product="putative hydroxamate-type ferrisiderophore
FT                   receptor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00593; match to protein family HMM PF07660; match to
FT                   protein family HMM PF07715; match to protein family HMM
FT                   TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82530"
FT                   /db_xref="GOA:A6UYT6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT6"
FT                   /protein_id="ABR82530.1"
FT                   /translation="MPRPTFRPGLLAIAIAIALAVPAPFLHAAPAEQASVRDYRIAAGP
FT                   LAGTLNRIAAQAGLVLTLDPALAEGRSAHAVQGRFDAPGALREALRGSGLELVENAGGT
FT                   YSLRKVPEDTLSLQAMTVSGAEEDPLGPTSGYVAKRSMTGTKTDTPILETPRSISVATR
FT                   QQMADRAVHNLDDAVRYMPGVVASSFGSDTRSDWLKVRGFKPTQFLDGLPMAVGVYNNP
FT                   KLETWNLERVALLRGPASSVYGQTPPGGMLDMVSLRPQNVASHEVKAEVGNYNHKQVSF
FT                   DSTGPLDDEGRFLYRLSGVVRDSNTQVDHIDDKRYNIAPSLTWNIDDDTRLTFLGQFNR
FT                   DDTAATSQFLPLRGTKYDAPFGKISHHKNLGDPDWDFYDRTYYWLGYSFERRINDVWQF
FT                   RQNLRYLRNDLSFQTLTPTSSIDAASADGTLQRMTTSVDEDVSQFVVDNNFQADFETGA
FT                   LRHTLLLGIDHNRTRTDYTSIYNFTGVPPTNVNNPIYGQPIPKPSRSSAFYDYRQKTYQ
FT                   TGLYLQDQIALDNWRLTLGGREDWVHAGATFYNQNDATNTSRDKKFSANAALSYIFDNG
FT                   LAPYLSYAESFQPSTGADDIGSNKMFKPTEGKQWELGVKYQPVGSDSLFTAAVYDLRQE
FT                   NVRVTDNINGTPTTSQAGEVKVSGIELEATSNVTENLKMIGAYSYTDTEVKKGQYAGNR
FT                   LQQAPRNQASLWADYTWHEGALNGFSVGAGARYVGSTYGDQANTYDGYAGSYTLYDAAV
FT                   RYDLGQLNGSLKGVSVAVNANNLFNKDYLASCDGYYCYYGDQRSVVGSVSYKW"
FT   gene            complement(597290..598261)
FT                   /locus_tag="PSPA7_0577"
FT   CDS_pept        complement(597290..598261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0577"
FT                   /product="putative transmembrane sensor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04773"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85091"
FT                   /db_xref="GOA:A6UYT7"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT7"
FT                   /protein_id="ABR85091.1"
FT                   /translation="MNPDERQTAVHARVLDEAIAWQLLLDSGEAHPDDHRAFHRWYAAH
FT                   PEHERAWEQLGGLDRHLARAANGPARNALLSGNARFKRRLRRLGGSALGLLLALGVGLG
FT                   VANRYVPVRYLLADAYSATGEQRELTLPDATHVRLNSRSAIDVRFDGERRQVVLLAGEI
FT                   LVETAHGDPRPFVVSSADGDMRALGTRFLVRREEPGTRLTVLQSAVAARAETLSEERVI
FT                   KEGQQVLILPQGLQASAAAPALAGAWAQGMLVVENARLADLVAELGRYSPALLRVDPSI
FT                   ADLRVTGSFPLKDTRLALQALEPSLPVRSVRHNAWWFEVVPR"
FT   gene            complement(598258..598776)
FT                   /locus_tag="PSPA7_0578"
FT   CDS_pept        complement(598258..598776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0578"
FT                   /product="putative sigma-70 factor, ECF subfamily"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04542; match to protein family HMM PF04545; match to
FT                   protein family HMM PF08281; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84430"
FT                   /db_xref="GOA:A6UYT8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT8"
FT                   /protein_id="ABR84430.1"
FT                   /translation="MAAGEVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDTF
FT                   VRLLGRPELPGLREPRAFLAKVARGLLIDHFRRAALEQAYLAELALVPEAEQPSAEERY
FT                   LILEDLREIDRLLGTLSLKARSAFLYNRLDGMPHAEIAERLGVSVPRVRQYLAQGLRQC
FT                   YIALYGEPR"
FT   gene            598945..599694
FT                   /locus_tag="PSPA7_0579"
FT   CDS_pept        598945..599694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0579"
FT                   /product="putative glutathione S-transferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02798"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86891"
FT                   /db_xref="GOA:A6UYT9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYT9"
FT                   /protein_id="ABR86891.1"
FT                   /translation="MAEPLLIIGSYLSPYVRKVLVLLELKGVAYRIDPIVPFFGDEAFE
FT                   RLSPLRQIPVLVDGDFVLNDSSVICQYLEERYPQPSLYPADLGQRAQARWLEEYADSRL
FT                   GQVIIWQLFHQQVINRGIWKREPDQAVLQRTYDEDLPSVCAYLEGRTPERGWLLGELSI
FT                   ADVAIACLFRNAQLARYQVDGERWPRLARLLADAFALPVFQRLARFENASAQTPVAEQR
FT                   KVLGEAGAPLSATSHGREQPVRGPMSR"
FT   gene            599836..600237
FT                   /locus_tag="PSPA7_0580"
FT   CDS_pept        599836..600237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0580"
FT                   /product="esterase"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83167"
FT                   /db_xref="GOA:A6UYU0"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU0"
FT                   /protein_id="ABR83167.2"
FT                   /translation="MNVPEGFQPLFRSSPLLDLLGPFFCRRDAQRQLVVALRIEEKHCN
FT                   HGGSAHGGLLSTLADVGLGYAMAFSREPPQPMVTVGLRLDFCGVARVGDWLEVHTRVDK
FT                   LGQRMAFASARLHSGERLVASASGVFHLP"
FT   gene            600287..600856
FT                   /locus_tag="PSPA7_0581"
FT   CDS_pept        600287..600856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0581"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83297"
FT                   /db_xref="GOA:A6UYU1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU1"
FT                   /protein_id="ABR83297.1"
FT                   /translation="MPKKSNAAERIVHATASLLASRGYFGTGLSDIIARAEAPKGSLYH
FT                   YFPQGKPQIASAAIGFVGAEVETFLDRAGATAPHARNVLREFTATLRGWLERSAFEEAC
FT                   PVFSTTLSIDAELAPVHAECRRALRAWHAGIERALRADGMAEKAAGSRAWLILAALEGA
FT                   VGVARAERSVDALDAIEEELRALLPA"
FT   gene            complement(600882..602609)
FT                   /locus_tag="PSPA7_0582"
FT   CDS_pept        complement(600882..602609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0582"
FT                   /product="putative permease"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83275"
FT                   /db_xref="GOA:A6UYU2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU2"
FT                   /protein_id="ABR83275.1"
FT                   /translation="MSSTPKPPAAPREFSPSLLDLGTLESLDHLPRAGQSAAEFSAAML
FT                   DLGTPASLDCLPRAGLRAAEFSAARLDLGTPASLDCLPRASHHAGSELPPLSPRLYSAD
FT                   LAPSKAEGRRWGRYSLFALWTNDVHNIANYSFAIGLFALGMSGAQILAALALGALMVYG
FT                   LMNLSGYMGQKTGLPYPVMCRIAFGIHGAQLPALIRAVIAIAWFGIQTYLASIVLRVLL
FT                   TAIWPGLAAYDQDAILGLSSLGWATFVAIWCVQLLIFAYGMEMVRRYESFAGPVILLTV
FT                   AALAAWMYLRAGASIAWSSGEPMSGSQMWLKIFGGAAFWVTLYGTMILNFCDFARGCPD
FT                   KRTISVGNFWGLPVNILLFGLFAVVLAGAQFRIDGQLIQSPTDIVAAIPDTAFLVLASL
FT                   ALLIVTVAVNIMANFVAPAYVLTNLAPNLLNFRRAGLISATIAVLILPWHLYNSPGVIL
FT                   YFLGGLGALLGPLYGIIMVDYYLVRKGRVNLPELYTESRAGAYHYARGVNPRAIAAFVP
FT                   AAIISTLLALLPAFAELSPFSWFFGAGLAGLIHYALANRRAAYREVSGEAIAVDSVQH"
FT   gene            complement(602957..603883)
FT                   /locus_tag="PSPA7_0583"
FT   CDS_pept        complement(602957..603883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0583"
FT                   /product="putative transcriptional regulator"
FT                   /note="manually annotated"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81180"
FT                   /db_xref="GOA:A6UYU3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU3"
FT                   /protein_id="ABR81180.2"
FT                   /translation="MHPLLRRLDLNLLLVFDSLYRHRNVGTAAGELAISASAFSHALGR
FT                   LRQGLDDELFLRQGNRMQPTQRAEHLAGAVAAALRALGEGLEEWRPFVPGQSQRTFVFA
FT                   TTDYTAFALLPPLMDRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLP
FT                   EGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSG
FT                   LRREVAVQLPTVLAALFLAGSTDFLLTAPRHAAQALAEAAGLALYPAPFDIPPYVLRLY
FT                   SHVQHAGRDAHAWMIGQLKGLDISRTG"
FT   gene            603971..604447
FT                   /locus_tag="PSPA7_0584"
FT   CDS_pept        603971..604447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0584"
FT                   /product="putative N-acetyltransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83685"
FT                   /db_xref="GOA:A6UYU4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU4"
FT                   /protein_id="ABR83685.1"
FT                   /translation="MTLEIRPAVPADAEQILAFIIELADYERARHEVVTDVEGIRRSLF
FT                   AEGSPTRALMCLSEGRPIGYAVYFYSYSTWLGRNGIYLEDLYVTPECRGVGAGRRLLRE
FT                   LAREAVANDCGRLEWSVLDWNQPAIDFYRSIGALPQDEWVRYRLDGEALRRMAQ"
FT   gene            complement(604713..606890)
FT                   /gene="glcB"
FT                   /locus_tag="PSPA7_0585"
FT   CDS_pept        complement(604713..606890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /locus_tag="PSPA7_0585"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01274; match to protein family HMM TIGR01345"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84414"
FT                   /db_xref="GOA:A6UYU5"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYU5"
FT                   /protein_id="ABR84414.1"
FT                   /translation="MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADSFWTGAEAVIND
FT                   LAPKNKALLAKRDDLQAKINGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQN
FT                   VDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKV
FT                   RGDKVIAFARAFLDEAAPLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQ
FT                   GDAAKPQAVLLKHNGLHFEIQIDPSSPIGQTDAAGVKDVLMEAALTTIMDCEDSVAAVD
FT                   ADDKVVIYRNWLGLMKGNLAEEVSKGGTTFTRTMNPDRVYTGADGSELTLHGRSLLFVR
FT                   NVGHLMTNDAILDKHGNEVPEGIQDGLFTSLIAIHNLNGNTSRKNSRTGSVYIVKPKMH
FT                   GPEEAAFTNELFGRVEDVLGLPRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGF
FT                   LDRTGDEIHTSMEAGAVVRKGAMKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMP
FT                   DLMAAMLEQKIGHPLAGANTAWVPSPTAATLHALHYHKVDVFARQAELAKRTPASVDDI
FT                   LTIPLAPNTNWTAEEIKNEVDNNAQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATL
FT                   RISSQLLANWLRHGVISQEQVVESLKRMAVVVDRQNASDPSYRPMAPDFDDNVAFQAAL
FT                   ELVVEGTKQPNGYTEPVLHRRRREFKAKNGL"
FT   gene            607197..607640
FT                   /locus_tag="PSPA7_0586"
FT   CDS_pept        607197..607640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0586"
FT                   /product="putative acetyltransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85284"
FT                   /db_xref="GOA:A6UYU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU6"
FT                   /protein_id="ABR85284.1"
FT                   /translation="MPVHAASLADLADLVPLFSAYLDFYEVPAPEEQVRAFLAERLRQG
FT                   DSTLFLARDAEARALGFVQLYPLFASLALRPSWLLSDLFVRPEARRQGVGEALMNQARR
FT                   FAESMGACGLQLETAKTNHAGQSLYERLGYVRDEQFYTYWLQL"
FT   gene            607672..608187
FT                   /locus_tag="PSPA7_0587"
FT   CDS_pept        607672..608187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0587"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86291"
FT                   /db_xref="GOA:A6UYU7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU7"
FT                   /protein_id="ABR86291.1"
FT                   /translation="MDHLVLTVIATDHPGLVERIAQCIASHGGNWLESRMSRMAGQFAG
FT                   ILRVAVPAEGYDELVEGLQGLSKHGIRVLLAESGIEPVCSWKPIRLDLVGNDRPGIVRD
FT                   ITRLLAEHGVNLESLATEVRPAPMSSEPLFHAEALLAVPLTLPLDTLRERLEDLADDLM
FT                   VELVLEAS"
FT   gene            complement(608876..609772)
FT                   /locus_tag="PSPA7_0588"
FT   CDS_pept        complement(608876..609772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0588"
FT                   /product="membrane protein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00892; match to protein family HMM TIGR00688"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86059"
FT                   /db_xref="GOA:A6UYU8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU8"
FT                   /protein_id="ABR86059.1"
FT                   /translation="MATANLRRGYVLGLTAYVIWGLFPLYFKLLERIPAVEIIVQRAVW
FT                   SALFGAVLLLFWKHPGWWRELRQNPRRFVVLAASGLLIASNWMTYVWAVNNGHMLEASL
FT                   GYYINPLINVMLGMLLLKERLRPLQWLAVALASLGVAQQVWQLGSLPWVSLVLALTFGF
FT                   YGLIRKQAPVAALPGLVVETWLLLPLALVWLLLFADGPTSEAAFWSTPEALWVVAAGPV
FT                   TLVPLVCFNAAARHLPYATLGFLQYLAPTLVLLQAILLFGEHLDSSRLTAFAFIWLALA
FT                   VYSLDAWRSLRRLPQPG"
FT   gene            complement(609983..610957)
FT                   /locus_tag="PSPA7_0589"
FT   CDS_pept        complement(609983..610957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0589"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82547"
FT                   /db_xref="GOA:A6UYU9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYU9"
FT                   /protein_id="ABR82547.1"
FT                   /translation="MSHPFDSLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIED
FT                   DEPLIAKFYRPDRWSDAAIREEHAFSAELAECEVPVVAPLTREGESLFGFAGFRFALFP
FT                   RRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFEHREALTVDNFGHASLATLLEGDFI
FT                   PRSLLPAYESVARDLLRRVDALFAEVPYQPIRLHGDCHPGNLLCRDEVYHMVDLDDCRM
FT                   GPALQDLWMMLAGERHERLAQIAELVDGYNEFHDFDPRQLPLLEGLRSLRLMHYSAWLA
FT                   RRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF"
FT   gene            complement(611019..611777)
FT                   /locus_tag="PSPA7_0590"
FT   CDS_pept        complement(611019..611777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0590"
FT                   /product="putative molybdenum transport regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03459; match to
FT                   protein family HMM TIGR00637; match to protein family HMM
FT                   TIGR00638"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82245"
FT                   /db_xref="GOA:A6UYV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV0"
FT                   /protein_id="ABR82245.1"
FT                   /translation="MSALSTLAQHVTRRPQRIALLAQIAELGSITRAAKAVGISYKGAW
FT                   DAIDELNNLADRPLVERSVGGKGGGGARLTAEGERLLALYRRLEALQAQVLQAAEDAED
FT                   LNLIGRLMLRTSARNQLHGRVLSIHGEGFHDRIAIELPGQQRIEALITRTSTEQLELGR
FT                   GRPVLALIKAGWLEVDLEPRDDQPNQLHGTLEEILAAKAGPSEVRIGLGSGLTLCALLS
FT                   GERLASLGLKKGRKVVVSVDPAQVLLGTPL"
FT   gene            complement(611845..612165)
FT                   /locus_tag="PSPA7_0591"
FT   CDS_pept        complement(611845..612165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0591"
FT                   /product="lipoprotein, putative"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81865"
FT                   /db_xref="InterPro:IPR017028"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV1"
FT                   /protein_id="ABR81865.1"
FT                   /translation="MRALLVAACLSLGGCSHFAEDDWLGQDKALHFASSAALAAAGMQA
FT                   AHERGLRGGRQARFGLSFSLAFGIGKELHDSRAAGSGWSWKDLAWDVAGSAAGYSLYRA
FT                   AD"
FT   gene            complement(612207..612932)
FT                   /locus_tag="PSPA7_0592"
FT   CDS_pept        complement(612207..612932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0592"
FT                   /product="putative phosphoribosyl transferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81490"
FT                   /db_xref="GOA:A6UYV2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV2"
FT                   /protein_id="ABR81490.1"
FT                   /translation="MSLPLQYLPRWLAPAPACLLCAARSDQPPRPLCRACATELPWSRR
FT                   QCRRCALPLPLDGQLCGECLRRPPAYEQVIAPWRYAFPLDSLINRFKHQAAWPLGRLLG
FT                   ELLAEHLRQRYAEGLPRPVRLLPVPLAPRRERRRGFNQARLLADWLAGELRLRCAPHLL
FT                   RRVLDTPAQQGLDAALRRRNLRHAFALAPGKEVRGLHLALVDDVLTTGATAECLARLLR
FT                   RAGAARVDVYCLARTPKPG"
FT   gene            complement(613071..613364)
FT                   /locus_tag="PSPA7_0593"
FT   CDS_pept        complement(613071..613364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0593"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83115"
FT                   /db_xref="GOA:A6UYV3"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV3"
FT                   /protein_id="ABR83115.1"
FT                   /translation="MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWSAMDDFLHGLAR
FT                   AIGMDASLFSFVFLVLGLLLLYSGIRAFMRRSIIGGIIWTVLGLIVMSWLIH"
FT   gene            complement(613418..614335)
FT                   /locus_tag="PSPA7_0594"
FT   CDS_pept        complement(613418..614335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0594"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00126; match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85341"
FT                   /db_xref="GOA:A6UYV4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV4"
FT                   /protein_id="ABR85341.1"
FT                   /translation="MALTLRQVRYFIATAEFGQISQAAVHLNISQSAVTSAIQELEAML
FT                   GVALFTRTAQGMNLTDSGRHFLNHAYSIQRSVDDALASPLPDTRVGGSLKVAASYTVMG
FT                   YFLPHHLQRLAQWYPELRLQLFEDERASIERGLLDGRYDIAVLLTGNLTDPGIAAETLF
FT                   NSERRLWLPSRHPLGEKANLGLADVAGEPYIMLTVDEAGQSALRYWERSGHRPRVILHT
FT                   SSVEAVRSMVANGSGVAILSDLVYRPWSLEGKRIETLSLVDPVPSMSVGLAWRRDAEPS
FT                   AGMRALRENFRQSFLAPQQSSSRR"
FT   gene            614464..615222
FT                   /locus_tag="PSPA7_0595"
FT   CDS_pept        614464..615222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0595"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85183"
FT                   /db_xref="GOA:A6UYV5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV5"
FT                   /protein_id="ABR85183.1"
FT                   /translation="MTEVDLNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDP
FT                   SSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIQAPAIELVNDMLYQLGALREFARLE
FT                   GLALQHVKPHGALYMHLARDEAAARLFVETLQRLEPELLLYCMPGSATWRIGRELGQPL
FT                   VREFYADRDYDRSGSIVFTRRVAALDPRQVADKVLRACREGKVRTVEGEDLDIAFDSVC
FT                   IHSDTPGALELVAGTRAHLEAAGIRIKAPR"
FT   gene            615287..615535
FT                   /locus_tag="PSPA7_0596"
FT   CDS_pept        615287..615535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0596"
FT                   /product="putative biotin-requiring enzyme"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00364"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85822"
FT                   /db_xref="GOA:A6UYV6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV6"
FT                   /protein_id="ABR85822.1"
FT                   /translation="MAEHNVQSPLPGTFYRKASPDAPPYAEVGQAVEAGSVIGLIEVMK
FT                   QFSEVQAGQAGVLQAFRVADGEAIEPGQVLAVIASAE"
FT   gene            615546..616919
FT                   /locus_tag="PSPA7_0597"
FT   CDS_pept        615546..616919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0597"
FT                   /product="putative acyl-CoA carboxylase subunit"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00289; match to protein family HMM PF02785; match to
FT                   protein family HMM PF02786"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84941"
FT                   /db_xref="GOA:A6UYV7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV7"
FT                   /protein_id="ABR84941.1"
FT                   /translation="MHKRLNKLLVANRGEIAVRIVRAAQALGIPTVAVCSEADRDSLAA
FT                   RLADEVRLIGPARADQSYLDSEAILAAARETGADSIHPGYGFLSENPAFAEAVQAAGLV
FT                   FVGPDAQTIRRMGDKAEARRTAMAAGVPVVPGSPGELDDLDAALACAEEVGYPLLVKAS
FT                   AGGGGRGIRIARDADELRREFPIAQREAQAAFGSPAVYLERFIRQARHIEVQILGDGER
FT                   VVHLFERECSLQRRRQKVFEEAPSAALDGAQRQALCESAVRLAQSLGYRGAGTLEYLFD
FT                   AHSGEFFFIEMNTRIQVEHPVSEMVTGIDLVQAMLRIAAGEALPWRQEEIRLNGAALEM
FT                   RINAEDPARNFFPSPGTVERLAWPKGEGVRVDSHLYPGYRVPPYYDSLLAKLIVHGRDR
FT                   SEAFTRARQALERTELAGMATTLPLHRWLLADARVQAAQFDTGTLETWLAERAVALET"
FT   gene            616921..617799
FT                   /locus_tag="PSPA7_0598"
FT   CDS_pept        616921..617799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0598"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83865"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV8"
FT                   /protein_id="ABR83865.1"
FT                   /translation="MHANIRYSFGGDEHLFAEVAESMSLEAFFRGMAISRAIESLQLPG
FT                   VLDVCLANASFQVRFDPDRLAPQALLETVRGLEAEAVAARSIETRIVEVPVLYNDPWTH
FT                   ETLMRFRDRHQDPTSTDLEYAARINGYADVQAFIQAHSGTPWFVSMVGFVAGLPFMYQM
FT                   VERERQLQVPKYLRPRIDTPKLTLGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDPRQGL
FT                   PYLAESMVFFRAGDIVQFRPIERTEYERMAAEVEAGTFDLRIRPVSFDLDAFLADPRGC
FT                   TQRLQEVLYVD"
FT   gene            617789..618766
FT                   /locus_tag="PSPA7_0599"
FT   CDS_pept        617789..618766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0599"
FT                   /product="biotin-dependent carboxylase domain protein"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF02626; match to protein family HMM TIGR00724"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABR80769"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYV9"
FT                   /protein_id="ABR80769.1"
FT                   /translation="MSIKVLKPGLASSVQDAGREGYYHLGIPPSGALDQYALRVANRLV
FT                   GNSADAAVLEFALMGPQLEFQRDALVAVSGARMQPRLDGQDMPLDTSFRVRAGQVLEFG
FT                   YPTAGARGYLAVAGGIDVPLVLGSRSTYGLGAIGGYLGRRLQTDDLLPLGEPQAQAREG
FT                   LALPPSLGLALEKEVILRVVPGLYYHRLTAEAAERFFADTWTVGSEADRTGYRYKGGQP
FT                   LAFEPREQPFGAGSDPSNIVDACYPIGSIQVPGGLEPIVLHRDAVSGGGYAMIGTVISA
FT                   DLDLIGQLQPNNRARFVAVTLEQAMQARAQYRQRLRRLELMGQG"
FT   gene            618955..620013
FT                   /gene="bioB"
FT                   /locus_tag="PSPA7_0600"
FT   CDS_pept        618955..620013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="PSPA7_0600"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF04055; match to protein family HMM PF06968; match to
FT                   protein family HMM TIGR00433"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84409"
FT                   /db_xref="GOA:A6UYW0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYW0"
FT                   /protein_id="ABR84409.1"
FT                   /translation="MSASAAVATRHDWSLAEVRALFEQPFNDLLFQAQTVHRAYFDPNR
FT                   VQVSTLLSIKTGACPEDCKYCPQSGHYNTGLDKEKLMEVQKVLEAAAEAKAIGSTRFCM
FT                   GAAWKHPSAKDMPYVLEMVKGVKRLGLETCMTLGRLTQEQTQALADAGLDYYNHNLDTS
FT                   PEFYGNIITTRTYGERLQTLAYVREAGMKICSGGILGMGESVDDRAGLLIQLANLPEHP
FT                   ESVPINMLVKVKGTPLAEEKDVDPFDFIRTLAVARIMMPKSHVRLSAGREQMNEQMQAL
FT                   AFMAGANSIFYGEKLLTTKNPQAEKDMQLFARLGIKPEEREEHADEVHQAAIEQALVEQ
FT                   RDSQLFYNAASA"
FT   gene            620119..621324
FT                   /gene="bioF"
FT                   /locus_tag="PSPA7_0601"
FT   CDS_pept        620119..621324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="PSPA7_0601"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF00155; match to protein family HMM PF00202; match to
FT                   protein family HMM TIGR00858"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81961"
FT                   /db_xref="GOA:A6UYW1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYW1"
FT                   /protein_id="ABR81961.1"
FT                   /translation="MSFDLASRLAARRAEDLYRQRPLLQSAQGPDVVVDGQPLLAFCSN
FT                   DYLGLASHPEVIAALRAGAERWGVGGGASHLVVGHSGPHHELELALAEFTGRPRALLFS
FT                   TGYMANLGAVTALVGKGDTVLEDRLNHASLLDAGLLSGARFSRYLHNDPASLAARLDKA
FT                   EGNTLVVTDGVFSMDGNLADLPALAAVAQARGAWLMVDDAHGFGPLGAAGGGIVEHFGL
FT                   GQEQVPVLIGTLGKGFGTAGAFVAGSEELIETLVQYARPYIYTTSQPPAVACATLKSLE
FT                   LLRRESWRREHLAALIARFRRGAEALGLTLMDSFTPIQPILVGGSRQAVALADMLRARG
FT                   IMVGAIRPPTVPANSARLRVTLSAAHSEAQVDRLLEALGESWRQLSSSLLAEIEAEEGD
FT                   DA"
FT   gene            621317..622039
FT                   /locus_tag="PSPA7_0602"
FT   CDS_pept        621317..622039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0602"
FT                   /product="putative biotin biosynthesis protein bioH"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84489"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYW2"
FT                   /protein_id="ABR84489.1"
FT                   /translation="MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLADA
FT                   ADWLDELDDNLPRDSWLAGWSLGGMLASELAARRGDDCRGLLTLASNPCFRVREDWPNA
FT                   MPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVALPQLEREALVAGLQ
FT                   LLGQLDTRAALENFRGPQLHLFAGADALVPVAAAEALLEWLPDVEVATLAASHGLPLEC
FT                   PDEVAGAILRFLREGDDA"
FT   gene            622032..622856
FT                   /locus_tag="PSPA7_0603"
FT   CDS_pept        622032..622856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0603"
FT                   /product="putative biotin synthesis protein BioC"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF01209; match to protein family HMM PF08241; match to
FT                   protein family HMM PF08242; match to protein family HMM
FT                   TIGR02072"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83383"
FT                   /db_xref="GOA:A6UYW3"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYW3"
FT                   /protein_id="ABR83383.1"
FT                   /translation="MPDLSAPLLAPHGVAALPDKRQVAASFSRAAASYDAVAELQRGVG
FT                   ESLLAALPEGFAPRRWVDLGCGTGYFSRALAQRFGGGEGLAVDIAEGMLRHARARGGAS
FT                   HFIGGDAERLPLRDGSCDLLFSSLAIQWCADLPAVLAEARRVLRPGGVLAFSSLCVGTL
FT                   GELRDSWRVVDGFVHVNRFRAFADYLQHAAGSGLLPLVLRHEDRVLHFPDLRSLTHELK
FT                   ALGAHNLNPGRPDGLTGRQRIRALVAAYERFRQPGGLPATYRVVFGVLRKDS"
FT   gene            622860..623546
FT                   /gene="bioD"
FT                   /locus_tag="PSPA7_0604"
FT   CDS_pept        622860..623546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="PSPA7_0604"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="Annotation was generated automatically without
FT                   manual curation; identified by match to protein family HMM
FT                   PF01656; match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83056"
FT                   /db_xref="GOA:A6UYW4"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6UYW4"
FT                   /protein_id="ABR83056.1"
FT                   /translation="MPAFFVTGTDTEIGKTTIAAGLLHAARSAGLSTAAAKPVASGCEA
FT                   TAQGLRNGDALALLGECSLALAYEQVNPLAFEPAIAPHLAAREAGVELSAARLHDAVRE
FT                   VLALRADFTLVEGAGGWRVPLQGRENLSDLARLLGLPVVLVVGVRLGCINHALLSAEAI
FT                   LGDGLALAGWVANIVDPATSRLEENLATLAERLPAPCLGRVPRLADAGPAAVAAHLDLR
FT                   PLGIGL"
FT   gene            623656..623886
FT                   /locus_tag="PSPA7_0605"
FT   CDS_pept        623656..623886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0605"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85300"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYW5"
FT                   /protein_id="ABR85300.1"
FT                   /translation="MEISGNAFVSGLNTLQSGSARVAQAGSEIARNAVEARSPQAEQML
FT                   ELTRGKLEAQSGARVIEVADETLGTLIDTHA"
FT   gene            624224..626029
FT                   /locus_tag="PSPA7_0606"
FT   CDS_pept        624224..626029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0606"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00441; match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABR84021"
FT                   /db_xref="GOA:A6UYW6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYW6"
FT                   /protein_id="ABR84021.1"
FT                   /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGAEDATPDMVNAILEE
FT                   GAKFCEQVIAPLNRVGDLEGCTWSAEGVKTPSGFKEAYQQFVEGGWPSLAHDVEHGGQG
FT                   LPESLGLAISEMVGQANWSWGMYPGLSHGAMNTLHAHGTAEQQATYLTKLVSGEWTGTM
FT                   CLTEPHCGTDLGMLRTKAEPQADGSYKVTGTKIFISAGEHDMADNIVHIVLARLPDAPQ
FT                   GTKGISLFIVPKFLPNAEGNAGERNAVSCGSIEHKMGIHGNATCVMNFDAATGFLIGPP
FT                   NKGLNCMFTFMNTARLGTALQGLAHAEVGFQGGIAYARERLQMRSLTGPKAPEKPADPI
FT                   IVHPDVRRMLLTMKAFAEGNRAMLYFAAKQVDIVQRSQDEEQKKAADSMLAFLTPIAKA
FT                   FMTEVGFESANHGVQIYGGHGFIAEHGMEQNVRDSRISMLYEGTTGVQALDLLGRKVLM
FT                   TQGEALKGFTKIVHKFCQANEANEAVKEFVAPLAQLNKEWGDLTMKVGMAAMKDREEVG
FT                   AASVDYLMYSGYACLAYFWADMARLAAEKLAAGTGEEAFYKAKLQTARFYFQRILPRTR
FT                   AHVAAMLSGANNLMEMAEEDFALGY"
FT   gene            626242..628038
FT                   /locus_tag="PSPA7_0607"
FT   CDS_pept        626242..628038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0607"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00441; match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81002"
FT                   /db_xref="GOA:A6UYW7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYW7"
FT                   /protein_id="ABR81002.1"
FT                   /translation="MPEYKAPLRDVRFLIDDVFDFHGHYQALGASDATPDMVAAILEEG
FT                   SKFCEQVLAPLNRSGDEEGCHFDNGAVTTPKGFKEAYAQYVEGGWNGVASDPAYGGQGL
FT                   PHSLGLLLSEMIGASNVSWGMYPGLTRGAMSAIHAHGSQAQKDTYLPRMTAGTWTGTMC
FT                   LTEPHCGTDLGIIKTRAVPNADGSHSISGTKIFISAGEHDLSENIVHLVLAKLPDAPAG
FT                   TKGISLFIVPKFLPDAEGNVGARNAVSCGSIEHKMGIKASATCVMNFDGATGYLIGEPN
FT                   KGLHCMFTMMNHARLGTGMQGLCLGETSYQGAVRYARERLQMRSLSGPKAPDKPADPII
FT                   VHPDVRRMLLTMKAFNEGNRALAYFTAQLLDTEHLSQDAAERERAADLLAFLTPICKAF
FT                   MTETGQEVTNLGMQVYGGHGYIREWGMEQLVRDCRIAQIYEGTNGIQALDLLGRKVLGS
FT                   QGKLLRGFTKLVHQLCQAQAGHPQLKGQVAQLAALNAQWGELTQQVGLAAMKNADEVGA
FT                   ASVDYLMFSGYVTLAYFWLRIALVAREKLDAGSGEAAFHEAKLATADFYFSRLLPRTAA
FT                   HAAAIQAGAAGLMSLSAEQFSL"
FT   gene            628310..630088
FT                   /locus_tag="PSPA7_0609"
FT   CDS_pept        628310..630088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0609"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00441; match to protein family HMM PF02770"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82560"
FT                   /db_xref="GOA:A6UYW9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYW9"
FT                   /protein_id="ABR82560.1"
FT                   /translation="MADYKAPLRDMRFVLNEVFEVSRLWTQLPALADVVDAETAAAILE
FT                   EAGKVTAGTIAPLNRPGDEEGCQWNAGAVSTPAGFPEAYRTYAEGGWVGVGGDPAYGGM
FT                   GMPKVISAQVEELVNSANLSFGLYPMLTAGACLALNAHASDELKDKYLPNMYAGTWAGS
FT                   MCLTEPHAGTDLGIIRTRAEPQADGSYKISGTKIFITGGEHDLTENIIHLVLAKLPDAP
FT                   AGPKGISLFLVPKVLVNADGSLGERNSLGCGSIEHKMGIKASATCVMNFDGATGWLVGE
FT                   VNKGLAAMFTMMNYERLGVGIQGLATGERSYQSAIEYARERIQSRAPTGPVAKDKAADP
FT                   IIVHPDVRRMLLTMKALNEGGRAFSSYVAMQLDTAKYSEDAVTRKRAEELVALLTPVAK
FT                   AFLTDMGLETTLHGQQIFGGHGFIREWGQEQLVRDCRITQIYEGTNGIQALDLVGRKVI
FT                   GSGGAFSRHFTDEIKAFVASADETLGEFSKPLAAAVENLEELTAWLLDRAKGNPNEIGA
FT                   ASVEYLHVFGYTAYAYMWALMARTALAKQGEDDFYASKLGTARFYFARLLPRIHSLSAS
FT                   VRAGSESLYLLDAEQF"
FT   gene            complement(630333..631814)
FT                   /gene="nirN"
FT                   /locus_tag="PSPA7_0610"
FT   CDS_pept        complement(630333..631814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirN"
FT                   /locus_tag="PSPA7_0610"
FT                   /product="putative c-type cytochrome"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02239"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABR82389"
FT                   /db_xref="GOA:A6UYX0"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX0"
FT                   /protein_id="ABR82389.1"
FT                   /translation="MRLTGLALGLLLLPLAQAAEPRGEALYRQHCQACHGAERLGGSGP
FT                   TLLPESLSRLKPAQAREVILHGRPATQMAGFAGQLDETGADALVAYLYQAPSHAPRWSA
FT                   EDIRASRVQPHPLATLPAAPRFQADPLNLFVVVESGDHHVSILDGDRFAPIARFPSRYA
FT                   LHGGPKFSPDGRLVYFASRDGWVTLYDLYNLEVVAEVRAGLNTRNLAVSDDGRWVLVGN
FT                   YLPGNLVLLDARDLSLVAVLPAADAQGQPSRVSAVYTAPPRHSFVVALKDVHELWELPY
FT                   ANGKPVAPKRLAVADYLDDFSFSPDYRYLLGSSRQARGGEVIELDSGARVASIPLSGMP
FT                   HLGSGIYWKRDGRWVFATPNISRGVISVIDLQNWKPLKEIATDGPGFFMRSHADSPYAW
FT                   TDTFLGKKHDEILLIDKQTLEIAHRLRPSPGKVAGHVEFTRDGRYALLSVWDRDGALVV
FT                   YDAHSLEEVKRLPMNKPSGKYNVGNKIGYAEGTSH"
FT   gene            complement(631805..632644)
FT                   /locus_tag="PSPA7_0611"
FT   CDS_pept        complement(631805..632644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0611"
FT                   /product="putative uroporphyrin-III c-methyltransferase"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00590; match to protein family HMM TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86241"
FT                   /db_xref="GOA:A6UYX1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX1"
FT                   /protein_id="ABR86241.1"
FT                   /translation="MNTTVIPPSLVEVDFPAGSVALVGAGPGDPGLLTLRAWALLQQAE
FT                   VVVYDRLVARELVALLPESCQRIYVGKRCGHHSLPQEEINELLVRLARQQRRVVRLKGG
FT                   DPFIFGRGAEELERLLEAGVDCQVVPGVTAASGCSTYAGIPLTHRDLAQSCTFVTGHLQ
FT                   NDGHLDLDWTGLARGRQTLVFYMGLGNLAEIAARLVEHGLPGDNPAALVSQGTQARQQV
FT                   TRGPLAELPALARRYQLQPPTLIVVGQVVGLFAEREMPRPSCLNAAPASSGEASACA"
FT   gene            complement(632655..633818)
FT                   /gene="nirJ"
FT                   /locus_tag="PSPA7_0612"
FT   CDS_pept        complement(632655..633818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirJ"
FT                   /locus_tag="PSPA7_0612"
FT                   /product="heme d1 biosynthesis protein NirJ"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85804"
FT                   /db_xref="GOA:A6UYX2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023992"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX2"
FT                   /protein_id="ABR85804.1"
FT                   /translation="MLRISHYLRSLAGDAPAPRRAGGRRAPVVIWNLLRRCNLTCKHCY
FT                   STSADSDFRGELETAEILRGIDDLRTAGVRVLILSGGEPLMHPDLFEIAAHARQAGMFV
FT                   ALSSNGTLIDEGNIQRVAEARFDYVGISLDGLRETHDRFRQKQGSFDAALAAMRLCREA
FT                   DIRVGMRTTLTEENATQLPALLDLMRELDVQKFYLSHLNYSGRGRRSRALDAHHRRTRE
FT                   ALALLFERADEDIRQGRDSDFVTGNNDADAILLLDWVRRRRPQRLARLCELLLDWGGNA
FT                   SGEGIANIDNTGEVHPDSYWWHHSVGNIRRQRFADFWFEHPDPLLLQLRQHPRPVGGRC
FT                   TQCRWLDICNGNTRTRAWASGDLWGEDPGCYLSDQEIGLERIALHAV"
FT   gene            complement(633812..634327)
FT                   /locus_tag="PSPA7_0613"
FT   CDS_pept        complement(633812..634327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0613"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABR86038"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX3"
FT                   /protein_id="ABR86038.1"
FT                   /translation="MSACISPSDALLARRLVELTQAGLPLVADPWAWIAAQLQLSETET
FT                   LALLRRLRDAGVIRRIAAVPNHYRLGYRHNGMTVWDVADERIERLGRLVGGLSFVSHCY
FT                   RRPRRLPQWRYNLFAMVHGRSEAQIEGYRQQIRLLLGEDCRADEMLVSSRILKKTGLRL
FT                   AQKEERPC"
FT   gene            complement(634302..634745)
FT                   /locus_tag="PSPA7_0614"
FT   CDS_pept        complement(634302..634745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0614"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81787"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX4"
FT                   /protein_id="ABR81787.1"
FT                   /translation="MDEFDRRLLNRLQHGLPLEPHPYALLAGELDCREEDILRRLDDLL
FT                   DDGTLTRFGPLFDIEPLGGAFTLAAMSVPEARFEELAALLAGWPQVAHNYRREHALNMW
FT                   FVVACDSPAEVAETLARLERESGLAVLDLPKEATYHVGLHFPL"
FT   gene            complement(634738..635262)
FT                   /gene="nirL"
FT                   /locus_tag="PSPA7_0615"
FT   CDS_pept        complement(634738..635262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirL"
FT                   /locus_tag="PSPA7_0615"
FT                   /product="heme d1 biosynthesis protein NirL"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83242"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX5"
FT                   /protein_id="ABR83242.1"
FT                   /translation="MKPVEPLAAPQRQHLRYLLEQGLPLASRPYRVLAERIGAGEDEVL
FT                   EQVRRWDEDGLFRRFGVILHHRALGYTANAMLVLDVADAEVDAVGRALAHESIVSLCYR
FT                   RPRRLPMWPYNLFCMIHGRERCEVERQIAALLERHDLRQAPHRWLFSLRAYKQCGGRYT
FT                   APPSGLERRHG"
FT   gene            complement(635259..635711)
FT                   /locus_tag="PSPA7_0616"
FT   CDS_pept        complement(635259..635711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0616"
FT                   /product="putative transcriptional regulator"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81337"
FT                   /db_xref="GOA:A6UYX6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX6"
FT                   /protein_id="ABR81337.1"
FT                   /translation="MDDLSRRLLARYQKGLPICAEPYRRMAETLGCSEAEVLERLRRLE
FT                   ADGALSRVGPVLRHQRAGASTLAALAVPEERLQRVAERISQYAEVNHNYQREHHYNLWF
FT                   VLTAGDRAQLDRVLAEIAADTGLQPLDLPMQEAYCIDLAFPLEASR"
FT   gene            complement(635720..636898)
FT                   /gene="nirF"
FT                   /locus_tag="PSPA7_0617"
FT   CDS_pept        complement(635720..636898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="PSPA7_0617"
FT                   /product="heme d1 biosynthesis protein NirF"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF02239"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85246"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX7"
FT                   /protein_id="ABR85246.1"
FT                   /translation="MNLRPLAPLFLALLAGCSQQPPLRGSGDLGVLIERADGSVQILDG
FT                   TAKTSLARVEGLGDLSHASLVFSRDQRYAYVFGRDGGLTRLDLLAQRIDKRLIQGGNSI
FT                   GGAISQDGRLVAVSNYEPGGVKVFDSRTLELVAEIPATRLPGQDRNSRVVGLVDAPGQR
FT                   FVFSLFDSGEIWIADFSQGDTPRLTRFRDVGKQPYDALISPDGRYYMAGLFGEDGMAQL
FT                   DLWHPERGVRRVLGDYGRGQRKLPVYKMPHLEGWTIASDQAFVPAVGHHQVLVLDARDW
FT                   KQTDAIDVAGQPVFVMTRPDDRQIWVNFAYPDNDKVQVIDSETHEVIETLRPGPGVLHM
FT                   EFSGRGDQVWISVRDADQVQVWDPYRLERIGSLPARSPSGIFFSHRAQHIGL"
FT   gene            complement(636895..637254)
FT                   /gene="nirC"
FT                   /locus_tag="PSPA7_0618"
FT   CDS_pept        complement(636895..637254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirC"
FT                   /locus_tag="PSPA7_0618"
FT                   /product="putative c-type cytochrome precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85749"
FT                   /db_xref="GOA:A6UYX8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX8"
FT                   /protein_id="ABR85749.1"
FT                   /translation="MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLRH
FT                   LLLQDCGSCHGLRLTGGLGPALTPEALRGKPREPLVATVLMGRPQTPMPPWAGLLSEDD
FT                   AGWLVDRLIEGEIAP"
FT   gene            complement(637251..637565)
FT                   /gene="nirM"
FT                   /locus_tag="PSPA7_0619"
FT   CDS_pept        complement(637251..637565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirM"
FT                   /locus_tag="PSPA7_0619"
FT                   /product="cytochrome c-551 precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83995"
FT                   /db_xref="GOA:A6UYX9"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYX9"
FT                   /protein_id="ABR83995.1"
FT                   /translation="MKPYALLSLLATGTLLAQGAWAEAPEVLFKNKGCVACHAIDTKMV
FT                   GPAYKDVAAKFAGQAGAEAELAQRIKNGSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK
FT                   "
FT   gene            complement(637616..639322)
FT                   /gene="nirS"
FT                   /locus_tag="PSPA7_0620"
FT   CDS_pept        complement(637616..639322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirS"
FT                   /locus_tag="PSPA7_0620"
FT                   /product="nitrite reductase precursor"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00034; match to protein family HMM PF02239"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABR85960"
FT                   /db_xref="GOA:A6UYY0"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYY0"
FT                   /protein_id="ABR85960.1"
FT                   /translation="MPFGKPLAGTLLASLTLLGLATAHAKDDMQAAAQYQGAASAVDPA
FT                   HVVRTNGAPDMSESEFNEAKQIYFQRCAGCHGVLRKGATGKPLTPDITQQRGQQYLEAL
FT                   ITYGTPLGMPNWGSSGELSKEQITLMAKYIQHTPPQPPEWGMPEMRESWKVLVKPEDRP
FT                   KKQLNDLDLPNLFSVTLRDAGQIALVDGDSKKIVKVIDTGYAVHISRMSASGRYLLVIG
FT                   RDARIDMIDLWAKEPTKVAEIKIGIEARSVESSKFKGYEDRYTIAGAYWPPQFAIMDGE
FT                   TLEPKQIVSTRGMTVDTQTYHPEPRVAAIIASHEHPEFIVNVKETGKVLLVNYKDIDNL
FT                   TITSIGAAPFLHDGGWDSSHRYFMTAANNSNKVAVIDSRDRRLSALVDVGKTPHPGRGA
FT                   NFVHPKYGPVWSTSHLGDGSISLIGTDPKNHPQYAWKKVAELQGQGGGSLFIKTHPKSS
FT                   HLYVDTTFNPDARISQSVAVFDLKNLDAKYQVLPIAEWADLGEGAKRVVQPEYNKRGDE
FT                   VWFSVWNGKNDSSALVVVDDKTLKLKAVVKDPRLITPTGKFNVYNTQHDVY"
FT   gene            639538..640320
FT                   /gene="nirQ"
FT                   /locus_tag="PSPA7_0621"
FT   CDS_pept        639538..640320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirQ"
FT                   /locus_tag="PSPA7_0621"
FT                   /product="regulatory protein NirQ"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF07728; match to protein family HMM PF08406"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81544"
FT                   /db_xref="GOA:A6UYY1"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYY1"
FT                   /protein_id="ABR81544.1"
FT                   /translation="MRDAIPFYEATGHEIDVFERAWRHGLPVLLKGPTGCGKTRFVQHM
FT                   ARRLELPLYSVACHDDLGAADLLGRHLIGADGTWWQDGPLTRAVREGGICYLDEVVEAR
FT                   QDTTVAIHPLADDRRELYLERTGETLQAPPSFMLVVSYNPGYQNLLKGLKPSTRQRFVA
FT                   LRFDYPAAQQEARILVGESGCAEVLAQRLVQLGQALRRLEQHDLEEVASTRLLIFAARL
FT                   IGDGMDPREACRVALAEPLSDDPATVAALMDIVDLHVG"
FT   gene            640310..640882
FT                   /locus_tag="PSPA7_0622"
FT   CDS_pept        640310..640882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0622"
FT                   /product="putative cytochrome c oxidase subunit"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00510"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81066"
FT                   /db_xref="GOA:A6UYY2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYY2"
FT                   /protein_id="ABR81066.1"
FT                   /translation="MSADTVERRLPGDLAMWFFILAELSVFSLLLLAFAGAQAWQPELF
FT                   RAGRGQLDSRWGLMLTVALLSSGWLAALAVHAVRRGRPRQASGWLLAALLLALVYVGLK
FT                   LHEYGRLADLGLDIEHDTFFTLYWCLTGFHFLHVLLGLLILGWLAQACWRRRHTPQACS
FT                   GLESGVLYWHMVDLVWVLLFPLVYVLQ"
FT   gene            640890..641147
FT                   /locus_tag="PSPA7_0623"
FT   CDS_pept        640890..641147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSPA7_0623"
FT                   /product="hypothetical protein"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABR83962"
FT                   /db_xref="GOA:A6UYY3"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYY3"
FT                   /protein_id="ABR83962.1"
FT                   /translation="MRTLTLCWLALLALAVAGVLLGGAGDSPWLLAAVLACAVAKGWLI
FT                   GERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN"
FT   gene            641237..641677
FT                   /gene="norC"
FT                   /locus_tag="PSPA7_0624"
FT   CDS_pept        641237..641677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="PSPA7_0624"
FT                   /product="nitric-oxide reductase subunit C"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81306"
FT                   /db_xref="GOA:A6UYY4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYY4"
FT                   /protein_id="ABR81306.1"
FT                   /translation="MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAM
FT                   SEAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPL
FT                   NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG"
FT   gene            641677..643074
FT                   /gene="norB"
FT                   /locus_tag="PSPA7_0625"
FT   CDS_pept        641677..643074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PSPA7_0625"
FT                   /product="nitric-oxide reductase subunit B"
FT                   /note="Annotation generated by automatically transferring
FT                   the annotation from the manually curated GenBank accession
FT                   AE004091; identified by match to protein family HMM
FT                   PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:PSPA7_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABR81731"
FT                   /db_xref="GOA:A6UYY5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A6UYY5"
FT                   /protein_id="ABR81731.1"
FT                   /translation="MMSPNGSLKFASQAVAKPYFVFALVLFVGQILFGLIMGLQYVVGD
FT                   FLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPRLAWILFWVFAAA
FT                   GVLTVLGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTVL
FT                   RGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAIL
FT                   AFVLVKITGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEP
FT                   LPFFAMVLFAFNTINRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTHG
FT                   TQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMVF
FT                   ITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLSF
FT                   RRGKAAA"
FT   gene            643076..644914
FT                   /locus_tag="PSPA7_0626"
FT   CDS_