(data stored in ACNUC10043 zone)

EMBL: CP000745

ID   CP000745; SV 1; circular; genomic DNA; STD; PRO; 1772694 BP.
XX
AC   CP000745; AAZM01000000-AAZM01000006;
XX
PR   Project:PRJNA18819;
XX
DT   30-JUN-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Methanococcus maripaludis C7, complete genome.
XX
KW   .
XX
OS   Methanococcus maripaludis C7
OC   Archaea; Euryarchaeota; Methanomada group; Methanococci; Methanococcales;
OC   Methanococcaceae; Methanococcus.
XX
RN   [1]
RP   1-1772694
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Clum A., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Anderson I., Sieprawska-Lupa M., Whitman W.B., Richardson P.;
RT   "Complete sequence of Methanococcus maripaludis C7";
RL   Unpublished.
XX
RN   [2]
RP   1-1772694
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Clum A., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Anderson I., Sieprawska-Lupa M., Whitman W.B., Richardson P.;
RT   ;
RL   Submitted (25-JUN-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1baf21e3cbd9012980aa589744281354.
DR   BioSample; SAMN00000031.
DR   EnsemblGenomes-Gn; EBG00001111658.
DR   EnsemblGenomes-Gn; EBG00001111659.
DR   EnsemblGenomes-Gn; EBG00001111660.
DR   EnsemblGenomes-Gn; EBG00001111661.
DR   EnsemblGenomes-Gn; EBG00001111662.
DR   EnsemblGenomes-Gn; EBG00001111663.
DR   EnsemblGenomes-Gn; EBG00001111664.
DR   EnsemblGenomes-Gn; EBG00001111665.
DR   EnsemblGenomes-Gn; EBG00001111666.
DR   EnsemblGenomes-Gn; EBG00001111667.
DR   EnsemblGenomes-Gn; EBG00001111668.
DR   EnsemblGenomes-Gn; EBG00001111669.
DR   EnsemblGenomes-Gn; EBG00001111670.
DR   EnsemblGenomes-Gn; EBG00001111671.
DR   EnsemblGenomes-Gn; EBG00001111674.
DR   EnsemblGenomes-Gn; EBG00001111675.
DR   EnsemblGenomes-Gn; EBG00001111676.
DR   EnsemblGenomes-Gn; EBG00001111677.
DR   EnsemblGenomes-Gn; EBG00001111679.
DR   EnsemblGenomes-Gn; EBG00001111680.
DR   EnsemblGenomes-Gn; EBG00001111681.
DR   EnsemblGenomes-Gn; EBG00001111682.
DR   EnsemblGenomes-Gn; EBG00001111683.
DR   EnsemblGenomes-Gn; EBG00001111684.
DR   EnsemblGenomes-Gn; EBG00001111685.
DR   EnsemblGenomes-Gn; EBG00001111686.
DR   EnsemblGenomes-Gn; EBG00001111687.
DR   EnsemblGenomes-Gn; EBG00001111688.
DR   EnsemblGenomes-Gn; EBG00001111689.
DR   EnsemblGenomes-Gn; EBG00001111690.
DR   EnsemblGenomes-Gn; EBG00001111691.
DR   EnsemblGenomes-Gn; EBG00001111692.
DR   EnsemblGenomes-Gn; EBG00001111693.
DR   EnsemblGenomes-Gn; EBG00001111694.
DR   EnsemblGenomes-Gn; EBG00001111695.
DR   EnsemblGenomes-Gn; EBG00001111696.
DR   EnsemblGenomes-Gn; EBG00001111697.
DR   EnsemblGenomes-Gn; EBG00001111698.
DR   EnsemblGenomes-Gn; EBG00001111699.
DR   EnsemblGenomes-Gn; EBG00001111700.
DR   EnsemblGenomes-Gn; EBG00001111701.
DR   EnsemblGenomes-Gn; EBG00001111702.
DR   EnsemblGenomes-Gn; EBG00001111703.
DR   EnsemblGenomes-Gn; EBG00001111704.
DR   EnsemblGenomes-Gn; EBG00001111705.
DR   EnsemblGenomes-Gn; EBG00001111706.
DR   EnsemblGenomes-Gn; EBG00001111707.
DR   EnsemblGenomes-Gn; EBG00001111708.
DR   EnsemblGenomes-Gn; EBG00001111709.
DR   EnsemblGenomes-Gn; EBG00001111710.
DR   EnsemblGenomes-Gn; EBG00001111711.
DR   EnsemblGenomes-Gn; EBG00001111712.
DR   EnsemblGenomes-Gn; EBG00001111713.
DR   EnsemblGenomes-Gn; EBG00001111714.
DR   EnsemblGenomes-Gn; EBG00001111715.
DR   EnsemblGenomes-Gn; EBG00001111716.
DR   EnsemblGenomes-Gn; EBG00001111717.
DR   EnsemblGenomes-Gn; EBG00001111718.
DR   EnsemblGenomes-Gn; EBG00001111719.
DR   EnsemblGenomes-Gn; EBG00001111720.
DR   EnsemblGenomes-Gn; EBG00001111721.
DR   EnsemblGenomes-Gn; MmarC7_R0001.
DR   EnsemblGenomes-Gn; MmarC7_R0002.
DR   EnsemblGenomes-Gn; MmarC7_R0003.
DR   EnsemblGenomes-Gn; MmarC7_R0004.
DR   EnsemblGenomes-Gn; MmarC7_R0005.
DR   EnsemblGenomes-Gn; MmarC7_R0006.
DR   EnsemblGenomes-Gn; MmarC7_R0007.
DR   EnsemblGenomes-Gn; MmarC7_R0008.
DR   EnsemblGenomes-Gn; MmarC7_R0009.
DR   EnsemblGenomes-Gn; MmarC7_R0011.
DR   EnsemblGenomes-Gn; MmarC7_R0012.
DR   EnsemblGenomes-Gn; MmarC7_R0013.
DR   EnsemblGenomes-Gn; MmarC7_R0014.
DR   EnsemblGenomes-Gn; MmarC7_R0015.
DR   EnsemblGenomes-Gn; MmarC7_R0016.
DR   EnsemblGenomes-Gn; MmarC7_R0017.
DR   EnsemblGenomes-Gn; MmarC7_R0018.
DR   EnsemblGenomes-Gn; MmarC7_R0019.
DR   EnsemblGenomes-Gn; MmarC7_R0020.
DR   EnsemblGenomes-Gn; MmarC7_R0021.
DR   EnsemblGenomes-Gn; MmarC7_R0022.
DR   EnsemblGenomes-Gn; MmarC7_R0023.
DR   EnsemblGenomes-Gn; MmarC7_R0024.
DR   EnsemblGenomes-Gn; MmarC7_R0025.
DR   EnsemblGenomes-Gn; MmarC7_R0026.
DR   EnsemblGenomes-Gn; MmarC7_R0027.
DR   EnsemblGenomes-Gn; MmarC7_R0028.
DR   EnsemblGenomes-Gn; MmarC7_R0029.
DR   EnsemblGenomes-Gn; MmarC7_R0030.
DR   EnsemblGenomes-Gn; MmarC7_R0031.
DR   EnsemblGenomes-Gn; MmarC7_R0032.
DR   EnsemblGenomes-Gn; MmarC7_R0033.
DR   EnsemblGenomes-Gn; MmarC7_R0034.
DR   EnsemblGenomes-Gn; MmarC7_R0035.
DR   EnsemblGenomes-Gn; MmarC7_R0036.
DR   EnsemblGenomes-Gn; MmarC7_R0037.
DR   EnsemblGenomes-Gn; MmarC7_R0038.
DR   EnsemblGenomes-Gn; MmarC7_R0039.
DR   EnsemblGenomes-Gn; MmarC7_R0040.
DR   EnsemblGenomes-Gn; MmarC7_R0041.
DR   EnsemblGenomes-Gn; MmarC7_R0042.
DR   EnsemblGenomes-Gn; MmarC7_R0043.
DR   EnsemblGenomes-Gn; MmarC7_R0044.
DR   EnsemblGenomes-Gn; MmarC7_R0045.
DR   EnsemblGenomes-Gn; MmarC7_R0046.
DR   EnsemblGenomes-Gn; MmarC7_R0047.
DR   EnsemblGenomes-Tr; EBT00001703200.
DR   EnsemblGenomes-Tr; EBT00001703201.
DR   EnsemblGenomes-Tr; EBT00001703202.
DR   EnsemblGenomes-Tr; EBT00001703203.
DR   EnsemblGenomes-Tr; EBT00001703204.
DR   EnsemblGenomes-Tr; EBT00001703205.
DR   EnsemblGenomes-Tr; EBT00001703206.
DR   EnsemblGenomes-Tr; EBT00001703208.
DR   EnsemblGenomes-Tr; EBT00001703209.
DR   EnsemblGenomes-Tr; EBT00001703210.
DR   EnsemblGenomes-Tr; EBT00001703211.
DR   EnsemblGenomes-Tr; EBT00001703212.
DR   EnsemblGenomes-Tr; EBT00001703213.
DR   EnsemblGenomes-Tr; EBT00001703214.
DR   EnsemblGenomes-Tr; EBT00001703215.
DR   EnsemblGenomes-Tr; EBT00001703216.
DR   EnsemblGenomes-Tr; EBT00001703217.
DR   EnsemblGenomes-Tr; EBT00001703218.
DR   EnsemblGenomes-Tr; EBT00001703219.
DR   EnsemblGenomes-Tr; EBT00001703220.
DR   EnsemblGenomes-Tr; EBT00001703221.
DR   EnsemblGenomes-Tr; EBT00001703222.
DR   EnsemblGenomes-Tr; EBT00001703223.
DR   EnsemblGenomes-Tr; EBT00001703224.
DR   EnsemblGenomes-Tr; EBT00001703225.
DR   EnsemblGenomes-Tr; EBT00001703226.
DR   EnsemblGenomes-Tr; EBT00001703227.
DR   EnsemblGenomes-Tr; EBT00001703228.
DR   EnsemblGenomes-Tr; EBT00001703229.
DR   EnsemblGenomes-Tr; EBT00001703230.
DR   EnsemblGenomes-Tr; EBT00001703231.
DR   EnsemblGenomes-Tr; EBT00001703232.
DR   EnsemblGenomes-Tr; EBT00001703234.
DR   EnsemblGenomes-Tr; EBT00001703235.
DR   EnsemblGenomes-Tr; EBT00001703236.
DR   EnsemblGenomes-Tr; EBT00001703237.
DR   EnsemblGenomes-Tr; EBT00001703238.
DR   EnsemblGenomes-Tr; EBT00001703239.
DR   EnsemblGenomes-Tr; EBT00001703240.
DR   EnsemblGenomes-Tr; EBT00001703241.
DR   EnsemblGenomes-Tr; EBT00001703242.
DR   EnsemblGenomes-Tr; EBT00001703243.
DR   EnsemblGenomes-Tr; EBT00001703244.
DR   EnsemblGenomes-Tr; EBT00001703245.
DR   EnsemblGenomes-Tr; EBT00001703246.
DR   EnsemblGenomes-Tr; EBT00001703247.
DR   EnsemblGenomes-Tr; EBT00001703248.
DR   EnsemblGenomes-Tr; EBT00001703249.
DR   EnsemblGenomes-Tr; EBT00001703250.
DR   EnsemblGenomes-Tr; EBT00001703252.
DR   EnsemblGenomes-Tr; EBT00001703253.
DR   EnsemblGenomes-Tr; EBT00001703254.
DR   EnsemblGenomes-Tr; EBT00001703255.
DR   EnsemblGenomes-Tr; EBT00001703256.
DR   EnsemblGenomes-Tr; EBT00001703257.
DR   EnsemblGenomes-Tr; EBT00001703258.
DR   EnsemblGenomes-Tr; EBT00001703259.
DR   EnsemblGenomes-Tr; EBT00001703260.
DR   EnsemblGenomes-Tr; EBT00001703261.
DR   EnsemblGenomes-Tr; EBT00001703262.
DR   EnsemblGenomes-Tr; EBT00001703263.
DR   EnsemblGenomes-Tr; MmarC7_R0001-1.
DR   EnsemblGenomes-Tr; MmarC7_R0002-1.
DR   EnsemblGenomes-Tr; MmarC7_R0003-1.
DR   EnsemblGenomes-Tr; MmarC7_R0004-1.
DR   EnsemblGenomes-Tr; MmarC7_R0005-1.
DR   EnsemblGenomes-Tr; MmarC7_R0006-1.
DR   EnsemblGenomes-Tr; MmarC7_R0007-1.
DR   EnsemblGenomes-Tr; MmarC7_R0008-1.
DR   EnsemblGenomes-Tr; MmarC7_R0009-1.
DR   EnsemblGenomes-Tr; MmarC7_R0011-1.
DR   EnsemblGenomes-Tr; MmarC7_R0012-1.
DR   EnsemblGenomes-Tr; MmarC7_R0013-1.
DR   EnsemblGenomes-Tr; MmarC7_R0014-1.
DR   EnsemblGenomes-Tr; MmarC7_R0015-1.
DR   EnsemblGenomes-Tr; MmarC7_R0016-1.
DR   EnsemblGenomes-Tr; MmarC7_R0017-1.
DR   EnsemblGenomes-Tr; MmarC7_R0018-1.
DR   EnsemblGenomes-Tr; MmarC7_R0019-1.
DR   EnsemblGenomes-Tr; MmarC7_R0020-1.
DR   EnsemblGenomes-Tr; MmarC7_R0021-1.
DR   EnsemblGenomes-Tr; MmarC7_R0022-1.
DR   EnsemblGenomes-Tr; MmarC7_R0023-1.
DR   EnsemblGenomes-Tr; MmarC7_R0024-1.
DR   EnsemblGenomes-Tr; MmarC7_R0025-1.
DR   EnsemblGenomes-Tr; MmarC7_R0026-1.
DR   EnsemblGenomes-Tr; MmarC7_R0027-1.
DR   EnsemblGenomes-Tr; MmarC7_R0028-1.
DR   EnsemblGenomes-Tr; MmarC7_R0029-1.
DR   EnsemblGenomes-Tr; MmarC7_R0030-1.
DR   EnsemblGenomes-Tr; MmarC7_R0031-1.
DR   EnsemblGenomes-Tr; MmarC7_R0032-1.
DR   EnsemblGenomes-Tr; MmarC7_R0033-1.
DR   EnsemblGenomes-Tr; MmarC7_R0034-1.
DR   EnsemblGenomes-Tr; MmarC7_R0035-1.
DR   EnsemblGenomes-Tr; MmarC7_R0036-1.
DR   EnsemblGenomes-Tr; MmarC7_R0037-1.
DR   EnsemblGenomes-Tr; MmarC7_R0038-1.
DR   EnsemblGenomes-Tr; MmarC7_R0039-1.
DR   EnsemblGenomes-Tr; MmarC7_R0040-1.
DR   EnsemblGenomes-Tr; MmarC7_R0041-1.
DR   EnsemblGenomes-Tr; MmarC7_R0042-1.
DR   EnsemblGenomes-Tr; MmarC7_R0043-1.
DR   EnsemblGenomes-Tr; MmarC7_R0044-1.
DR   EnsemblGenomes-Tr; MmarC7_R0045-1.
DR   EnsemblGenomes-Tr; MmarC7_R0046-1.
DR   EnsemblGenomes-Tr; MmarC7_R0047-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01125; sR4.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01737; flpD.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000745.
DR   SILVA-SSU; CP000745.
DR   StrainInfo; 697971; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4004021
CC   Source DNA and archaea available from William B. Whitman
CC   (whitman@uga.edu)
CC   Contacts: William B. Whitman (whitman@uga.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1772694
FT                   /organism="Methanococcus maripaludis C7"
FT                   /strain="C7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:426368"
FT   gene            120..2243
FT                   /locus_tag="MmarC7_0001"
FT   CDS_pept        120..2243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0001"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65074"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF48"
FT                   /protein_id="ABR65074.1"
FT                   /translation="MVNNYRLLKEMNLDLEDDLSLIIGKNNCGKTSLLSILNKFLNNSP
FT                   NFSFDDFNIEFQDGLRDFVLQNTDLTSRGIYLKLFIEYGEKDDLANVSNLMMDLDPDNN
FT                   KIILSFGYVLPDDKIDNLKADFNEYISKKPKPEENKKTIFNEFIKKEHGKYFKTFKKTV
FT                   GYDLQTASINENRYIDLNERKISLDNIINFKIIGATRNVSNNDSNKTLSLLSSKYYEKT
FT                   EESKKGLDNFKEFKEILCKTDGELEDIYGKLFEDVLTKVRKFGGINEGDSTIKLVSNLQ
FT                   HKELLGGNTTVVYEHNKEHLLPESYNGLGYLNLISMIFEIELILSDFRRENKEDKNPAD
FT                   INILFIEEPEAHTHPQMQSVFIKNIKELLKTESGNSDGTEFNLQTIITSHSSHIVSESD
FT                   FEDIKYFYKKSQNEVIAKNLKDLKSEYLGAGEDAYYKFLKQFLTLNRAELFFADKAILI
FT                   EGDTEKILLPAMMKKIDQEFPENMPLLSQNISIVESGAYSHIFEKFIDFIGIKSLIITD
FT                   LDSAKKEPVLNNKGEQETYDNGNPKYTTGKVKVFEGNITTNASLKFFHGKRENLDYFLG
FT                   LSCESKRLSKNKTTKNWETDENGNLMVIFQVEESNCNDEKYCARSFEDAFFHLNRKYVC
FT                   DNIGNFPSLQYKKYVADQTKDVYTLAEKCIDKKPAFAIEILLNSKDTENGKMFGNWKTP
FT                   KYIREGLIWLKNC"
FT   gene            2225..4108
FT                   /locus_tag="MmarC7_0002"
FT   CDS_pept        2225..4108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0002"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: lsl:LSL_1564 DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65075"
FT                   /db_xref="GOA:A6VF49"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF49"
FT                   /protein_id="ABR65075.1"
FT                   /translation="MVEKLLEPEIVEIFGHVLRGNNFLLSGGAGSGKTYSLIQVIRKAL
FT                   NDNPNASIACITYTNSAVNEIKLKINHDNLMVSTIHDFLWNNIKQFQKELKNGIIELSE
FT                   LETSKIKFKNENDKSHFVENVSNIQYKEYIQMKNGIISHDEVLVLAHHLFEKHDLLCNI
FT                   LKDKFKFIFLDEYQDTNKLVIEILLKHLKKCNKEQIIGFFGDSMQSIYDDGIGDLKDYV
FT                   NSGEVKEVVLNQNRRNPKLVIDLANKLRTDNVIQEPSNDINAPNMKDGSVIIGKINFLY
FT                   STTNDVENIKSTQYFSNWNFNDTIKTKELSLTHNLIAPKAGFSNLMAIYDKDPMFRLKN
FT                   DILSKSNEKCIELDDSKSFEKIIEEVDSLFRNSKKQMINSSNEVKELYDHLKNLPFSEI
FT                   KKIYFDKDSLIDNKKETDDEGSNDSKRDNLIKHLFKIEKIIQNYKNKDYNEFIRKTNFK
FT                   IDSIAKKRELKNIIDKIGNFSELKIEEVINLCDEKELCKKDDSFNTFIEKNQYLYNRVK
FT                   ALQYLEFQNLFNYLEGFTPFSTQHKVKGSEFENVLVILDNGGWNNYNFEYLFCNRIDKQ
FT                   SVLLRTQKIFYVCCTRAKENLNIYYHNPNSQTISKAIEWFGEENVHNLDDN"
FT   gene            complement(4131..5381)
FT                   /locus_tag="MmarC7_0003"
FT   CDS_pept        complement(4131..5381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65076"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF50"
FT                   /protein_id="ABR65076.1"
FT                   /translation="MNNQFTVTEFGIIVKGNENRQFDTYISLKESVFNDLKTFILQNKD
FT                   KNTDEFLTITYKKNYGEVLQAKNYVGIIQMKNGVTIEILPKIYGKSKDLSVSDTRKLFL
FT                   KMLKTLKDSPFKKFDLSNLKTDRMPLNEIFITMFLDELSVLIKRGLKSDYIETQKNLNV
FT                   LKGKLKFKEHIKHNLIHKERFFVEFDEFIKDMAENRIIKSTLKELSKRSKSGKNLKNIS
FT                   EYSFVFDEISESKNIEKDFNACKSGRLMVDYENILLWCRVFLKNESFINFKGSNVAFAL
FT                   LYPMEKIFESYLTYKLKKSGKFSYVKAQDSRFFLVKEDLKKMFKLKPDIYAEKDDTIYL
FT                   IDAKWKILDVNSPNYGISQGDMYQLLSYAKIYENNCKKHVKMALVYPKTDKFLEKVNFE
FT                   YFDEKNVLLKIWPFELV"
FT   gene            complement(5395..7932)
FT                   /locus_tag="MmarC7_0004"
FT   CDS_pept        complement(5395..7932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0755 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65077"
FT                   /db_xref="GOA:A6VF51"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF51"
FT                   /protein_id="ABR65077.1"
FT                   /translation="MDIKEKYQLWDEFLQRWPVEKVKSMTLEEYTNLGNNDYFCYWLER
FT                   KAHELGGIGGGASFKFGIFRTNSENKENERGRKYSEKYGWYEKYGKTEEEAFQTVKNMV
FT                   MDIIEKSRAGKFNEIDSIDLGNAVKWKIAFIYQDRNSPKLVSIYNTKMLAKALGVEFNG
FT                   SVSELQSCAFKEKPENMDIFEYYDILESRFKESDEDESEDFIEEESEEISVTSKNKKFP
FT                   LNTILYGPPGTGKTYSVTEKAVEIIDGDISNKSREELVDRYENLRENGQIEFITFHQSY
FT                   SYEDFIEGIKPVLENSDSNSIEYQIDDGIFKTLCLKAKAKKSTVITGYTFDENKSNVFK
FT                   LSLGDVSIDADPIFKYCFENGVIALGWGEDIDFSKSTSLDAIKKVHDTKYPQYASFGPT
FT                   AVDRFINGMKKGDIVVITHGNRKFKAICQIIGDYEYRNDSEIRYYQFRKVKWLWVADEP
FT                   APVSQILKEKNFSQMSIYKLSKEDLLIENLKDLISNNSDVENNKPRFDEVFTKLIGNTD
FT                   FENGETIRIDMKNPNSHYLIKKVNEKTIFYDKGNVSGEYNLSINTLKRMYDTGENNIIT
FT                   GGGLESYYNGLLTRINKIAEQLSVKTDEKNYVLIIDEINRGNISKIFGELITLIEDDKR
FT                   LGTKNQITTTLPYSKDTFGVPKNLYLLGTMNTADRSIALMDTALRRRFHFEELMPDPEL
FT                   LNGIIVKGINLKQMLEKLNERVEFLYDRDHEIGHAYFLPLKYIENEEEQFKKLCQIFKN
FT                   KIIPLLQEYFYDNYEKIQIVLGDHFRQLNRMEETENYEDIPVRFIQSKKFKENSVIGFD
FT                   HEEYEDMITYRINPDLCIGDITPETFKKIYEKI"
FT   gene            8074..10704
FT                   /locus_tag="MmarC7_0005"
FT   CDS_pept        8074..10704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP3870A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65078"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF52"
FT                   /protein_id="ABR65078.1"
FT                   /translation="MGFQAVKSVDELYNGVKPKKIVLTNDAALATALNKRIDKPMIGKF
FT                   AYTSQEIAQKFIPTYFDEQKLSKTDVILKISKDFGYDIKSVHSAVEKIVEIKKHSRNVS
FT                   KYINSYEKRILDKYNSLATTENTLEKFDFYKHFKNYSEDEVAVIGFENFSKIDKLALPK
FT                   NFTKISPFKEEPKDLENFYLFKNENEISDRISNIINPENQNDFSIILNTESTILDILKA
FT                   KLYKKGINLNVKEYLHENLNLRSILNLLTLSFQINELYLRDLAPYFEMFNIGTSEGYSN
FT                   YTLKDYSENVNTDENFNKLCEFLKNISEYRFLDLLTFLNDFEIEIPYEFKKTLQKLEIY
FT                   DKKVTYQNIQNLTYYIDNFDVEIGNSKSGVLLIDAKNSVYVDKPVCIYVNIDSSWTKDV
FT                   KKAPYISKKDEEQKNLSNFQILLSQGQLQYYFVPEFKNGEKTIPCFYFNQIFEKEIESF
FT                   RDEIFNVKILSNGKNSMIEEFSEDFESKEPITKHIFSQSSLNNFVLCPKIYEISRIYRS
FT                   DSKNYHVKGNLLHEFAEFYVNYPEVVNGKGYEYFAEILSNEYSKLIDILLKDLEKTEFL
FT                   IAIKNTVEFIDSTTFDFESTFNLESKKQNENFLSRLFEMPLFRKNTEVYFEDLNFGLNG
FT                   FIDLLIDNSTILDYKSSKSVKSASKILKLCNIKKLGSEIDFQPMVYLLKLRTENPNKNL
FT                   SFKYYFFLGNKNKVLDGTGHFDENIVDIMYYPTSFNDFVLSDEGFELALGSKERMNFVN
FT                   TVSKEYILEYFTKNPFNSEMTNEFLETHKFGFLEHILAYSPKKTVEKGALSFYKELLNI
FT                   KNGTSRAVSKAVFFKDDLDNFEEFLKGKIEEVKLYSGLGYPYLPIVSELCKNCEYSDIC
FT                   LKRGD"
FT   gene            10706..13543
FT                   /locus_tag="MmarC7_0006"
FT   CDS_pept        10706..13543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0006"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: hwa:HQ2149A DNA
FT                   helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65079"
FT                   /db_xref="GOA:A6VF53"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF53"
FT                   /protein_id="ABR65079.1"
FT                   /translation="MVFNPKQDEVAENINGIYVVDAGPGTGKTHTITKRYLNILNSADI
FT                   GDILLLTFTKNAAENMKKKIFNKVISHDSSINLLDANISTFHSFCNKILRENPESAPYY
FT                   LGINEPLSKNYSILESSILENYFFKSVYYDFKEKNLEKYPEIFKTVSKNYFEILFLIKK
FT                   LLSKGIFPTKDGWFLDGEKRLIGDFEEFLKVSNNSNAPVMGKKDFTQSKMLKKFKSSGD
FT                   KVYLDTPDDIEENKQISQKYIEESFNEDRADLLSFIHDIYFNYIEKSVIENKLNFDFLT
FT                   MFSYLMLYHDHKLRENNSFRYIMVDEFQDTNELQFILTLMLLKEPNLCAVGDWKQGIYG
FT                   FRNATIDNILNFEEKLNEYKNLLNDEFERIKFDLNAENKEFVINFRSSQKILDFSNNAL
FT                   IAKGSSSEEIDSNEILKNVTKLSANFDMKEYSEIEFINSKDKESEIKSILSKISEIVNN
FT                   EKYKIVDYNDEKPVFRPIEYSDIAVLSRTRNFGLEIHKHAKKLGIPAKYDGGIELFNAR
FT                   ESVLILAWLRLLSNIDDKRAWVTILAEDNYPYLEKRKIISEKEYPEKYIEFRKNLQKIQ
FT                   NNVIFLISEIFKHYNIDNDYSNAITAQISSLCSNNLISTKILANFIEEAIQNNETFEIE
FT                   IDSSPNSITIQTVHGSKGLEYPVVFIVNCNQKNFPSEMSEKGLLTHSDLYGARLSKIYG
FT                   IKGEYHSLFNNWKADLLKAAVLREYDEERRLMFVAITRAKQYVYFTAYNPSNFFKELSR
FT                   DFSILEPSEFEFSKIENDVEIQNTEFELENYVKQGHIYSVHDFIDFTPSEGGRGIEFGN
FT                   YIHHVAEQFALKKEVFDDSKEVLEVKNFIDSLDAIELIPEIECSLPVNGNLIRGIIDLL
FT                   AMYDDKIEIIDYKTDVSKINHEEYRKQLSIYYYVVKEYFKKNTLCKIYYVSLEEVVEVN
FT                   PLGYDELVSLMSERI"
FT   gene            13588..15549
FT                   /locus_tag="MmarC7_0007"
FT   CDS_pept        13588..15549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0007"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; KEGG: mac:MA2096 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65080"
FT                   /db_xref="GOA:A6VF54"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF54"
FT                   /protein_id="ABR65080.1"
FT                   /translation="MIPESPNMLEHIPEDFKYWRKYQQEKVEEILGHISNGKKIIVLNA
FT                   PTGAGKSLYNISVGSILNSLNENNNAFVLTSTKMLQNQYSDEFPEVRVIKGRANYPCKS
FT                   WEWLYNLRKNEDAKKGKKTEEYKAKTFEDCYKIAKNTKCNFEGVCEYKLAKKEALESTF
FT                   ACMNMAYFILAVPNEEVGFENRTLCIIDEAHNIEDTLMNHYTIEITKKRVEKLRKSLKE
FT                   QKEVNFPKEKWNGILPVNIYFKDIINYAVDAAFENIYEGEAELLNFLKKTVYSDIKIIL
FT                   DKQLVSKDIFFMKVKNQNNLINMSNLERKQKLINYSKMFLPSNYIDLSESETTRFMDSI
FT                   EKYQKRIKNAINLFDDLYKIEEIQESGEMGAKWIPTHVERNYGKNVGTYLEKIILKPID
FT                   VKDLKEELFDQAEFYILSSATLSKQHMKDLGFSEKDYAVVSVPASFPVKNRPLKIINEF
FT                   NMKYEYLNKKDYFKKTVEKLDLILSNHKNERGIIHVSSNKLMKDIFKNSIHKNRMIKVT
FT                   SNGNLSEGIESIDSGLYYHEKNNNSVLISPSLHTGVDFKDDKARFQIIFKVPFLAGDEQ
FT                   VTARRKKDPNWYFGKAVTQMIQSYGRTTRSVNDYSITYILDKRALHYLKNDNFTPNWVK
FT                   EAVIKYNTVEDALIDKSL"
FT   gene            complement(15646..16239)
FT                   /locus_tag="MmarC7_0008"
FT   CDS_pept        complement(15646..16239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ter:Tery_3996
FT                   tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65081"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF55"
FT                   /protein_id="ABR65081.1"
FT                   /translation="MKKLFLFIFGIILVSSFSGCTDNTDYVAKGDSYLSQGRYEMAILN
FT                   YDIALDSIFYKINPNDEIYKNKGIALENLERYDESLSSYVRAYEIDPENIDTLCHVGNL
FT                   LLKLERYNDALPYYEKALSIKPETEDALYGKARVLQFQENYAQANGYYDEVLILNENNT
FT                   QALYNKGLTLQKIGKYSEANIYIERAKELTNAQN"
FT   sig_peptide     complement(16174..16239)
FT                   /locus_tag="MmarC7_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.911 at
FT                   residue 22"
FT   gene            complement(16254..16508)
FT                   /locus_tag="MmarC7_0009"
FT   CDS_pept        complement(16254..16508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0009"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65082"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF56"
FT                   /protein_id="ABR65082.1"
FT                   /translation="MAKVQRTTKVYELKQGRKKVYIGISNDPERRAKEHARAGKKFTHM
FT                   NVLTNKKTQSNAKKMERELIEKYGGTKSKTPKYNKTLWG"
FT   gene            16976..17794
FT                   /locus_tag="MmarC7_0010"
FT   CDS_pept        16976..17794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65083"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF57"
FT                   /protein_id="ABR65083.1"
FT                   /translation="MEIPLRVHICLVGFEVERISKAALERKADRVYLITKHKDDKGRVF
FT                   FDKNKEILEKHNVEVIGKFIDDIVLEDILKVTKEIIKNENTENTIYINISSGSTLAAIS
FT                   GMLCSMMYSTDKRIIPYYVKAKDYLDKTKNEDKEKITEIMGKNYGGTPPITSGILAISD
FT                   ILTFPMSLPSNELLIFLKEIQKEKDGISISALIEFSKTDDNIAKFRELTKRNDIKESSQ
FT                   KTKQSEYAWINQNILKKLRDEWELITIEKRGRNHFVKINEKGEKMLKYLC"
FT   gene            17862..18431
FT                   /locus_tag="MmarC7_0011"
FT   CDS_pept        17862..18431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0011"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: mmq:MmarC5_1161 exonuclease,
FT                   RNase T and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65084"
FT                   /db_xref="GOA:A6VF58"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF58"
FT                   /protein_id="ABR65084.1"
FT                   /translation="MKVFLDTETTGLEPGQIAQISYIISDDDLNIQKAENIYFKVNSME
FT                   TKAQSVHGLSIEKLELLSDGKSFTDHANQILDDIDQKILICHNVPFDYKFLNSEFVRCG
FT                   IEYDPKKFCTMNHYTNLCGIPNPYRPGYKWPRLEETLDFLSIEKSEVLKNALNLFGNTT
FT                   GFHDSRFDSMGLFMIYKEGIKRGFIQ"
FT   gene            18477..20765
FT                   /locus_tag="MmarC7_0012"
FT   CDS_pept        18477..20765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0012"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   mmq:MmarC5_1162 DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65085"
FT                   /db_xref="GOA:A6VF59"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF59"
FT                   /protein_id="ABR65085.1"
FT                   /translation="MGRALELLNKMRKNKSFNDYIEHVREIPEKDAEYSEEELNLPQCI
FT                   QNYLNGKYIKPYTHQYETLNHARGGKNVLITTSTASGKSLCFNLPVFEKLANDSSATAL
FT                   YIYPTKALSNDQLTTLKSMDSEMSLKIYPDRYDGDTNRDLKSEIRATSRLVVTNPYMLH
FT                   LVLPYHKGWTRFFENLKYVIIDEAHMYRGVFGSHVSFLIRRLRRICENYGSNPQFVMST
FT                   ATLANPEEFSQKLTGLDFEVVENDGSQKSKKYFVLYNTMKQTTSEDSWNKAAVRLFKAS
FT                   MLSKLQTIGFTRTRRMTELLTVWVKEDLDPTLQNKVSAYRSGYSTKNRIEIENRLKQGK
FT                   LWGIFSTNALEVGIDIGSLDSVLMYGYPGTLMSLWQQAGRAGRSGSDSIVTLFANSDAL
FT                   DQYLVKHPEMIFEKTPENAVVDLNNYHILEKQLECAAYELELTPNGKDSDFCNGIEKRI
FT                   LRMEENGRLKKQNGGYVSTTENPALNVNMNVVSSEIFKVIDENGRKIEEIDKWHVYCEA
FT                   HKGAILINQGEKYLIKDIDLENKKCIAKKVKYDYHTDAYATTDIKIEKELNSRNYGEFT
FT                   FHFGEVNVITNYFEFAEKKYGTVLTRKPLDLPPLTFKTTAMWITFPPRFMKSVTEGDKS
FT                   DIGGLHGAEHAMINIFPLHVMCDRSDIGGVSDLKHQDTKRPTIFIYDGMEGGIGLSEKA
FT                   FTLPKKIVKTAYELVRDCNCETGCPACIYSPKCGNSNQELDKVSTLRILEGLNKKLEFE
FT                   LDWWLDNKE"
FT   gene            21094..21975
FT                   /locus_tag="MmarC7_0013"
FT   CDS_pept        21094..21975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_495790 surface antigen BspA-like"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65086"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF60"
FT                   /protein_id="ABR65086.1"
FT                   /translation="MDKFGINKVENKICNVIGDFGFKKKENGYEIDRYSGNSKEIIINE
FT                   KYNEIPIIGIGDEIFHYSGLMSVTIPESVTYIGDRAFHANNLSEISIPKLVSHIGDMAF
FT                   SNNELTSLIIPESVKAIGNNAFKNNKLTQVVIPESVTYIGEFAFHKNQIKGIIIPDSIT
FT                   RIYNDSFSNNLLTGVVIPDSVTHIMWNAFKNNKLTGIIIPDSVTCLGEECFSDNNLKYV
FT                   ILGNSVTDIGNSAFKNNPDLKICCKKGSYAEKYSKKNNIPCLYLDTDETSSSLVKKPDV
FT                   NIPEKTRLNHIS"
FT   gene            22026..22364
FT                   /pseudo
FT                   /locus_tag="MmarC7_0014"
FT   gene            22468..22908
FT                   /locus_tag="MmarC7_0015"
FT   CDS_pept        22468..22908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0015"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   mmq:MmarC5_0611 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65087"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF61"
FT                   /protein_id="ABR65087.1"
FT                   /translation="MNYFLCITTEENAKVILDKKIWGVSEKYKNTISKVSPGDHLIIYE
FT                   MGKSKTKTSEAKPQYIRAVYEVTSELKEDTKKIFEAHPNNPKEVYPLRVKLKEVKIFEN
FT                   PILFKELVPEMEFIKNKKQWSGSLRRAMAQIGEKDYKKIIGA"
FT   gene            complement(22909..24207)
FT                   /locus_tag="MmarC7_0016"
FT   CDS_pept        complement(22909..24207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0016"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: mja:MJ0130m type I
FT                   restriction-modification enzyme, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65088"
FT                   /db_xref="GOA:A6VF62"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF62"
FT                   /protein_id="ABR65088.1"
FT                   /translation="MENEFKDTEIGKIPVDWEVLELKQVTENIFSGGTPDTRKPEYWNG
FT                   DIPWLSSGETRNNSITETEKKITYKGVENSSTRLAKKEDIVIASAGQGYTRGQASFCKI
FT                   DTYINQSIVALRTKKELVNPLFLYYNITLRYNELRAISDSHSSRGSLTTKLLAPLKIPI
FT                   PPLEEQQKIAQILSALDDKIENNNQQNKILEETANSIFKEWFVDFNFLNEDGLSYLEND
FT                   GEMEFNEELEIEIPEGWNVKYLDEICTVMGGGTPKTNVPEYWQDGTILWATPTDMTSKK
FT                   SPVIDTTEKKITELGLKESSAKLVPKGSILMTSRATIGYSSIAMKEISTNQGFINIICD
FT                   KKVSNYFILYLLEHIKDKIIALANGSTFLEISKTNFKNIRVIVPDYQTMEKYNEIIEEL
FT                   INKIYKNSKENQNLSNLRDLLLPKLMSGEIRLK"
FT   gene            complement(24236..27334)
FT                   /locus_tag="MmarC7_0017"
FT   CDS_pept        complement(24236..27334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0017"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="TIGRFAM: type I site-specific deoxyribonuclease,
FT                   HsdR family; PFAM: type III restriction protein res
FT                   subunit; protein of unknown function DUF450; SMART:
FT                   DEAD-like helicases; KEGG: aba:Acid345_3755 type I
FT                   site-specific deoxyribonuclease, HsdR family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65089"
FT                   /db_xref="GOA:A6VF63"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF63"
FT                   /protein_id="ABR65089.1"
FT                   /translation="MSNLCEDTIEQGTLELLESIGYEIISGPEIAPDGTSPERKDYSEV
FT                   VLVSRLRNAISRINPKVPEVAREDALRKVLRLENPNLLMNNEKFHEFIFKGIDVEYPID
FT                   GRVKGDKVYLLDKNPLKNEFVAVNQFTIIQNNKNRRPDIVIFVNGLPLSVIELKNPTKE
FT                   DATIWSAYNQIQTYKSEISELFKYNELILISDGTESRIGTLSSNKEWFLPWKSIDGTSE
FT                   INNGVSQLKISILGMFDKTRFIDIIKNFIVFKKDGKDIIKVIAGYHQYFAANRAIEKTI
FT                   EAVSGNRRCGVVWHTQGSGKSLTMAFYAGKLAITPELKNPTIVVVTDRNDLDDQLFGTF
FT                   ASCIDVLKQTPVQAKNAEDLKEQLKVVSGGVIFTTMQKFSVDELNAKYPMLSDRENIIV
FT                   MADEAHRSQYGLKARSVEKNGEVGITYGFAKYLRDALPNASFIGFTGTPIDFEDKSTRS
FT                   IFGEYIDIYDVRRAVADGRTVKIYYESRVAKIGIENDVLAKLDAEFEEVTEFEENYKKE
FT                   KLKGKWAQLEAIVGSNDRISNVAQDIVNHFEKREETLSGKAIVVCMSRRICVDLYDEII
FT                   RLRPEWHNDDDKLGVLKVIMTGSAADGTEWQKHIRTKGKRKELADHFKDSESEFKIAIV
FT                   RDMWLTGFDVPCLHTLYIDKPMKGHGLMQAIARVNRVFRDKPGGLVVDYIGIAQDLKYA
FT                   LMNYTSSGGTGKPTYDIEDAVNLMKSKYEAMKDFFYGHDYSKFFNGTNIEKMDVIPETL
FT                   EFILNQPDGKKRFVKLALELIKSYALSLPHEEAVKIREEVAFFTGVKAALYKNTEISGK
FT                   PEDELNSAIKQIVSGAVRTDGIIDVFGEAGLEKPDISILSEQFLEDVKNMKYKNLALET
FT                   LKKILNDEIRAKFKNNLLQEKKFSEMIENAIKRYHNKAIDSAAVIQELIAIAKEIENAK
FT                   RRGEELHLTEEELAFYDALSDNDSAQEILGTEILTEIARELTETLRNSVSIDWEVRETV
FT                   RATLRVKIKRLLRKYGYPPDKQQIAADLVLKQAETISKEWIKT"
FT   gene            complement(27347..29046)
FT                   /pseudo
FT                   /locus_tag="MmarC7_0018"
FT   gene            complement(29062..30567)
FT                   /locus_tag="MmarC7_0019"
FT   CDS_pept        complement(29062..30567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0019"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: mhu:Mhun_2789 N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65090"
FT                   /db_xref="GOA:A6VF64"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF64"
FT                   /protein_id="ABR65090.1"
FT                   /translation="MAKLGFEEDLWKAADKLRGNINASDYRNVVLGLIFLKYISDAFEE
FT                   RYNQLLLEVKDGADPEDPDEYKSNIHGKSVFWVPKESRWEYIQERAKLDSIGVVIDGAM
FT                   ELIEKENSRLKGILPKEYANPTLDKRRLGELVDLIGRITLIDREHSQDILGRVYEYFLG
FT                   QFASAEGKKGGEFYTPDCIVKLLVEMIEPYKGRVYDPCCGSGGMFVQSEKFVIEHSGKI
FT                   NDISIYGQESNPTTWKLANMNLAIRGIEADIKFGDSFHNDLHPDLKADFILANPPFNIS
FT                   DWGGNLLTDDKRWKHGVPPTGNANFAWVQHMIHHLSTTGIAGFVLANGSMSSNTSSEGE
FT                   IRTNIINAGLVDAIVALPSQLFYNTQIPACLWFIRRGKEVRKGETLFIDAREMGEMISR
FT                   KNRSLTEEDIKKIAGVYHSWRNGEGYEDVPGFCKSSDISDIEKQGFILTPGRYVGFKEE
FT                   EDDGIPFEEKMESLVSELKKTFEEGEILDKRIKENLKKLGYEI"
FT   gene            complement(30661..31539)
FT                   /locus_tag="MmarC7_0020"
FT   CDS_pept        complement(30661..31539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65091"
FT                   /db_xref="GOA:A6VF65"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF65"
FT                   /protein_id="ABR65091.1"
FT                   /translation="MSLFKISGKSVEKMNSTKNIERKIQNLCENNLEEIFGVKFLRSEY
FT                   PTTTGGRMDTLGIDFEGNPVIIEYKQVESENIITQGLFYLDWLIDHKGDFEQVLNKAGV
FT                   EMEVSWDSPRVILVAKSYSKYDTYAVNQFSGNIELWKYMIYDDEVLHIERINLAKDEKE
FT                   KAIRHKSRVTYQTYEIDHHLAGKPENIVNLYYLVRDEILKLDENISEKIKKLYIAYTLD
FT                   KNFCEFVVQKNGLRAYININKDILEDPKDISEDVSYKGHWGSGCTSLKIEKEEDIPYAM
FT                   ELIKQSYEKNL"
FT   gene            complement(31658..32632)
FT                   /locus_tag="MmarC7_0021"
FT   CDS_pept        complement(31658..32632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0021"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   mmp:MMP0743 probable integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65092"
FT                   /db_xref="GOA:A6VF66"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF66"
FT                   /protein_id="ABR65092.1"
FT                   /translation="MNELEKKLLYGTKPDPVVATEEQNKYIMKFREEREFDNIKPSTIK
FT                   NDITSLKVFLAFCEDAKKEPYTLSTHDFVIFFNMLNNRRNCTVRTQNRYFNLLKVFYRL
FT                   LKYDNFKEFERESIERKRFSKFEKKHYDTINFDTYNRIIKEIILSNSRTRLRDALIVRV
FT                   LWETGCRRSEALSIRYKDCDFEKGRFRIRDTKTYEERTVVIAEETVEIVRDYIKENIRR
FT                   DSNDYIFQNEMIQNGKRVKLDWITNVFKKAVRKLKEEGVIPEGKRIVIHSLRHGRATDL
FT                   LDKGVPIDVVKEILGHRSLETTLYYSHSKERKDGMLDNIQKLL"
FT   gene            complement(32642..32902)
FT                   /locus_tag="MmarC7_0022"
FT   CDS_pept        complement(32642..32902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65093"
FT                   /db_xref="GOA:A6VF67"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR024254"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF67"
FT                   /protein_id="ABR65093.1"
FT                   /translation="MSDTITLGLIENVDRRTARYILHKVEDMNAVSPDILRKATEPKKQ
FT                   YRKTLSLSDIEKKIVEKHGKATSLLMNCYIVMNREGLINEN"
FT   gene            complement(32904..33062)
FT                   /locus_tag="MmarC7_0023"
FT   CDS_pept        complement(32904..33062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65094"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF68"
FT                   /protein_id="ABR65094.1"
FT                   /translation="MISIEDAELPREMIENRIKDTEKQIERFENFIESLKIRKKKYEEK
FT                   LAEMDGE"
FT   gene            complement(33073..33228)
FT                   /locus_tag="MmarC7_0024"
FT   CDS_pept        complement(33073..33228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65095"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF69"
FT                   /protein_id="ABR65095.1"
FT                   /translation="MDSYSYWKYGLLNLQVEVDPKGRLINKKALEKVLKELEKIVEEND
FT                   DKIFYR"
FT   gene            complement(33563..33880)
FT                   /locus_tag="MmarC7_0025"
FT   CDS_pept        complement(33563..33880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65096"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF70"
FT                   /protein_id="ABR65096.1"
FT                   /translation="MLWPHSNKVHFEFKGYVSTNQVNYEGVKTVKFHYIIQKDRITESY
FT                   GVANGKKELIRISELVKDENCTLKVLNRPDFLKIKRKIDMKTNRKRAKTFKIERIDYMN
FT                   A"
FT   gene            complement(34004..34348)
FT                   /locus_tag="MmarC7_0026"
FT   CDS_pept        complement(34004..34348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65097"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF71"
FT                   /protein_id="ABR65097.1"
FT                   /translation="MGADLYIEDKIGNNLGYFRDSYNDSNVFWKFEGSYWEMIEIATEE
FT                   MYSEVNCEKAISYMEEKLANDEVFEKNISELLDVEQEYFKKESKQLKKFVKKARDVLNG
FT                   KIEGKIIFSV"
FT   gene            complement(34358..36388)
FT                   /locus_tag="MmarC7_0027"
FT   CDS_pept        complement(34358..36388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0027"
FT                   /product="MCM family protein"
FT                   /note="PFAM: magnesium chelatase ChlI subunit; MCM family
FT                   protein; KEGG: mmp:MMP0748 MCM family related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65098"
FT                   /db_xref="GOA:A6VF72"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF72"
FT                   /protein_id="ABR65098.1"
FT                   /translation="MRKGGEKVMDDKKIHELRLYLVDYLKAYHLDDFRIEKYRVKVDIK
FT                   NIYENYGFEFVNYLEEEPKEAVNLLEEAYTEAYYSVKGDKPHFVLSIYNLPDTINKKSG
FT                   KVVTIEDINVETHGRLLEVEGIIVLATKIKMALKRGVHICTSCGEKKIEYIEKPFEAQF
FT                   EPVCPKCAQNMMLLEDDSETKYVNFQELKLQQPLDLMSDPEEPPKFITVLLENSPGFYT
FT                   GRVKVTGIPIKIQRNKKVPMYDLVFSGIHCEPVSEKLESDFTENEIESFEKIAKNENVI
FT                   EILADRLIPDLKGYMTVKKAVFLQQVKGVKKGNKRNDSHILLITDPGTGKSLSLRKIAK
FT                   IPGNVYGSVNMASGVGLTASVVQEKTEIGDNTYVIKPGLLVKANGGTACIDEFATNKKL
FT                   HENLLEAMESQTIHISKGGLNTKLPSECAVLAAGNPRWGRFDPNVSIMEQINISPPILS
FT                   RFDLIFPLIDEPDRTKDRGIAHHIISIHRAHLDKGKDKEIDLTSKVIDDIEIDFGFICK
FT                   YITYARQLEPKITDEAENILTDYYLKMRKGVVQITARQLEAAIRLSEAIAKARLKTEVT
FT                   CEDALEAVELINESLKETAFDPETGQYDVDKIMGVSKKERSRLTEVYDAIKDLGSIKDL
FT                   VLYDDLLEALKMKEAILKEAIKKLITNGDIDEPKTGMYRII"
FT   gene            complement(36385..36912)
FT                   /locus_tag="MmarC7_0028"
FT   CDS_pept        complement(36385..36912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65099"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF73"
FT                   /protein_id="ABR65099.1"
FT                   /translation="MGRGKVLKPHKRLHTDLETGNGETLEDYERFEEISKRWNMDKNKT
FT                   FRKMINLIFENIGVYEKLRDYAEELGKKDAEILELKKEIALKNQDLSKRDLEIEKLNAI
FT                   LPESSEDQTYSWLQKWLKDWRTTPDETRELARPMIIKKGVVVRNEINTLLGLVDYEPTV
FT                   ESEFEKVKSGAT"
FT   gene            complement(36943..37209)
FT                   /locus_tag="MmarC7_0029"
FT   CDS_pept        complement(36943..37209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65100"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF74"
FT                   /protein_id="ABR65100.1"
FT                   /translation="MCENSEKEKLIKYIESHIELINTDVKTVSVCGAITKEGITLQIKD
FT                   KFSGELDEMKYEDLRAAFEFLCGIYYGANVIINSKLSDLIYQC"
FT   gene            complement(37317..37514)
FT                   /locus_tag="MmarC7_0030"
FT   CDS_pept        complement(37317..37514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65101"
FT                   /db_xref="InterPro:IPR019205"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF75"
FT                   /protein_id="ABR65101.1"
FT                   /translation="MKIRKKSWRKPRKMYPTFSGVIKAIGNSGTLDVSVPYEYIGKKAF
FT                   LTVIDDDDEIEACFNRKSES"
FT   gene            37699..37986
FT                   /locus_tag="MmarC7_0031"
FT   CDS_pept        37699..37986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0031"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: regulatory protein MarR; transcriptional
FT                   regulator PadR family protein; KEGG: mmp:MMP0465
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65102"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF76"
FT                   /protein_id="ABR65102.1"
FT                   /translation="MVTRVLFKKHVREVLELLGKHDELYFSEISELLGVHQGSLSRVMK
FT                   ELTDEKFIEKRKEEKDVALPKAYYALTEIGKTALEIYDIVNKMEKMQKEL"
FT   gene            complement(38584..39546)
FT                   /locus_tag="MmarC7_0032"
FT   CDS_pept        complement(38584..39546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dre:795254 hypothetical protein LOC795254"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65103"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR036404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF77"
FT                   /protein_id="ABR65103.1"
FT                   /translation="MTIYEPTQYAGHGGHPFRQFGNDCSVIHSIRVWIDSLDKHRIIKA
FT                   LEVTFTDGITTKMCGESHGNVHTEYVFKPGEKIESMSLWDCGNPKKLRAGRILFKTSNG
FT                   ITVDTGKCKGKTEFPVNVGSGILVGIEGGSGADVDRIGFIFIKPIKEMILENVIYPTLK
FT                   FETTGIMPVYLDEYLGHNTSDHTISWKFGDSINKTFEHTWSSTSNVELFGEYSVKAGVP
FT                   EVVEVDGKYGWKVGAETRLERSEKESKELNWDTEGTLEPGESINLVAITRRGSLPGIDM
FT                   SGDLKIVTKDGESKSFKMTGLYNGITYTQVETCSKNEKL"
FT   gene            40066..41577
FT                   /locus_tag="MmarC7_0033"
FT   CDS_pept        40066..41577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65104"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF78"
FT                   /protein_id="ABR65104.1"
FT                   /translation="MVEDKKIWLKIDGEHVVDHNIDIKKFAKILETFQQIAYKLRPGEQ
FT                   APELYQFYLNDIKPGSADVCVTVSKTFAGDLNKSYNELNKFYSGINDSEDIESLKDHVD
FT                   NSIIEGEPNKLVSNLKDLWPKDNEIMGIALSKEQPKDISEYILFKPEAKKNINELYNEY
FT                   HKPVRKKMHGILSRIATDIDQFGFLTSKKDLIKGKFNLNPELKDALLENMEKPVEINGE
FT                   YDKANKKFVKLYSVYPSNQIFMDSIGEISLQGRTEKIYDKINSYFDSIIFKTEQTTLEK
FT                   VFEDKTVVFDKLMHDLKSSLEFQHSSEERKEALSDYFEVLELILNNYKPTMNELLKSAK
FT                   DIFNDEIVSILAPIPERMIKSGKTKYIGSLTTYDELLKMYVSRLESKLESLEDELLALS
FT                   KKINRADCPEFDVKRTETISGEFMGYKLKKEMLLNVLYIKNEEIWEISFNDLNLFGIGD
FT                   TYELAKEHFELSFETLIDGYLKYPNEKLSKDGLELKNRLITYLGE"
FT   gene            41579..41878
FT                   /locus_tag="MmarC7_0034"
FT   CDS_pept        41579..41878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tko:TK0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65105"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF79"
FT                   /protein_id="ABR65105.1"
FT                   /translation="MGNSYKIRKVKSSMKKKGFEEENGGNHLKYYFQDENGNRTSVFTV
FT                   MSHSWLELKDPYISKISKELNFDDKNQFEKYIECTFSKIDYINVLKKKGILTKE"
FT   gene            complement(41919..42227)
FT                   /locus_tag="MmarC7_0035"
FT   CDS_pept        complement(41919..42227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65106"
FT                   /db_xref="InterPro:IPR038735"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF80"
FT                   /protein_id="ABR65106.1"
FT                   /translation="MVEYGKLVRDKIPDIIFEEGKISLIHTADEEEFKIKLNEKLIEEA
FT                   TEFSENPSIEELADIFEVINAICEFYGFDLKEIEEERIKKLNERGGFSERVILDIVE"
FT   gene            complement(42230..43198)
FT                   /locus_tag="MmarC7_0036"
FT   CDS_pept        complement(42230..43198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0036"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   mmp:MMP0758 HNH endonuclease:HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65107"
FT                   /db_xref="GOA:A6VF81"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF81"
FT                   /protein_id="ABR65107.1"
FT                   /translation="MEDYIKNWNNIIMNCSFDNTYKMAWAKALVETASLKNIDSDLVIP
FT                   FEKIAELFLKYYWDQTIYFDLIQGSNLKKIPEVLKYTKELINLYHNLKGDYFPEHYEKI
FT                   IFEGFGIENERNKTIKRIVKTLGQDVSWRFMNLGGETYQLYELNENTVILSLENAKLLK
FT                   KYSDFLLPLINYRWTQMLESFNHSPRISSKVRAIDENKIKRDVLNKFKEYLDYEFDDGK
FT                   RYCFYSGKELNDEDCTIDHVIPWSFMYSDDIWNLVYCDKSENSRKSNRIPDENIINALE
FT                   LRNKLLLEKLKENNKTGKRVDELKLAIEKDYVKKFWISSRG"
FT   gene            complement(43302..44279)
FT                   /locus_tag="MmarC7_0037"
FT   CDS_pept        complement(43302..44279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0037"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   ecv:APECO1_388 putative DNA adenine methyltransferase
FT                   encoded by prophage CP-933O"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65108"
FT                   /db_xref="GOA:A6VF82"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF82"
FT                   /protein_id="ABR65108.1"
FT                   /translation="MELNEIYNQDFFEGVKKLSNNSVDLIIADPPYYNIKGDFDFKLNF
FT                   DEWKILHEKMAKEFKRVLKLNGSILLYGHARNIAYQQVIFDDLFFLENNLVWHKTDCQT
FT                   RKNIKGYRCFAPVTERILFYSNEFRKNNNSLNNPMYREYVETFKPIIEYFMEEKEKIMK
FT                   LHNLSTNGDFIRFMDEYMQSTTPARHHFSWSQWSFPSEKTYAKLQHIGDGILEKEYPLF
FT                   RKHYEELKNQFESSRRYFVNSEHTDVLFFSQESHITRKYNHPTQKPPKLTKMLIEATTK
FT                   PESLVLVPFVGSGVECVTCKELERNFIGFEIDENYFEIAKNRLN"
FT   gene            complement(44388..44615)
FT                   /locus_tag="MmarC7_0038"
FT   CDS_pept        complement(44388..44615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65109"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF83"
FT                   /protein_id="ABR65109.1"
FT                   /translation="MSKKLLSRIGSSHGIIMDNSDKDHVHVLNPGEDEIEKRHMTIDGM
FT                   NCIVIFNADEWELKQLQKKKQLEDLKKELE"
FT   gene            44784..45158
FT                   /locus_tag="MmarC7_0039"
FT   CDS_pept        44784..45158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65110"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF84"
FT                   /protein_id="ABR65110.1"
FT                   /translation="MKNCEINVARERLKEFHEGRDGVPDIMRNRTQGELRDYSGKIVNM
FT                   LDYEILKSYLYNTYYSVFILEEAPEKYFYGGKVITHELLDHEDAGLHVDVKKAGMKVKF
FT                   TEKAHSDPNKNNYFVMDYLD"
FT   gene            complement(45262..46338)
FT                   /locus_tag="MmarC7_0040"
FT   CDS_pept        complement(45262..46338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0040"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65111"
FT                   /db_xref="GOA:A6VF85"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF85"
FT                   /protein_id="ABR65111.1"
FT                   /translation="MINKVFVVSDLHFGGYNSVKNPFPLISFFNDDNRFNDSIIVIAGD
FT                   LLDSWTQTCNRKPPSYEDMIKNSMVWNQIINRAKKTPTWFINGNHDMDLDLTELGVEDI
FT                   IQVDPKDLCLDIIQNRLYIDHGNCVDLFNVKPKPRPCDDPILQYPLGYYKTRLNHTKKT
FT                   IPMQKDHFVNVAKYNVIQMIYDLKSKNEKITNDFLSEISQMLIEGFKNDIKIQFNVDDI
FT                   NKVKCKMNDDTELGYGDILESFGDFVNRFYIDNLLPSLSKDQQSDKFIYDNFANSIDVV
FT                   QTGGLFWYSQSIFDLYGADKIIFGHTHMNQLNVGQNFVYANSGCWCVNPVGPNVTNIEI
FT                   NLDENKVLSRNETISFNI"
FT   gene            complement(46537..47091)
FT                   /locus_tag="MmarC7_0041"
FT   CDS_pept        complement(46537..47091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0041"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: mmp:MMP0766 site-specific
FT                   recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65112"
FT                   /db_xref="GOA:A6VF86"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF86"
FT                   /protein_id="ABR65112.1"
FT                   /translation="MIIGYARVSTKDQNLERQLDELKKAGCEKIFLEKISGTKRNRPEF
FT                   DKMFGVLRSGDIILVTELTRISRSTKDLVEIVESCKSLGVEIKSLKESWLDTTSAHGKL
FT                   LFTIFAGLAEFERDLISERVKSGLTAARSRGRLGGRPKIDSEKVEMALKMYDSKEYTIK
FT                   QILNATGISKFTLYNYLEKRE"
FT   gene            complement(47255..48205)
FT                   /locus_tag="MmarC7_0042"
FT   CDS_pept        complement(47255..48205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0042"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mmp:MMP0767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65113"
FT                   /db_xref="GOA:A6VF87"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF87"
FT                   /protein_id="ABR65113.1"
FT                   /translation="MDTLKKQLLTKKTLLSFLISFLIIYWIFSKLDFYLMMSSIKNTNF
FT                   FWFFVAFGCFYASIFLKSIRWKLLLNDAELEVKLKDSILIFYLSMFANSIIPAKIGDIY
FT                   RSYLLKQKNNAPISLSFATVFVERIFDLMTMIPLLLIFGIISFNSDIPVEVFIALKYGI
FT                   ALIILLIVFTLIFLKLNAKIMDKINNKLIKNVFTNFEKGIRTLKVRSIPKLFLLSLISW
FT                   ITEGFTIYFIFLSIGLNFDVLFSIFTDLSSSLLTAIPFTPSGLGVVEYALVFILNLKNT
FT                   GITESSVVIVLYRVISYFSIIFLGSITHFMYGIKK"
FT   gene            complement(48229..48924)
FT                   /locus_tag="MmarC7_0043"
FT   CDS_pept        complement(48229..48924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0043"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mst:Msp_0054 predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65114"
FT                   /db_xref="GOA:A6VF88"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF88"
FT                   /protein_id="ABR65114.1"
FT                   /translation="MGEKVSIVIPAYNEEIAIGNTLDLINSVIKNIEEYEFELIVVNNN
FT                   SKDNTKQVAEKHGALVLDELNQGYGNAYKKGMGFATGDILITGDADASYPFEDIPRFLR
FT                   LMAENDFDFINTNRFANLEKNSMPVLNYFGNKMLTLMANGIYGVNIKDSQSGMWIFKKE
FT                   ILENMDFGIMGAGMPFSQEIKIYSNHNNNKFVEIPIKYRKRLGEKKLNPLKDGYDNFIN
FT                   LLNFKKKLK"
FT   gene            complement(48924..50717)
FT                   /locus_tag="MmarC7_0044"
FT   CDS_pept        complement(48924..50717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65115"
FT                   /db_xref="GOA:A6VF89"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF89"
FT                   /protein_id="ABR65115.1"
FT                   /translation="MLILYIILGLFLQYSEISGFQSPPSPIYGGDYYYQMGSVNHILSG
FT                   GDPFESSSMDGGIPGYLPLYGILCAGFCKLFSLDTFNGMIYFSLAIFAFGSILWFQTFK
FT                   QIFKNEWLSVIGVILANGISIYPILKYTEFTEQIMIPLFILALYLTFTHKKSVNYAFLG
FT                   IIYGLLAISHTVAFVGATLIIATFMTYEICDKYKFNKINGIKSYLKENWKNLGIFGIFG
FT                   FPLSLLYWYKPIFVYKLRQVNDLLIWNVNRDWNNLNVQINFVFETLKNLINVNSLYSAL
FT                   VSLLFLLGLIHIYKARKNAHNEFLRIFGIGCIFATFSYFITIPLLNMHFVPNYMANYYI
FT                   WCMGILISLYGLNLLNNTKMFKKDHSKMKLCFSAIFILLLILSSNGFISNVENNSWMKR
FT                   GYNPMPEPYPSLQKYISENTEVSDTILSTKELSFAVNSISGRKLVVNRWAQQNNPYLDF
FT                   SERDIDASIILYGNNTSKKLELIKKYDIKYLYWDTNWNGLDYRVSENNSLSHCDPLIAF
FT                   YNPLYERKLDENEVKYYRVDWWVDPSLHDVSKFDLLMISPENYRNPVKPWKEDLDPYLE
FT                   EVWNYSVDGQKIAVLYKIRVE"
FT   gene            complement(51003..52421)
FT                   /locus_tag="MmarC7_0045"
FT   CDS_pept        complement(51003..52421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0045"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: mmp:MMP0768 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65116"
FT                   /db_xref="GOA:A6VF90"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF90"
FT                   /protein_id="ABR65116.1"
FT                   /translation="MKNIAILGAGPAGLSSAYELAKISDNFENEYNVVIFEKSSEVGGI
FT                   SKTALNNGYYFDLGGHRFFTKIEDVSNMWNDILKDEFILRPRLSRIYYNKKFFNYPVKV
FT                   FDAVSKLGLKEDFLIFMSFMKSQMLKRKEISFEDWVSNRFGYRLYSIFFKTYTEKVWAT
FT                   PCDKIQAEWASQRIKGLSIGAIIKRELLGDKNEVIKTLIDEFLYPKYGPGQMYSELAKT
FT                   LTEKDVKIAYNSYISAITTKENKIVSIVDNNDNEFEIDELISSIPIDDMVRLLNPPNEV
FT                   LDAITNLKFRSFIIVNLVFDNLVDLKDTWIYIHEPEVKLGRVQIFNNWSPHLVKNSNCS
FT                   SIGAEFFCSENDELWVLPDNEIIKKAEEEIKKIDLIPDNFKITDAKVVRVPKAYPVYDE
FT                   GYKNNLNIVIDYLNAFENLQLIGRAGMFKYNNMDHSIYTGFLAARNIAYGKKYDIWGVN
FT                   QDQEYHEEIKSDKW"
FT   sig_peptide     complement(52356..52421)
FT                   /locus_tag="MmarC7_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.629 at
FT                   residue 22"
FT   gene            complement(52433..54322)
FT                   /locus_tag="MmarC7_0046"
FT   CDS_pept        complement(52433..54322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65117"
FT                   /db_xref="GOA:A6VF91"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF91"
FT                   /protein_id="ABR65117.1"
FT                   /translation="MRNKNKRLYYKKTLNCSLNEINTRGLIISKLKLPYLMLILYICLG
FT                   LFLQYIEVSEIQSFFGPLNGDQYYQMGSVNHILSGGNPFESSSMVGGLPGYLALYGILC
FT                   AGFCKLCSLDAFNGMIYFSLTIFAFGSFIWYYTFKRIFKDEWTSVIGVVLTNGISMYPI
FT                   LKYTEFTIQIMIPLFILAIYLVFTSKKSFNYAFLGLIYGLLAISHNIAFVGATLIIATF
FT                   LIYEICKKYSSDKINGLREYFKENLKNFGVFFIFGLPISILYWYRPLFVYKLHQVNNFM
FT                   IWGVSLNWYNSDVQIEFIFDVLRSLINVDSLYSALVSVFLINGLVQMYKTRTNSQCKFL
FT                   KIFGIGCIFATFSYFITIPLLNMHFFPNYMSKFYLVTLCSMICIYGLNSLKNTKIIKNH
FT                   HLRMNLGFTSLFILLMVLTSNIFVSNMDDWSVAGKNPFPNSQISLYNYLLENTSSEDTI
FT                   LSTKGLSYFIIGTSGRKLLVNHWAQQNDPYLDLSERDIDAAIILYGNNTEKKLELIEKY
FT                   NVKYIYWDYRWNSTEYQFVNGSETPKDPLIAFYKEKYKKQLEEYGIKYTEKTWWVDIYQ
FT                   RNAQTLDLLMISPENYRNSIKPWTTDLDPYLEEVWNYSSDGQKVAILYKLNIE"
FT   gene            54469..55219
FT                   /pseudo
FT                   /locus_tag="MmarC7_0047"
FT   gene            complement(55216..55683)
FT                   /locus_tag="MmarC7_0048"
FT   CDS_pept        complement(55216..55683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65118"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF92"
FT                   /protein_id="ABR65118.1"
FT                   /translation="MSEKPEADLDLSHQDAEENIDEVPRKVGPENTKELNVEKEEKPEK
FT                   ETDGDFVVSKPEITEEKENSSDTKPIYDIPIGRSKAGPETNEEEFDEVTPKTAGRKKSV
FT                   YLESVVNKTIIDILEDLKEIHSVSYQKEVKRTSKKIGQNIIFLKETLKGNI"
FT   gene            complement(55694..56449)
FT                   /locus_tag="MmarC7_0049"
FT   CDS_pept        complement(55694..56449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65119"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF93"
FT                   /protein_id="ABR65119.1"
FT                   /translation="MGILENLGFKKKKSDPGSERSENTEENIDDPEKETPGTFNVIEKV
FT                   KKKKEEYNAEREAYDSLAPYLSRQKLLIWHNGSGAKLFGYPHAVIPDEGTYKILYKNKA
FT                   TDWLEDLIITIKSTLFNYKRHYAVVYAPKSCVDISEDIIIFFVDHFRDDKYANFVKYAV
FT                   PLEDDDPRQRVAWITERKRAEAYEIMCENLLSQDIPNLVEAALYINPTMKMYKGSEKES
FT                   SRKSTKEKSFEGGEFSFDNAITKMKNEMM"
FT   gene            complement(56458..57810)
FT                   /locus_tag="MmarC7_0050"
FT   CDS_pept        complement(56458..57810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65120"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF94"
FT                   /protein_id="ABR65120.1"
FT                   /translation="MVRINLGIGRADPTKKFGERTKRTLDLKNDEANHITLLGKSGYGK
FT                   TTIMRGMIEEIYSSYSDAGIPPIIIVIERKVDTSKPKKVIEIYHEESEYLSSAKAHRKY
FT                   GEGIWNYLEHYVKEIEKDKELKYGLMGDFAIGFPNILGKYTKMESDETKSLLGRHGLSP
FT                   AAYPARRFVFRPRREIENIAFDNGPLTEAINSKLAYPDLAFEIIADMNNLGEQTRYSAI
FT                   LKNIWDISKIRDPKEVLLIAGSSETSNSGPSQTYLRIDETMNRLKTDVLFTGDIDNSFL
FT                   TKLTNKKINILDFSQNSELETYEECLIFKLVVQHAINVAIKYRIPVFFVVDEVQNFMKD
FT                   KNGKWAIDKILREGRSLCINLICATQYTDNLPKDILIGSSHIGIMGKLASNTDTKTLEK
FT                   LIPDFKDVVDFDEPGSLSEWENMKRKLRFRGYFSYNKDFTEHIEYRQPQSL"
FT   gene            complement(57938..58477)
FT                   /locus_tag="MmarC7_0051"
FT   CDS_pept        complement(57938..58477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65121"
FT                   /db_xref="GOA:A6VF95"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF95"
FT                   /protein_id="ABR65121.1"
FT                   /translation="MQKKLFLIMIFCLLPGVYANSDNETVYVLTDYDDLNYSTLIVYDG
FT                   NMVSGQNALIHELKQNITALNEELSKKDKQLSSYIVAKAENVELKENITTLKSKIKLLE
FT                   AEKEILETQNEGYQDMITDLITKQSNDTKDISTEAYNNAVKTVNNFKLGVLVGVVVCLV
FT                   LFLVLRWKKKQFDFGI"
FT   sig_peptide     complement(58412..58477)
FT                   /locus_tag="MmarC7_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.516 at
FT                   residue 22"
FT   gene            complement(58618..59058)
FT                   /locus_tag="MmarC7_0052"
FT   CDS_pept        complement(58618..59058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65122"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF96"
FT                   /protein_id="ABR65122.1"
FT                   /translation="MKKIIFFTFLIIFLLVFQILNSSKSDEEIIQLKLLKFGYPSSGYI
FT                   ICNETVYYKDGSKSELTNPPKMYELGGVEAYYLAKDYIDKEYGTSLESKGLMIRVEPKS
FT                   IEESENYWKFKFYFGDIGSTGRFMGYISVNREKGYVDMEGLF"
FT   sig_peptide     complement(58984..59058)
FT                   /locus_tag="MmarC7_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.369 at
FT                   residue 25"
FT   gene            complement(59064..59543)
FT                   /locus_tag="MmarC7_0053"
FT   CDS_pept        complement(59064..59543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65123"
FT                   /db_xref="GOA:A6VF97"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF97"
FT                   /protein_id="ABR65123.1"
FT                   /translation="MANFSLDVWLPKAVGASAVVGLLLWWTGTQVVTISEIATSLSSIP
FT                   FAVILLIEGLDKLADVSGMYNKLIPQNTSNHLLKSVVIGVIAFVAVLYGILGTISLSLG
FT                   SLAAPALVAAGICAVYILAPETGDDELLLFLWIGATAATLGHNIAIIPPIPGITG"
FT   gene            complement(59553..60287)
FT                   /locus_tag="MmarC7_0054"
FT   CDS_pept        complement(59553..60287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0777 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65124"
FT                   /db_xref="GOA:A6VF98"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF98"
FT                   /protein_id="ABR65124.1"
FT                   /translation="MKNNIWIGLAVAVILVAAGAWYYLDQGESAGIIIPTGTTFSSDAA
FT                   FDNETGDVLITFNASKENITADSLELYVSYDELTFTKTNTFEDVAFPIDVEVTPEDGEE
FT                   NLYYYAVISYSDKTYRLPTDAGSYETVEITVENSTEETEETALSFTAVPDFNSTTSVVL
FT                   FSLSASEENKTADVVLFTSYDNTTFTNTVNSTALDLPGTFEFTADAAETDLYYYLEITC
FT                   DENTSRLPTEGAEWINITVAAE"
FT   sig_peptide     complement(60228..60287)
FT                   /locus_tag="MmarC7_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.719 at
FT                   residue 20"
FT   gene            complement(60649..60975)
FT                   /locus_tag="MmarC7_0055"
FT   CDS_pept        complement(60649..60975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65125"
FT                   /db_xref="GOA:A6VF99"
FT                   /db_xref="UniProtKB/TrEMBL:A6VF99"
FT                   /protein_id="ABR65125.1"
FT                   /translation="MINQLILVVMSFVLSMVLKEQVEVVGQVLGLPGLVSWIILTLIVL
FT                   ICVWKIGSDKWDLGDLLASFVLIVLVLLYYYQDVSQIFLECSRIMLGVCLGAIVVSAAN
FT                   ASKR"
FT   gene            complement(61002..61451)
FT                   /locus_tag="MmarC7_0056"
FT   CDS_pept        complement(61002..61451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65126"
FT                   /db_xref="GOA:A6VFA0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA0"
FT                   /protein_id="ABR65126.1"
FT                   /translation="MVGCGVGFAALMWYVMNNSVMGSDVVRGLAAVPFVFYLMAELLDT
FT                   IVDMNKVVYTPLFKNYSGIVAVGLTVITVVCMFFVTLWALSGSITLSIGSAGASSVVVA
FT                   AIFALYLLAPNTGKEKFLLYLFVGASIATWGSYLSIIPSFTGFGL"
FT   gene            complement(61550..63580)
FT                   /locus_tag="MmarC7_0057"
FT   CDS_pept        complement(61550..63580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65127"
FT                   /db_xref="GOA:A6VFA1"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA1"
FT                   /protein_id="ABR65127.1"
FT                   /translation="MMKSKLFSIFCIFLIASLPSASAFSVLGTEVNAGWDDVGALGIGG
FT                   LAVGALAVTAGAPVLVAAGVACIGAAGVDYAYRWATGKDVEESAAVTGAAKTNVTDSEY
FT                   INNSYIYEELAGYRQYSEESAAQDIAEIKDKLESGIGTYLFKTTGTLSDVSVSMKGPDK
FT                   IYGFSAFPVQLKFDEALTGSESSYVKIESVKIYLVDSDGVKWNEKTYSDDIKLQENCED
FT                   YPDAIEEYILNFTMKAPDPYIGKAKSQVTNAPDREILQELLNAEVKQFELVVEIDGYAK
FT                   LYKEESGWRYNEDYGLEMWETWEEYDKTITIDTKLTTLEAWDMIHNGAYYVDGADGSLP
FT                   TTFVNEVTPIAYSSYANGATSNVIGRVWASPVHCYNSSAQYKFILVGQPDNLEPVEVTI
FT                   EDDYRAMVLKLRDDLVATIASETPGNFHDMSVHNGVTTSLNYLKTDSTEAFETYFLVIA
FT                   DVDDDIDAALPVWCIIQPRISVIDNVKYSLSEEFKEEILELLSDGSISDSDTERITEII
FT                   EISENSLKEKQYVAEIEAEKYEDDQKASNAISNALEDYEKAFEYYEKAKNTDDPEEIKV
FT                   YTYLAGDIYEPAGDYWSEAAEKYNLGLDDQGDALAENAEKLESLAAEYEPSLWFTAGST
FT                   ISEWWDQFKSGFGIGDVPDTVLIIVLLGVLVSGAIIVTKIL"
FT   sig_peptide     complement(63503..63580)
FT                   /locus_tag="MmarC7_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.521 at
FT                   residue 26"
FT   gene            complement(63577..65466)
FT                   /locus_tag="MmarC7_0058"
FT   CDS_pept        complement(63577..65466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65128"
FT                   /db_xref="GOA:A6VFA2"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA2"
FT                   /protein_id="ABR65128.1"
FT                   /translation="MIKRSILFLLVLLCVSTVNAGTTSILSSDQTSDYYVELNSQYTDE
FT                   LLLSALNTTSWSAYVPVVVGYGDNKIYFSSEKDLARFCTALAYNVRTLAFSGEYTVYIE
FT                   DQLVPVTTYYSTSTTTRTGYVENAQYAYIYAVAYTGADYYGSESCIYFNSESLAHAEGK
FT                   SAASGQFTSRAVSGTYDHRVACLGYQGYGFYSVTIFDYVDYDDTLVTTLIEPPDRGTVS
FT                   INTEPETAVYDGDILLGTTDNGGLLQIDIPVGEYNLKLVKEGYWDAYESINVNIENETE
FT                   LFVSLAPKTAIFQVSNEFSGNLYPNSVGTLSMDITPLKEAYATKLRVSGVEVSKVYYQT
FT                   QELPKGSDGYYILGDVTSIQNIEIEFKTPASWGEKTFTVELDAVDIEGTAYTNLETINY
FT                   EVLELPFLLEMPETFGIGINDITLTDQSGTAYSVLMVLYDSEDVEQWSSSSNLLEYCDY
FT                   TFEVPIDDAGDYTLELTAKTGTVKTYYSIEIIEPVTLITEEITANPGSVATVQFKISNP
FT                   TSNVKYYTSELTCPFFNESIAKTFSIAPKTVDKTVDISFEVPEELDLENYQLTLEIFDP
FT                   DKTDPIYFGNVVLTIPSSSLFLASVPGGNTTLILLAAAVLLIAGTFAALRLKK"
FT   sig_peptide     complement(65404..65466)
FT                   /locus_tag="MmarC7_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 21"
FT   gene            complement(65468..65803)
FT                   /locus_tag="MmarC7_0059"
FT   CDS_pept        complement(65468..65803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65129"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA3"
FT                   /protein_id="ABR65129.1"
FT                   /translation="MIILIKICPYCLKPVEHFEKDYHKSEVKAVNVHTSNKNCSVLQTS
FT                   FVKDQAKCSNIQSLKMNAGKISKDLNLSEIQKKDFFNSIIKLKRDRNHLKDYIILQSAL
FT                   NTVLVGG"
FT   gene            complement(66209..66295)
FT                   /locus_tag="MmarC7_R0001"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(66209..66295)
FT                   /locus_tag="MmarC7_R0001"
FT                   /product="tRNA-Ser"
FT   gene            complement(66859..67881)
FT                   /locus_tag="MmarC7_0060"
FT   CDS_pept        complement(66859..67881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0060"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   mmq:MmarC5_0634 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65130"
FT                   /db_xref="GOA:A6VFA4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA4"
FT                   /protein_id="ABR65130.1"
FT                   /translation="MTVKFPKTHYGDIMDDITDMILLKKDSKEHTAPNDTKKLEIDKLV
FT                   DEFSEQRRFDNIKEATISNDNDRIRVFLRYIYYTLNKTPETLTNRDYMAFFTYVKRERN
FT                   CSDNTVNKYFKLLKVFYRLMKFKNFSDFVVESKERKRFSRFDIKHYDAIDEDTLNQVLV
FT                   KLLKSNSGTKIRDATFIRLLWDTGCRVSEACNLTYSASDLNKGVFKLTHTKTKQDRTVV
FT                   CSKETLKLLNYFLQHDPDNSPEDHLFKSANGAKLNKYTLSARFRNIVKELKKDGTVPKN
FT                   QWLVIHSLRHGRAVDLLNKGVSIDVVKEYLGHASIETTLIYSHSTERKNKMLDQISKIL
FT                   "
FT   gene            68251..71091
FT                   /locus_tag="MmarC7_0061"
FT   CDS_pept        68251..71091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0061"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: mth:MTH472 DNA
FT                   helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65131"
FT                   /db_xref="GOA:A6VFA5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA5"
FT                   /protein_id="ABR65131.1"
FT                   /translation="MYTTPYKLTKSQMDAIKYVESPLLVVAGPGTGKTRTIIEKVVYLV
FT                   EELGYDPNKLLVVTFTIKAADELKDRLRKRLGDRVETMQISTIHSFCQRMLEMFPEYHN
FT                   YGSVFEVMDELDQFIYVDNNYRGFGLNGIEERLETGKRIRFVDKLTNFYNLLTENDIDP
FT                   IALKTYYSGKRSLKTEELLTESYEYYEAELDKTDPKKLDFAMLQKQFYHMLLNNEDALN
FT                   SVREMFDYIFVDEYQDTNPIQDAIIRLIAEPKFNITVVGDEDQSIYGFRGASVENFRQF
FT                   LERYSGPEKIKAHMIKLEENFRSPEEIVDAFDKFMGPHRTFEKKIISKNGHYSDPVLIV
FT                   SESPEEESIKIAEWIEKLITKHNVDYGDIAVLFKSVRNHANELVDELMERNIPYVVYGD
FT                   SSLIDQPEIRSVIHAMACINEYELNEKVSRNRKLMSLLDYDILGSDLLNLDEKTVEKLD
FT                   YRGEPHKFCDVYNYEGLKNQGIATKDIDTLINIKNIRNKDVKKPQLDIFYELMDATGYL
FT                   RRLFEASKDEADKYNAEKAELQLKNLAKFTTILEKFKKNTGSNSFKSFIYLLTKIPDNK
FT                   LEDAASPEGQDVVKIMTIHQAKGLEFPVVVLGGVTERRYGARADDRLVNIPKQFMMNKH
FT                   DVDFDEEVRRVFYVGMSRAQKLLTISAIDGRNRKMSKFIGEIGDYKFISPSAFTATFGE
FT                   DDHYVPVDEKIRMTYSSVNYYMDCPFRFYLYYVLGFVTPEWERQIYGSIIHNCLKKLHI
FT                   MMSEGKNISIRDIMGIVDKYCKEENTKKYRNSVIDLVRDYHKNAKEFIGEIVDVERPFT
FT                   YINSDLVVNGQADLVIRNKNGELCILDFKSMTKKGIESTNVEIQLQTYGMALSKVYPEP
FT                   ISHLIAYSIEDNHMQHIPNSEEGIQKTQKLIMNVEDSINNKEFERNWGCKFCNTTEGKC
FT                   PFYGLCYKLEGANNGK"
FT   gene            71081..74140
FT                   /locus_tag="MmarC7_0062"
FT   CDS_pept        71081..74140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0062"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   mma:MM0193 type III restriction-modification system
FT                   methylation subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65132"
FT                   /db_xref="GOA:A6VFA6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA6"
FT                   /protein_id="ABR65132.1"
FT                   /translation="MVNNDKLTQMQAVLRNLFQFEESDLDFGIYRIINIKRNEIKKFIE
FT                   EDLINIIQLQMKSVEDTKEIEKKIDELKSQLEGVFGKKIDAIVKLHGDTDGVKNYLGLQ
FT                   KLLNQSKNENSIEEGIYEDIINFFSRYYDSGDFISKRRYSKSNKYAIPYNGEEVYLYWA
FT                   NNDQYYIKTSENFLNYSFKLGSLSVNFEISSEDTEVEQNNVKSSDKKFFIFNNLEYNQD
FT                   SKELTVTFGYRGLTKDEENEVNKISGKKTVTNDTVNEFNVEKITEQIGIYGISSLFKKH
FT                   LKMDGTMSDKSEIEWHLNKYATKNTSDYFIHKDLKKFLTGELDFYIKNEMFHLDNVLED
FT                   NWNKYDIELRRIKVFKEISLNIIDFLAQVENFQKKLWEKKKFVVSTDYCITLDRIDKKH
FT                   YSKILSNHSQLDEWKTLFDFDVNVKTKDSKSNLLGYTSTGNPEIELLVQNPTLTLDTKF
FT                   FDEDFKYELLSEIDNLEDNITGILINSENFQALNLLLEKYREKIKCCYIDPPYNKGYDG
FT                   FIYKDNFKHSSWNSLIYDRLALSKNLIRENGSISISIDDDEEHNLTALADMCLGNENRL
FT                   AKLIWNRNHSAQAGFFKLYHEYVLCYSKNRTQFNAILGADGKIIAGAQKKESKRHKLQE
FT                   FTFPKGTRFEAEDGFELNGTWGGVESTELINGRMMCKGNKLAEDVTLKAGWTQLNQMNK
FT                   YFYSDEEVFDTKNQKVLEFFFSSTGKLKYVKEKTHEIPSTVLNEMGTAGQASNDLTNIL
FT                   GYSIDSTPKSIKLMEFIINYLADESSLVLDFFAGSGTTGHAVINLNKEDNGKRKFILVE
FT                   MGQYFDTVLKPRIQKAIYSENWKDGKPLDNNGSTNQIIKYHKLEQYEDTLNNIEFKIPT
FT                   LTALESKDYAIKYMLEFESRDNNVFLNLDNLDNPFNYILKIEQNNEIKEQKIDLIETFN
FT                   YIAGITVNKIYKTNSDNVSYVVVSGKRNGNSVIVIWRNKDDKFDPTADKDFVENNILTE
FT                   QVDEIFMNGNSLVTNAKPLDEVFKANMFGD"
FT   gene            74142..77330
FT                   /locus_tag="MmarC7_0063"
FT   CDS_pept        74142..77330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0063"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   SMART: DEAD-like helicases; KEGG: mem:Memar_1479 type III
FT                   restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65133"
FT                   /db_xref="GOA:A6VFA7"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA7"
FT                   /protein_id="ABR65133.1"
FT                   /translation="MARAKQQRKLQNHLLLNRYISSLFGFKKLDDFRRKLDDIPEGINQ
FT                   NGKFYFTEVLQNLNINDELRQKLEQYDENIQEYLNKINEKRETPILLKYYQYLAVLFTE
FT                   LYLDKYYNEFDVFYDELINYAEHMREVERDKNVPYPKENGLNKLVYWAATGSGKTIIMH
FT                   INYLQIMRYNKTSYDNILLITPSESLTAQHMAELSISNIRNRCFNFQLNLDNFGVQNPI
FT                   IVIDNYKLKQDVKTQDGKSVPVEFFGENNIVFVDEGHKGSGGKEWKSNRESLVGKHGFI
FT                   FEYSATFGELAADDDLFEEYATSIIFDYRYKYFYEDGFGKDYSILNLRNKNDYDNDEYL
FT                   VGALLSLYEQKKYMNDNSRGIRKFKLENPLMIFVGSSVSGKKTESDVLNVVKFIAKFVN
FT                   EENSMKKCIKNIFTNKSSIVDEHDQPIFNRKFSYLRELIRNNQLNIDEIYDNVISDLFY
FT                   VKSSKILEFVDIKKAEGEIGLRFGHDADYFGVINIGDTASFIKLAESENENEYFKTDIK
FT                   SNLEKTLFGKIENKNSKINFLIGSKKFIEGWNSYRVSSMCLLNIGKKEGAQIIQLFGRG
FT                   VRLRGYENSLKRSQYLKDHKRLDDSIIVPEKLEILETLNIFGMNANYMEVFRETLKGEG
FT                   ISEYETFKLKIKPTLPGFNLYIPRKSKDAGEFKDEVQITTYNNFKSTVGLDLRSKIERL
FT                   DSKDKIAETHGDSTIKELLFTDEIVSMMDFDRVYLEIMKYKGLKKYSNMYFTKKDLIEL
FT                   INKKAYYIRCKEEILEITKDHNLGKLQKLEDYAIQLLKSMVDKIYGQEKQRWYQKNLSY
FT                   EVLDEQDHRMIPEDYIFTINCTERDLKWDMNEFTDTLIKYVRKNASSDDDVIYSENSSF
FT                   GYDEATILEFFANETHLFQPLIYKNEDERLKFIKLSPTALVESERKFLNYLTEYIERNK
FT                   DNLPFDRAYLLRNPSRTGIGFFETKGFYPDFILWTINGNKQSIAFIDPKGLMLMNQDDE
FT                   KLRLYEDIKQIQDSINKRGDIQLNLDAFITSVTNYRDLKTQWDATKDELENKNILFLED
FT                   GHECIRKMFNKLYA"
FT   gene            complement(77687..78181)
FT                   /locus_tag="MmarC7_0064"
FT   CDS_pept        complement(77687..78181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0064"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   mmq:MmarC5_0637 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65134"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA8"
FT                   /protein_id="ABR65134.1"
FT                   /translation="MLSYNSNRIIDYIISVVVILTNYFMCITNEENWNVVKDKKVWGVS
FT                   EMYKNTIAKVEKGDMLLIYEMGITGKEPKPQYIRGLYEVTSDVNRDGKKIFGAHPRNPN
FT                   ETYPLRVKLKEIEVFESPILFKPLVEKLEFIKNKKQWSGSLRRAMVPLNEKDFNTIRNG
FT                   K"
FT   gene            complement(78558..80591)
FT                   /locus_tag="MmarC7_0065"
FT   CDS_pept        complement(78558..80591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0065"
FT                   /product="MCM family protein"
FT                   /note="PFAM: magnesium chelatase ChlI subunit; MCM family
FT                   protein; KEGG: mmq:MmarC5_0643 MCM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65135"
FT                   /db_xref="GOA:A6VFA9"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFA9"
FT                   /protein_id="ABR65135.1"
FT                   /translation="MVNEKIALTETLQEQIIKSVKSYKETNNGEKPTARDTILYIFNTH
FT                   SNVNIAVEDLKGILLSAGLHRSTYSKYINQLMDADILYEDKSGYLHKSETELSDIVKYL
FT                   LDKHKRKIESGKTVIVDFQEEFGTDKFLLNKLDSSPNDVFKMFSEAYTEAYRLLKNEKP
FT                   DCDGIVIQNLPDKYKCDIEDINSAKIGKVVEFEGIISIASSKKVMLKKGAYTCGCGNNR
FT                   EETLDNMFEDISKVWCKCGKEMMLNELESDYIDIQEIKLQQPLETMDNPQEPPKYITVF
FT                   FENSPGLFSGKLNVIGIPFKRKQKNGLIYDIYIYAKSIAAVEDIIVDRLDENKITYIKQ
FT                   VVEYCSKNDIKLLDKLSEILIPTIHSHEDVKKALLLQQLKGAVGLNRNNLHILLVADPG
FT                   VGKSEMLRTVSKLPKNIYGSITGSSGVGLTAAVEQERTSVGDSGWVTKPGLLVCKNGGT
FT                   ASLDELTVNKEMSTHLLEAMESQEIHISKAGLNICLPAEIAILAACNPRNGCWDNTKGL
FT                   IEQIELTKPVIDRFDLIFDMGIGQNKELDAEIARKTIRNHNLGSVNPDSLLDKTIDIGD
FT                   YTVNREFLLDFIEYTRTLSVKVPKSVEDSIVEYYVNRRANQNTSTRLVETIIRLSTAFA
FT                   KARLDTEVNERDFKDACALYTLSIKVDNPLKNLFNSKSVFDI"
FT   gene            81652..82044
FT                   /locus_tag="MmarC7_0066"
FT   CDS_pept        81652..82044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65136"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB0"
FT                   /protein_id="ABR65136.1"
FT                   /translation="MKTTELTIPSLAATALSHKGLCGRGYTKIRNQIDSEYWEIGSKLL
FT                   EEWESNTSLNMYSVTAELYHAKEFNFKGKHYGINVIGNGKVRKMCMDIAAVEMDLNRKM
FT                   DKKYESMLNDIICKLQKYDFETQEMC"
FT   gene            82615..83376
FT                   /locus_tag="MmarC7_0067"
FT   CDS_pept        82615..83376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0067"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mla:Mlab_0618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65137"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB1"
FT                   /protein_id="ABR65137.1"
FT                   /translation="MKIFYFTGTGNSLYVAKRIGGELYSIPQVLKDGNLEFEDETIGIV
FT                   FPCYAFGVPRLVAEFIKRVTLNANYVFAVMTYGNMSGSGLKQLEDLGKQSGITFNYTNE
FT                   ICMVDNYLPLYSVEEQLKHENKKLIEAHVENIVNDIRNQKTKCKRKGIVMDTVSKLVYR
FT                   FVYENKLDMADKKFIVNENCNACKLCEKLCPKNNISVTDKPEFLHRCDICYSCIHNCPQ
FT                   NAIHLKNEKSSMRFINQHVTVNEIIDSNDQS"
FT   gene            complement(83385..84461)
FT                   /locus_tag="MmarC7_0068"
FT   CDS_pept        complement(83385..84461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65138"
FT                   /db_xref="GOA:A6VFB2"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB2"
FT                   /protein_id="ABR65138.1"
FT                   /translation="MVIGDRGAVIMYSITNKKAAKVEATTFSQLGMNENDIEEILRCSI
FT                   DMLCDDEESLLIVGRQVKNEKNGRSDLTAVDNNGNIVLIEIKRDKKDIENRKEAFEFQA
FT                   IRYAASYAKVESPDELVKLVYAPYIEKYRNEYEIGELTSYELGIRKLNEFLDANDVTKF
FT                   NEKQRIILAAGEYDEQTLSAVAWLNKNNVDMNCFQLTPYKINNECYINAEKILPVSGYE
FT                   DYYVNLMDKAKYVSKKTKDITRRSLPKISDMLEWGVVKPGDVIKAKDHNAEAILLKNGN
FT                   VSVIPTEMSIGSADVRKIPMQTAVATEMSMQTWLKSVYGWSSIQTYNFAVLKETGETLS
FT                   KIREKYMEKLSSENTESE"
FT   gene            complement(88418..88714)
FT                   /locus_tag="MmarC7_0069"
FT   CDS_pept        complement(88418..88714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65139"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB3"
FT                   /protein_id="ABR65139.1"
FT                   /translation="MNPTISTELTNRIISAMETYVYTNGNWTERINCCKSYVELIVLLK
FT                   SELIHHPMTELGSLRPVVLSYIVDFIDWDTVAEHVVKQYIEETGTPLPFEMPQ"
FT   gene            complement(90284..90631)
FT                   /locus_tag="MmarC7_0070"
FT   CDS_pept        complement(90284..90631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65140"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB4"
FT                   /protein_id="ABR65140.1"
FT                   /translation="MGRDSIGPPAVVHYLINHEVLGELKYRHLKEHEAIEYAVYCRIGR
FT                   PHKLDEEHYDIIQGYVIDRGISEGTSRLRRLIATGKLSENDIRKYKTLSTMLKRTHMNR
FT                   SCSKPKEVLWL"
FT   gene            complement(91807..92028)
FT                   /locus_tag="MmarC7_0071"
FT   CDS_pept        complement(91807..92028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0071"
FT                   /product="seryl-tRNA synthetase related"
FT                   /note="KEGG: mmq:MmarC5_0645 seryl-tRNA synthetase related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65141"
FT                   /db_xref="GOA:A6VFB5"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB5"
FT                   /protein_id="ABR65141.1"
FT                   /translation="MAEITFEIVEHIGVLYEYPNGWKKELNLVSWNEKEPKYDIRDWNP
FT                   EHERMRKGITLTAEELKALKGILSEIEL"
FT   gene            complement(92434..92757)
FT                   /locus_tag="MmarC7_0072"
FT   CDS_pept        complement(92434..92757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65142"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB6"
FT                   /protein_id="ABR65142.1"
FT                   /translation="MDEVAVRRDILEYLYEKRDFVKGKDLVNISGLEKDDLKYCIHFLE
FT                   IKGYLMVKSSSYGMSYYTRITEKGKDIIKEILDKREDRNSKKKHEHKKYPLIKSRKLRC
FT                   PYK"
FT   gene            complement(92940..93287)
FT                   /locus_tag="MmarC7_0073"
FT   CDS_pept        complement(92940..93287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65143"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB7"
FT                   /protein_id="ABR65143.1"
FT                   /translation="MSSKFEKLFEKFERPGYMDFEKVVVELSENTDICSGNRAKSSKYF
FT                   IFDKYSNEKYPLKCFWIVAFGITNQMDLEEIYKKIGKLISGPVLLNEFEFFGIMVEKSK
FT                   KDDIRFKIIIE"
FT   gene            complement(93372..93893)
FT                   /locus_tag="MmarC7_0074"
FT   CDS_pept        complement(93372..93893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65144"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB8"
FT                   /protein_id="ABR65144.1"
FT                   /translation="MIKKTISSLKVDEFDNFDENILFEMPFNRKIRVSNIRTTPSGKTY
FT                   FFVKTDDFQEFKIYADKLSEKIEFILKKADGFVTDGYDVLKYVTFENQAPKHLKNDDEN
FT                   TLTQKNVLVKIPLWLANENKLHFGEKIGKFCYIHFKFVLESEKGMCFYSKELDKNVWLP
FT                   KSMISYEIER"
FT   gene            94127..94786
FT                   /locus_tag="MmarC7_0075"
FT   CDS_pept        94127..94786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0075"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: Methionine synthase B12-binding module cap
FT                   domain protein; cobalamin B12-binding domain protein; KEGG:
FT                   mmq:MmarC5_0840 cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65145"
FT                   /db_xref="GOA:A6VFB9"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFB9"
FT                   /protein_id="ABR65145.1"
FT                   /translation="MSELKERLIQELSDSVVEMDEEKTEELSKKYVENGFDAFEGITEG
FT                   LADGMNRAGVLYEEGEYFIPELLVCSDAMYLGLDILKPHLKYADSDSKFKAVVGVVEGD
FT                   THDIGKNLFKIMLETQGFEVYDLGRDVPPVEFVKKAKEINADVVGLSTLMTTTMDNMKV
FT                   VIDLLKEEGMREKTIVMVGGGPISQSFADKIGADGYAPEASKSARIAKELVTKLKN"
FT   gene            94811..95902
FT                   /locus_tag="MmarC7_0076"
FT   CDS_pept        94811..95902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0076"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="PFAM: Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   mmq:MmarC5_0839 uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65146"
FT                   /db_xref="GOA:A6VFC0"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC0"
FT                   /protein_id="ABR65146.1"
FT                   /translation="MDYPDKMTPVERATAKAKGEPIDRIACNPNIGNGMARIAGYKISQ
FT                   FNTDPEALADAIIKTYRRFGSDGARVFTDLFLISEAMGAKINMPYDNTADLEEPAINDM
FT                   SEFDKLKVVNPYTDGRIPVHLRALEIVRDEIASEVGVTASVVGPFTNAFFLIGVEKMTK
FT                   MLLKDPESVHKLCEISLQSCIALTDAVLEKGTGVTVSEPLSSCTVVSPKHFREFSAPYL
FT                   KRLIDHIKARTGKLVIHICGKTDPIWEDLVDMGVDVLSIDDIADLENCAETVGDRMVIA
FT                   GNVDPSGVLYAGSREDVRKATLKCIKQGIKAKKGYMIMSGCSLPVEVPVENIDAMMDAA
FT                   REAGWPITGEKLDYLLSIDKYKD"
FT   gene            96026..97054
FT                   /locus_tag="MmarC7_0077"
FT   CDS_pept        96026..97054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0077"
FT                   /product="methyltransferase MtaA/CmuA family"
FT                   /note="TIGRFAM: methyltransferase MtaA/CmuA family; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   mmq:MmarC5_0838 methyltransferase MtaA/CmuA family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65147"
FT                   /db_xref="GOA:A6VFC1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC1"
FT                   /protein_id="ABR65147.1"
FT                   /translation="MIKPKERLSKALKGEEVDRIPCICPGGMMNMITKDIMDITGVYWP
FT                   EAHTDAEKMVKLTVGMYENGGFENYGVPFCMTVEAESMGAGVKMGTDITEPRVTNYPID
FT                   SVTEYEKLNHINIDEGRGKTVLEAIELLKDKKSEVPIIANLTGPVSTASSLMEPVTYYK
FT                   ELRRKPDAAKEFMDFVTENLIEFGKAQLNAGADVLAISDPSGTGEILGPKMFKEFAIPY
FT                   LNKIIEETKDLAETGTIIHICGRLKSVYEEINSLKSDAISFDSITDVGQVVENVSRKAI
FT                   MGNVSTFTLENGTPESIERMSRACIKYGVDILSPACGIGVRTKLENIQAMVNVCKNSKR
FT                   GE"
FT   gene            97054..98832
FT                   /locus_tag="MmarC7_0078"
FT   CDS_pept        97054..98832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0078"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: mmq:MmarC5_0837 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65148"
FT                   /db_xref="GOA:A6VFC2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC2"
FT                   /protein_id="ABR65148.1"
FT                   /translation="MAIMDITNDKNKFEFKEGEFIFKILQENGIKIEVPCGGVGTCGKC
FT                   KVRVVSGEITQLSSEELEHLSKDEIDGGIRLSCLTKALGNVKIELLNLDENHKILTDGY
FT                   MPNLKINPPITKKIINLSECGVNKNNYEEIVNSELNAGKIQDIETLKALQKSFKTGNLT
FT                   SIFLNGELIGIEPEINEKIYGVAVDIGTTTVVASLIDVLAGIEIASETMINPQKEYGSD
FT                   VLSRIDFANKNENGLELLHNAIIDGINRLIFDLASNNKIAVENIYEVSIAANTTMMHFL
FT                   LNIDAESIGKSPYLPVFLSGKSIPSKDIGINVSPFGRIYCLPGVSGYIGADIVAGVIVS
FT                   ELLKTEKNILFIDIGTNGEIIFSKAGILSSCSCAAGPALEGMNISYGMRAADGAIEGIK
FT                   FAENGVELKVIGNKDPVGICGSGILDSISEIVRTGLVGKTGRLINSNGSDNEYKNLIIE
FT                   KNSKKFVQISKNPEILVSQKDIRQVQLAKAAIVSGFLALLDENNLTMGEIDEVIIAGQF
FT                   GKHLTVESLVGSGIIPEKLGKKVKYIGNSSKTGALMCLLSKESREEMESVSRDIKYFEL
FT                   STKENYEKLFVDSLNF"
FT   gene            complement(98890..99753)
FT                   /locus_tag="MmarC7_0079"
FT   CDS_pept        complement(98890..99753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0079"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="PFAM: Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   mmq:MmarC5_0836 uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65149"
FT                   /db_xref="GOA:A6VFC3"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC3"
FT                   /protein_id="ABR65149.1"
FT                   /translation="MKKTFSCISDNLEKIPKELTESNNLKFPNVHENLSDMVEFSKIMK
FT                   EHKKDLFCRVPFCMTVEAESFGAKINMGDEKYGPRAKEYAFKNLDELETIKPIDLTSGR
FT                   IKIVLDAVHALKESGEIPILAVEGPITIISSLMESRIFYKELRKNPERMNNFLNFLEDE
FT                   IVKYILSGIENGAKIISFGDPAGSIDIVGPKIFREYSGKIAKNIIEKVKSNEKNCIIHV
FT                   CGKTSVSLENEGMYEFNPINCNSETYGKAIYEIIRENTKTKIIGHNCIKKSIYKIPKNT
FT                   IWEIKE"
FT   gene            complement(99819..101123)
FT                   /locus_tag="MmarC7_0080"
FT   CDS_pept        complement(99819..101123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0080"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmq:MmarC5_0835 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65150"
FT                   /db_xref="GOA:A6VFC4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC4"
FT                   /protein_id="ABR65150.1"
FT                   /translation="MLSKDNIGKMMKYRWVIFAVLALVYFFVYFHRVSPAVMAGDLMTT
FT                   FGVGATSMGLLGSVYFYAYALMQIPSGIMSDKFGPRRVVAVFTLVAAAGAILTGIATDF
FT                   NMVIMGRLLIGIGVAAVYIPIMKMLSIWFRKNEFATQSGIMLAVGNVGALSAAAPLAYL
FT                   NTALGWQTVFMGLGVVSIALAILSYIVIRDKPSEMGLPNIEDIEAYENGEAVSTSAKTA
FT                   ENISIMDSIKMVLGKKSFWPLSIWFFFYYGSLMAYQGLWAGPYFKDILGWDKATYAGLL
FT                   TFIGIGLILGCPVSGYIADKVLKSRKKTLIIGTIMYTLLWFAVWFFNGMDNPLFYKILY
FT                   VLFGFFAGFFVVCYGQVKSLFPISIAGTSTSILNFFPFFGGAVLQQVCGLVIASYGLNA
FT                   LGGFTSAGYQMAWLLLAVGMVIATICVYFSEEQGL"
FT   sig_peptide     complement(101004..101123)
FT                   /locus_tag="MmarC7_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.809 at
FT                   residue 40"
FT   gene            101346..102467
FT                   /locus_tag="MmarC7_0081"
FT   CDS_pept        101346..102467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0081"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-component;
FT                   KEGG: mmp:MMP0836 2-hydroxyglutaryl-CoA dehydratase
FT                   (component D) related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65151"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC5"
FT                   /protein_id="ABR65151.1"
FT                   /translation="MDELKSIKKLDEVYSKRKDELYREKNEGKKVFGRFCVFVPTEIIC
FT                   AADAIPVGLCGGKESTIPSAEEDLPRNICPLIKSSYGFKKDKKCPYFEAADVIVGETTC
FT                   DGKKKMFEHMAEMSEMHIMHLPHFKDERSYELWLKEVYDFKDYVEKFTGNEITEEKLKE
FT                   AIDEENEERKLSHKLYELRSKIPSPITGTDALKIFQRSFLLNINDRIAILKELISELEE
FT                   RIKNGEGYSGKRILVAGCPMVAGNTKIVDIIEEVGGLVVGEETCTGTRKFDNLVNGYTI
FT                   DDLAERYFKINCASAFKNDSRIERIKELVKEQNADGVVYYTLQYCHTFNVEGALIEKEL
FT                   KNLGIPIIRIETDYSESDKEQIKTRLEAFVEMI"
FT   gene            complement(102506..103111)
FT                   /locus_tag="MmarC7_0082"
FT   CDS_pept        complement(102506..103111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0082"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: mmq:MmarC5_1097
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65152"
FT                   /db_xref="GOA:A6VFC6"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC6"
FT                   /protein_id="ABR65152.1"
FT                   /translation="MSKIYAVRKGRKTGLFETWGECENQVKGFSGAEFKSFTSKKDAEI
FT                   YLNQKTEEKQNNIQSNEFEKDVMYAWVDGSFNLKNKEYGAGVLTIFNGIEKEIKAKGNN
FT                   KELSKMRNVAGEILASELAMEYAVSKNVKNLIIYHDYLGIEKWCTGEWKTNKEGTTEYK
FT                   EKCKNYLKKLNIEFVKVKAHSGDKNNEIADKLAKESLL"
FT   gene            103463..104131
FT                   /locus_tag="MmarC7_0083"
FT   CDS_pept        103463..104131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0083"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   mmq:MmarC5_1098 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65153"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC7"
FT                   /protein_id="ABR65153.1"
FT                   /translation="MIENVKIIRKKIKNMYLVVNPDCSIVLKVPPHVSDEYIHSFIKKK
FT                   ENWIKKHLDNFESLNTNSAEKRYVDGEIFKYLGENYVLKIHLSKKEGLEILDGYFNLHI
FT                   SEIDDFEKKKKIIQKFYRKHAEIELFEIFKNSYMVVTKNIPDFAVRKMKKRWGSCSFHK
FT                   NKIILNERLIEKPKECIEYVVFHELAHLKYPNHSKEFYNYLTELMPDWKNRKIKLNEIC
FT                   "
FT   gene            complement(104146..104610)
FT                   /locus_tag="MmarC7_0084"
FT   CDS_pept        complement(104146..104610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65154"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC8"
FT                   /protein_id="ABR65154.1"
FT                   /translation="MDNIFELGFSVFTDNAHTSLLRYLLKYEKAEKKGFENISPRDVME
FT                   LGFETMFMSQVFEKELSKLEVSGPEKLALNIVRKYKHREFVHPIEKNYLVFTIWRNNEG
FT                   FLRYTLDNIKKPHNVENGFEKADCYLVPALDVLPHLRQIFLKIAIDKNIF"
FT   gene            complement(104681..105268)
FT                   /locus_tag="MmarC7_0085"
FT   CDS_pept        complement(104681..105268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0085"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mmq:MmarC5_1100
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65155"
FT                   /db_xref="GOA:A6VFC9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFC9"
FT                   /protein_id="ABR65155.1"
FT                   /translation="MTRNLILKKSKELFLEKGYSETSLSEIARACNISKGGIYHHFERK
FT                   EDLYIETMISILEENGKAVISSIENETRFENAIFEAIEQAIIIRTKYINNYNKDCEKTA
FT                   YFGPVSDAIKKFPEIWEFNNNIYKNAIDTLVNKIILAQETGEVKKELDPYSVAFHFCSI
FT                   FEGIHLVSYYTNQKFEDKSRLVISSFWELIKN"
FT   gene            106209..106607
FT                   /locus_tag="MmarC7_0086"
FT   CDS_pept        106209..106607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65156"
FT                   /db_xref="GOA:A6VFD0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD0"
FT                   /protein_id="ABR65156.1"
FT                   /translation="MDYRQGFTKITVYENIFTMKNIFQNISAKVNDVSALEIDTRGNCI
FT                   VLLIGFLWYISSNILLMVSKEVSYSLYYTILDLKAYHTIMTVLIFIAALFSTQIKLYVT
FT                   GYKPIIIIGNYFSMQKLFEILKEELNLK"
FT   gene            106712..106939
FT                   /locus_tag="MmarC7_0087"
FT   CDS_pept        106712..106939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65157"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD1"
FT                   /protein_id="ABR65157.1"
FT                   /translation="MEEIFMKEGVLEALEYINDNGFSEVILTKENVKISSKDLAVLMDL
FT                   GIIEVRMNENVVVFNLSNEGRKVLRNLKRS"
FT   gene            107041..107784
FT                   /locus_tag="MmarC7_0088"
FT   CDS_pept        107041..107784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0088"
FT                   /product="protein of unknown function DUF1112"
FT                   /note="PFAM: protein of unknown function DUF1112; KEGG:
FT                   mmq:MmarC5_1103 protein of unknown function DUF1112"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65158"
FT                   /db_xref="GOA:A6VFD2"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD2"
FT                   /protein_id="ABR65158.1"
FT                   /translation="MAINMRTSNPALSNDTFTGFNTYGQNQMTINGTVNKTIISLGIVS
FT                   ICAYFSWDVLFFGPYSGILMILTPILGFVMALATIFKKEWAPMTVPFYCVFEGLFLGII
FT                   SGYFELMYPGIIFQAVIATFGVLFSLLLAYKSKLIRATENFKLGIVAATGGIALIYIIS
FT                   LLLGLFGIPIPLIFGSGPVGILFSLFVVIIAALNLVLDFDFIEQGEKYGAPKYMEWYGA
FT                   FGLMVTLIWLYLEILRLLAKLRSRD"
FT   gene            complement(107810..108154)
FT                   /locus_tag="MmarC7_0089"
FT   CDS_pept        complement(107810..108154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65159"
FT                   /db_xref="GOA:A6VFD3"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD3"
FT                   /protein_id="ABR65159.1"
FT                   /translation="MNLRQNLQDISRFLIYTNNAIFILVSYAIFKIYTFLINDKSKIEQ
FT                   IGNILWLIWFLSSFLITFFFAYFEILNNFNDLTILFDWKFLGNTVVPIITLLFGNIKNG
FT                   LLEKWKRISE"
FT   gene            108474..108743
FT                   /locus_tag="MmarC7_0090"
FT   CDS_pept        108474..108743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65160"
FT                   /db_xref="GOA:A6VFD4"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD4"
FT                   /protein_id="ABR65160.1"
FT                   /translation="MNYAGPKIREYVALIVTTPILIVTTFYFIFKILNPDIFTEYCVMI
FT                   TSACSICFGNELLLKISKFGAIGAIALIGFLKIAEIKTSRLKNF"
FT   gene            complement(108770..109369)
FT                   /locus_tag="MmarC7_0091"
FT   CDS_pept        complement(108770..109369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65161"
FT                   /db_xref="GOA:A6VFD5"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD5"
FT                   /protein_id="ABR65161.1"
FT                   /translation="MFFRKIGAILIILMIFTGFSLYNSKKISEQILSREPVIFEIQGNS
FT                   AIMVGIINENIVYEVENLVENYPEVKTIVMLNVPGSVNSNANFKAARIVRTNNISTIVP
FT                   KNGYIASGGTVFFCAGVNRTIEENARVGVHSWKNEFITDASNIPRNNPVHKPYVEYFKE
FT                   MGISEEFYWFMISSAPSFGMYYLNDYEIKKYGLITN"
FT   sig_peptide     complement(109298..109369)
FT                   /locus_tag="MmarC7_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.722) with cleavage site probability 0.323 at
FT                   residue 24"
FT   gene            complement(109402..109875)
FT                   /locus_tag="MmarC7_0092"
FT   CDS_pept        complement(109402..109875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0092"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG:
FT                   mmq:MmarC5_1107 peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65162"
FT                   /db_xref="GOA:A6VFD6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFD6"
FT                   /protein_id="ABR65162.1"
FT                   /translation="MANTETAVFGMGCFWSAEELFRHVDGVISTEVGYMGGNVKNPTYG
FT                   QVCRGKSGHIEVVKVSYDSKIITYDDLLELFWKNHDPTTPNRQGWDVGEQYSSHIFYFT
FT                   DEQRIVAEKSLEKMQCYMDLKIVTAIKKASDFFPAEEYHQKYFMKKNNCILNF"
FT   gene            110123..110746
FT                   /locus_tag="MmarC7_0093"
FT   CDS_pept        110123..110746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0093"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mmq:MmarC5_1108 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65163"
FT                   /db_xref="GOA:A6VFD7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD7"
FT                   /protein_id="ABR65163.1"
FT                   /translation="MIETTQLFYFLIASAALTILPGPDILFVTVQSISRGKWAGISTAL
FT                   GLCTGLIVHTTAAAIGISAIIYNSAVAFTIVKYLGALYLLYLAVTVLCDKSALVSESVV
FT                   KLDKMALYKKGIFMNLLNPKISLFFLAFLPQFVNLNSGSVSIQMIILGLVFMLQAILIF
FT                   SAVAVFSSFFGEKILKSQKFGKYINIAKAGIFGVIGIQLALSTK"
FT   gene            110771..112024
FT                   /locus_tag="MmarC7_0094"
FT   CDS_pept        110771..112024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0094"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmq:MmarC5_1109 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65164"
FT                   /db_xref="GOA:A6VFD8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD8"
FT                   /protein_id="ABR65164.1"
FT                   /translation="MSSKKLGPCTLSGLIVGPILGSGIVIIPPIVYDILKDYSIFAWVI
FT                   MMVIGGIFAYFASKLCLKFPGDSGLTEVVGHSFGKSYKDLNAYYLLIALAMGPLVVIMV
FT                   AGEYLSVLFSNFMFGAEFYSAILMIIGGIILSRNISSVGKISMIISSVISTILVVGGLF
FT                   TILFYRKEVLFTETAINTIDIGYSFLIMFWSIIGWEILGNYSLEVENPKKTIPTAALLS
FT                   VIAMSVVYLIVSGALQVLDVEKLGPINPISGLSLILYPLFGDYSSIILSITITGLCLCS
FT                   FLMLIGGASRLVYAQARAEVFPKIFKYRSKTNAPLSGILLMVFTNFLTLFAVYLDLISL
FT                   TGIIAAVNAFLISNIIMAAIASIKVFDNLLEKGFAIFLAVSFLSMFLFSSKIVIIIILV
FT                   MFFGTIANNLKKSNFKLK"
FT   sig_peptide     110771..110836
FT                   /locus_tag="MmarC7_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.643) with cleavage site probability 0.621 at
FT                   residue 22"
FT   gene            complement(112031..113392)
FT                   /locus_tag="MmarC7_0095"
FT   CDS_pept        complement(112031..113392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65165"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFD9"
FT                   /protein_id="ABR65165.1"
FT                   /translation="MKKIVFSAVIFFIMLSGCIEDSEIVSEDFNILTNFETLNADINSE
FT                   TFENGDELTINGILIGKSSEVNIEISKNGSPNYIISENVSLSNLMFEFKINTKSLEADQ
FT                   YSAKITTPSGTCKILNFEVIENENYALNDNYESLSEQYCPDTHENYYSRNYSWDYDNKK
FT                   WHLELSLSKSAYEYYKNKPHNREDNYAQYALSDYDKTCLDMMIQSFEEASLKNEYSKYD
FT                   EALFIASFVQSLDYTSDNETTGFDEYPRYPLETLVDMGGDCEDKSILAAALLNELDYDV
FT                   VLIDLSDHMAVGIGCDGEVYGSYYEYNGKKYYYLETTDKNWVIGEIPEEYRDEKVIIRP
FT                   LIQIPRIIMNFFAERIAYDRTYVYYNVTCNLENLGPGTAKNPKVNIAAIAIEKGENYIW
FT                   KPDITVELENYEEGDYGVVNSILKIPRNKVTKIQCTIYGDNFKTVEVSSEEFNT"
FT   gene            complement(113437..114066)
FT                   /locus_tag="MmarC7_0096"
FT   CDS_pept        complement(113437..114066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0096"
FT                   /product="Protein of unknown function DUF1847"
FT                   /note="PFAM: Protein of unknown function DUF1847; KEGG:
FT                   mmp:MMP0851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65166"
FT                   /db_xref="InterPro:IPR014997"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE0"
FT                   /protein_id="ABR65166.1"
FT                   /translation="MYYCALCNIKACKSGEPEKMPKKCPNSNEIVEKSKELYLKEENEK
FT                   IAYNSALVESEGYCKLTRIEETILFAKKMNYKKLGIAFCTGLSNEAKVLQNIFLDHDFE
FT                   VESVICKAGSIPKEFLKITENEKVHEFEFEAMCNPIGQALFLNETKTDLNIILGLCVGH
FT                   DSLFIKYSKAPVTIIGVKDRVLGHNPLAAIYTANSYYKERLFKNKK"
FT   gene            complement(114122..114598)
FT                   /locus_tag="MmarC7_0097"
FT   CDS_pept        complement(114122..114598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65167"
FT                   /db_xref="GOA:A6VFE1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE1"
FT                   /protein_id="ABR65167.1"
FT                   /translation="MVFKIPKMAREEYDSLIEKNYISRIAFLGPKYPYIAPFLYVFNEN
FT                   NIYFLSTKYGRKIDLLKNNPYVSVEIEKFSEDMSCYKFITLQGKIVPEYHLEKKKEIRN
FT                   QFVNLIISKNLSNMVLEALGQNPDDPIDSLITADNTYVWKLTEVEDIVALKNSE"
FT   gene            114930..115757
FT                   /locus_tag="MmarC7_0098"
FT   CDS_pept        114930..115757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0098"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase iron protein; PFAM:
FT                   NifH/frxC-family protein; KEGG: mmp:MMP0853 nitrogenase
FT                   iron protein (nitrogenase component II)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65168"
FT                   /db_xref="GOA:A6VFE2"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE2"
FT                   /protein_id="ABR65168.1"
FT                   /translation="MVRKIAIYGKGGIGKSTTTQNTVAAMAYFHDKKVMIHGCDPKADS
FT                   TRLILHGKQQTTMMDTLREKGEEECTPEKVIDVGFCGVKCVESGGPEPGVGCAGRGVIT
FT                   AITLMEQQGVYEDNLDYVFFDVLGDVVCGGFAMPVRDGKADEIYVVASGEMMALYAANN
FT                   ICKGMVKYAEQSGVRLGGIICNSRNVDGELELLQEFCDKIGTQLIHFVPRDNIVQKAEF
FT                   QKMAVVDFDDSCNQALEYKALAQKIIDNKNLVIPNPMTMDELEELTSKYGFLD"
FT   gene            115800..116117
FT                   /locus_tag="MmarC7_0099"
FT   CDS_pept        115800..116117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0099"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mmq:MmarC5_0659 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65169"
FT                   /db_xref="GOA:A6VFE3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE3"
FT                   /protein_id="ABR65169.1"
FT                   /translation="MKMIRAVVRPSKAEEVVDALAESGCVALTKMDVIGRGKQKGIKID
FT                   QIYYDELPKTMLMIVVEDDAAESVVETVTKTAYTGSFGDGKIFISPVEEAYTVRTRSCG
FT                   L"
FT   gene            116127..116492
FT                   /locus_tag="MmarC7_0100"
FT   CDS_pept        116127..116492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0100"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mmq:MmarC5_0660 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65170"
FT                   /db_xref="GOA:A6VFE4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE4"
FT                   /protein_id="ABR65170.1"
FT                   /translation="MKEIIAIIRPSKMAATKNVLEGLGFPAMTANRVLGRGKQKAIVGE
FT                   LGFEIDNKELLNQPGDMRYIPKTMMTLIVPDEDASLVVEAIMKVNKSGQYGDGKIFVCP
FT                   IEDIITVRTSERGESAL"
FT   gene            116546..117976
FT                   /locus_tag="MmarC7_0101"
FT   CDS_pept        116546..117976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0101"
FT                   /product="nitrogenase alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase alpha chain; nitrogenase
FT                   component I, alpha chain; PFAM: oxidoreductase/nitrogenase
FT                   component 1; KEGG: mmq:MmarC5_0661 nitrogenase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65171"
FT                   /db_xref="GOA:A6VFE5"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005974"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE5"
FT                   /protein_id="ABR65171.1"
FT                   /translation="MPFCLLDVDKDIPEREQHVYIKDSKDTNGHCQKCNTTTIPGSMTE
FT                   RGCAFAGVKGVITGAIKDVLQVVHSPVGCSAYGNGTTKRYPTNSTMPDGSTFPVENFNL
FT                   KHIVGTDLSESDVVFGGMKKLKATIREGAKEYPFVNAIYVYATCTTGLIGDDLDAVCKE
FT                   MQAELGKDVVAFNAPGFAGPTQSKGHHVGNFTIFEKLVGTKEPLETTDYDINLIGEYNI
FT                   DGDYWVLEKYFDAMGIRVLSKFTGDACHDELCWMHKAKLSLVRCQRSATYVAKLIEEKY
FT                   GVPYIKVDFFGPEYCAENLRTVGKFFGKEIEAEAVIKKEMEKIQPEIDFYKSKLQGKKV
FT                   WISAGGPKSWHLAKPLEEYLGMDVVALSGLFEHEDGYEKMQERAKDGTIIIDDPNTLEM
FT                   EEVVEKYHPDIVLGGIKEKYFFHKLGVSSVMIHSYENGPYIGFEGFVNLAKDIYTAIYN
FT                   PAWSLMEFEDEEPGDTNE"
FT   gene            117969..119357
FT                   /locus_tag="MmarC7_0102"
FT   CDS_pept        117969..119357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0102"
FT                   /product="Nitrogenase"
FT                   /EC_number="1.18.6.1"
FT                   /note="PFAM: oxidoreductase/nitrogenase component 1; KEGG:
FT                   mmq:MmarC5_0662 nitrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65172"
FT                   /db_xref="GOA:A6VFE6"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE6"
FT                   /protein_id="ABR65172.1"
FT                   /translation="MSELNVIKKERTSVINPLVTCQPLGAMYAVMGIYRGMPLVHGSQG
FT                   CSTFVRYGFSRHYREPADIAVTSLHEDAAVFGGRKNLISGLGNLAQRFKPDVMGVVTTC
FT                   SSEIIGDDVGGFIKTAKQEIIKKMGEEAASKIKIVQINTPSFVEHQYKGYDNAIKAIVD
FT                   TLAEPKDEENGKLNIVPGIVNPGDIREVKHMLSLMGVEGILLTDTSDPFDSPLRPSVAE
FT                   KTPYYQKGGTTVAEIQDCANSLGTISLANYASSAPASLEKKYNMPSKVSEAPIGIKNTD
FT                   SFIRTVKKFTGNDVTEEILDERGIVIDAMADVASRYLFGRTVAIYGDPSITVGMARFIT
FT                   ELGMIPKVVCTGAKNDYFIDDLKKVAKESDEDIDALSGQDLRALDVYLKENPVDLLIGH
FT                   SDGRLMAKDLGIPLYRVGYPVYDRVGYQRRPIIGYNGALNLVDGITNTIIDKYYEPQDW
FT                   KLQQ"
FT   gene            119381..120823
FT                   /locus_tag="MmarC7_0103"
FT   CDS_pept        119381..120823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0103"
FT                   /product="nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase MoFe cofactor biosynthesis
FT                   protein NifE; PFAM: oxidoreductase/nitrogenase component 1;
FT                   KEGG: mmp:MMP0858 nitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65173"
FT                   /db_xref="GOA:A6VFE7"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE7"
FT                   /protein_id="ABR65173.1"
FT                   /translation="MVLNLDTENRKTQNGNNCDDFDIEVKIPKSIFEKLKSIEALKARE
FT                   SQMCISGKDDSIPTCDKNSTPGIITQRSCVYGGARVVLMPITDAVHLVHGPVGCAACTW
FT                   DIRGSKSTGDKLYKNGFTTDLQESDIVFGGEKKLYESILEVHKLYSPGAIFVYSTCVVG
FT                   LIGDDIKAVCKQAEEATGCRVIPVQSEGFKSFNKSAGHKLACDAMLDYLIGTEEPEEEH
FT                   PYSINIIGEFNVAGDLWGIIPLYEKMGVKVHTAITGDSTVKKVASAHRSKLNIVQCQKS
FT                   SNYLAAQMQKKYGIPNLKVNFFGIDETTKSLRAVAEFFGDEEMIKKTEELIKSEVKNLR
FT                   DEISEYKKDLAGSTVAIYSGAHKSWALVSAFGELDMEIIMSGTQNGKPEDYQKIREHVN
FT                   EGTLIVDDASSMELVQLLKEYKPDILISGAKEKYLSLKSGVPHCDFNHDRITAFSGFQG
FT                   FINFARVVHTAVMTPVWKLSRK"
FT   gene            120840..122216
FT                   /locus_tag="MmarC7_0104"
FT   CDS_pept        120840..122216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0104"
FT                   /product="Nitrogenase"
FT                   /EC_number="1.18.6.1"
FT                   /note="PFAM: oxidoreductase/nitrogenase component 1; KEGG:
FT                   mmq:MmarC5_0664 nitrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65174"
FT                   /db_xref="GOA:A6VFE8"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE8"
FT                   /protein_id="ABR65174.1"
FT                   /translation="MTEKKFAVINPCKICQPMGAIFALMGVKNSMPLIHGSHGCSTYMR
FT                   FQLGRHFKEAVNVASTSMSEANAVLGGEENLKHAIRNVSRIYGPEIIGVTTSCLSETIG
FT                   DDVEGIIRLFKKQNDDLPEIVPISTPSYKHTHVEGYDSTVKALVEHLATSSKPNSKLNV
FT                   ITGMVSPGDIAETKKLLLEMGIESIILTDTSESMDAPYDGEVSFVMSAGTTVEEIKDTA
FT                   NSFATISLCKHANSAAKFLHDAYGIKSVSPYLPIGLQSTDEFINELCKLTNKDIPEQIT
FT                   RERGKLIDAMIDAHQHNFGRKVAIYGDPDVVVGFTRFVLELGMIPSIVCTGSESKTFVE
FT                   DIEAVTKDSKHKPVILAPGDLYDLHQEIKKSKVDLLIGNSYGSRIAGAENIPLIRMGFP
FT                   IYDRVGAQRITCVGYTAGIRLVDTITNTILDRYFDEFGWALNEDTEVDHGDFESSNCIN
FT                   "
FT   gene            122182..122502
FT                   /locus_tag="MmarC7_0105"
FT   CDS_pept        122182..122502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0105"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: mmq:MmarC5_0665 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65175"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFE9"
FT                   /protein_id="ABR65175.1"
FT                   /translation="METLKVAIASTDGVNVNMHFGAATHFLIFEIKDNVAEFMEFRENP
FT                   TTTIKEHTDRWNYALDLLKDCGAIFCSRIGDNPKSVFEGKGVKIVTTENTLKEALKEFL
FT                   TA"
FT   gene            123079..124380
FT                   /locus_tag="MmarC7_0106"
FT   CDS_pept        123079..124380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0106"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein; KEGG: mmp:MMP0861 lysine
FT                   2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65176"
FT                   /db_xref="GOA:A6VFF0"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF0"
FT                   /protein_id="ABR65176.1"
FT                   /translation="MNELSDESIVKYTKKISENATIDNWNDYKWQLSNSIKDVDTLENF
FT                   LGITLENEEKKEIQKAIEVFPMSITPYYASLIDIKNLDKDPIYKQSVASSKELILENFE
FT                   MEDPLSEDEDSPVIGITHRYPDRVLFYINPNCAMYCRHCTRKRKVSEKSSNPSKEEIQK
FT                   AIDYIRNNDKIRDVLLSGGDPLLLSDEYLDWILSEISSIKHVELIRIGSRVPVVLPQRI
FT                   TDNLVNTLKKYHPIWINTHYNHPVEITKESKKALDKLSDSGIPLGNQTVLLAGVNDCPY
FT                   VMRKLNQKLVSSRVRPYYLYQCDLSKGISHFRTPVSKGLEIIESLIGHTTGFAVPRYVV
FT                   DAPGGGGKIPVMPNYIVSWGSDRVILRNYEGIITTYVEPSNYGGCSKSCDKCDRMCIGD
FT                   FEINQTGIEKLITDVDNSISLIPENNERVARRDD"
FT   gene            124382..125206
FT                   /locus_tag="MmarC7_0107"
FT   CDS_pept        124382..125206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0107"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmq:MmarC5_0667 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65177"
FT                   /db_xref="GOA:A6VFF1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF1"
FT                   /protein_id="ABR65177.1"
FT                   /translation="MEKIIEINDSVIQISDLNDRIYIMKLGKDADGVIGNVNNVCKEKN
FT                   LSKVFAKVSGNKKEIFEKNGYICEGKIKNYFLDDDAYFMSKFFEESRNISKFSKEAKDV
FT                   LNCVDTVDVDLSANIDEKFHLKIANETDAENLSKHYSKVFETYPFPINDPNYILKTMQT
FT                   NVKYFILEDNGKIVAAASCEMDSKNKCVEMTDFAVLEEYQKLGLSKYLLYIMEKIMKDN
FT                   GYRVFYTIARSISYGMNITFKKMGYTYSGTAINNTNICGNFEDMNFWYKLVE"
FT   gene            125356..125832
FT                   /locus_tag="MmarC7_0108"
FT   CDS_pept        125356..125832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0108"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmq:MmarC5_0668 CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65178"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF2"
FT                   /protein_id="ABR65178.1"
FT                   /translation="MKELETAIAKYHAMKLKDILPPKDTLPVVCNDSSILDVLEILRTR
FT                   HHVWVINCKDDGKLIGVIRYLDVINFIMPPEKHSTFIGTTRTVLMSIQGGAEVASEVME
FT                   KSAIKINYNKSILYALEKMKNYNLQLLAVVDDENKLVGEVSLRILINKFLDLCF"
FT   gene            125842..127008
FT                   /locus_tag="MmarC7_0109"
FT   CDS_pept        125842..127008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0109"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   mmq:MmarC5_0669 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65179"
FT                   /db_xref="GOA:A6VFF3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF3"
FT                   /protein_id="ABR65179.1"
FT                   /translation="MSISWVLFTVGLCLIFGKIGNEIMWRIGFPSVFGEIIVGIIFGNL
FT                   LFFGIVDPTHLTLHENDIFDFLSTVGIMFLLFLSGLEIDIHKLKKTEYISIVAAVFGAI
FT                   FPLILGYIVLSEFGYTAKESIVGGVILTATSIGITARLLMDLKVLKTDVGAAAISASIL
FT                   DDFLGLILLILAVGSGSLLGLISEITVFFIITGYFGWKLINKYLIFAEKFHIEKTVLSF
FT                   TIALMFLFSFLSESWFEVAIEGAFMAGLILSKTSEGKMLAKEIKSIGNSFLIPLFFIYT
FT                   GARLNLTAFLNHEALILATIFIVVGVLSKFVGWGLGAKLMGKWNLKKSIQLASSSVPRA
FT                   EIALINLMIAVSAGVILEENISKFIAATLIFVTFSIVITPPLLKKVFE"
FT   gene            complement(127062..128465)
FT                   /locus_tag="MmarC7_0110"
FT   CDS_pept        complement(127062..128465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0110"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mmq:MmarC5_0670 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65180"
FT                   /db_xref="GOA:A6VFF4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF4"
FT                   /protein_id="ABR65180.1"
FT                   /translation="MNSENYSKNDLEKWDKEYVWHPFTQMKEYSEGNPLLIEEGDGIYL
FT                   IDVNGKKYMDAVSSIWCNFFGHSEKRIADAISKQALKIGHSTQLGCGNVPSAILAKRYV
FT                   DFSPEQFTKVFFSEDGAEAVEIAVKMAFEYCKLKGFSNKTKFVSVKEGYHGDTVGAMSV
FT                   GGSELFHGCFKPLLFDGYHASTPYCYRCEYCNFKDTDEQNKLGCEMKCLKEMENLIRTN
FT                   KEEIFCVILEAGVMGSAGMIPYPKGYIEGVAKLCKELDIIFILDEIATFGRLGRAFYSD
FT                   IDELKELEKPDIICLGKGITGGYLPLALTLATDEIYNAFLGTFDECKQLFHGHTYAGNQ
FT                   IICASAIETVNILEETNICEEIRPNIKLLHENLDKLKEFPCVGDIRKSGYMIGIELVKN
FT                   KETKEPYNYGYKAGYKTAARLLEKGIYIRPIGNTLIFVLPLIIKPEEIELLTKKIYESI
FT                   SELLDEKIL"
FT   gene            complement(128631..129518)
FT                   /locus_tag="MmarC7_0111"
FT   CDS_pept        complement(128631..129518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0111"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: mmq:MmarC5_0671
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65181"
FT                   /db_xref="GOA:A6VFF5"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF5"
FT                   /protein_id="ABR65181.1"
FT                   /translation="MKYGTLFAIAILGLAVMFSGCVQSSQVVEDTQKGTIKFGLPPWPG
FT                   VTVKSNVVKVILEEQGYDVELNQLDAGITYAKLADGELDILLAGWLPTTHQDYWEQYGE
FT                   QLEMVHVNVGKTALGLAVPTYTYEAGIQSITDLNGNEELFDGRIVGIEPGAGIMSNTEK
FT                   AITLYGLEGYELQSSSTPAMMAELARAMNENENIIVTVWEPHSVFFKFNITMLDDPEKV
FT                   YGDGDKVYTIARNDFKDDFPEVYEFLQKFEVDPSVQSEWIYKYSDEGMDPEEVAEEWVA
FT                   NNPELVAEWTSHMN"
FT   sig_peptide     complement(129444..129518)
FT                   /locus_tag="MmarC7_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.878 at
FT                   residue 25"
FT   gene            complement(129534..130367)
FT                   /locus_tag="MmarC7_0112"
FT   CDS_pept        complement(129534..130367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0112"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmq:MmarC5_0672
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65182"
FT                   /db_xref="GOA:A6VFF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF6"
FT                   /protein_id="ABR65182.1"
FT                   /translation="MADTFNLGIGKFLVNLIDFLIDNYSGFFDIISSVIQSIVDFFLFL
FT                   LFAINPYLMIILISILVWKTVNLKSVPFTAFFLVIILMMGLWDTSMITLSLIITSTLIA
FT                   LIFGIPFGIVKARSKLVSTLLDPLLDVMQTLPSLAYLIPAVLFFGIGEVPGVIATVIFA
FT                   MPPAIKLTSLGIEQVSEELIEVGKAFGGTSWQILTKIELPTAVPSIMMGVNQAIMLSFS
FT                   MVVIAGFIGSGGLGEVIISGIQRYSLAPALEAGIAVTFLAVIFDRITRNLVGSKI"
FT   gene            complement(130381..131550)
FT                   /locus_tag="MmarC7_0113"
FT   CDS_pept        complement(130381..131550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0113"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit; PFAM: CBS domain containing protein; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   mmq:MmarC5_0673 glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65183"
FT                   /db_xref="GOA:A6VFF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF7"
FT                   /protein_id="ABR65183.1"
FT                   /translation="MNDPIIQITELYKIFGKKPEKAYPLIKEGFSRKEIKEKTKQVVGL
FT                   KNINFDVKRGEIFVIMGLSGSGKSTLIRCINRLIKPTYGKIVLENGVDISKMREKDLLE
FT                   IRRKYFGMVFQKFGLLPNRSVLENVALGLEIQGIGLEERIEKSEKALSLVGLKGWEKSK
FT                   ISELSGGMQQRVGLARGLAVNPEILLMDEPFSALDPLIRLEMQELLLKIQKKMKKTIIF
FT                   ITHDLNEAIKLGDRIMILNEEGSLVQLSQPEEILLNPQNDFVESFVKEVDKTTVIRAES
FT                   LVKKPEFTLNTRMEKENAIKILGDLSLDFAYVLDDSGKYVGVVNKEELQNSEQIIDCIQ
FT                   KIKPLEDVKTINQGLPQFISSDYPVPVVDDENNFLGYVEFEEVINLIKN"
FT   gene            complement(131897..133705)
FT                   /locus_tag="MmarC7_0114"
FT   CDS_pept        complement(131897..133705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0114"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   mmq:MmarC5_0675 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65184"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF8"
FT                   /protein_id="ABR65184.1"
FT                   /translation="MKIKGVLLLFSIFFIMNTCYAGTIGSSTEDWIDSGLEYFGNGNFE
FT                   KSIESFDETLRINPYNMEALVSKGYILYAINESEKAIECFDKALEINSDYYDTWQYKGY
FT                   ALHDLERYEEAIECFDKSLEIYEENPEVYYMKGASLYGLERYEEAIECLDIALETYPNN
FT                   IYMLTDKGNTLYELERYEEAIECFDKALKYVSYLNAWNDKGNTLCKLERYSEAVQCYDK
FT                   ALEIDSSSYVLWGNKGYAIYELGKYEKAIICFDRSLELNFDYLESNYYKGDSLYELERY
FT                   EEAIECYDKALEIDPKNEYIWYSKGCSLSNLERYEEAIECLDKALEIDSKNEKFWNKKG
FT                   YSLNELERYEEASECLDKALEIDSKNEKFWNNKGYALAGLERYEEAITCYDEALELNNN
FT                   YSKAYKNKGYSLAGLERYEEAIECYDKALEIDSNYTKAQQNKGNALFELGKYEEALECY
FT                   DLVIAVDKSNEKAWADKGNALFELERYEEAIECFDKAIELDSNDKEIWNNKGDTLYKLE
FT                   RYEESIECYDEALELDSEDEELWNNKGNIFFKLENYEEALKCYDRALEINTNFELAKLG
FT                   KQDTEDQLNSFSYILANFFKKIFGGN"
FT   sig_peptide     complement(133640..133705)
FT                   /locus_tag="MmarC7_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(133865..134497)
FT                   /locus_tag="MmarC7_0115"
FT   CDS_pept        complement(133865..134497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65185"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFF9"
FT                   /protein_id="ABR65185.1"
FT                   /translation="MLGGLFPKVHDSVKVWKPKFYPNEKGYQDDLFHHLRTNLNNNSFF
FT                   GSSNYSVRMESGRNLCDIAVERAVGIELKHNLDKKAKVDRLLGQVSRYMQDYSEGVLIV
FT                   LTGETSTKTLEDLKYELRSINTGDSMGFSQKNIKIIEKKTPKLRTTSNKPKAKEPGSKK
FT                   PTGKTSKPKSAKKPATSKKPAEPKKTSKKSNDPFKIELPKLELPKFF"
FT   gene            complement(134779..134973)
FT                   /locus_tag="MmarC7_0116"
FT   CDS_pept        complement(134779..134973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65186"
FT                   /db_xref="GOA:A6VFG0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG0"
FT                   /protein_id="ABR65186.1"
FT                   /translation="MFIMGIIEDAGRKTLGEIIITLTFFLVLPITGLALILGHSVIGIL
FT                   GLVFCIVLLHLGTDLKKRK"
FT   gene            135137..135574
FT                   /locus_tag="MmarC7_0117"
FT   CDS_pept        135137..135574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0117"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   mmq:MmarC5_0677 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65187"
FT                   /db_xref="GOA:A6VFG1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG1"
FT                   /protein_id="ABR65187.1"
FT                   /translation="MTDFMDEAIKEAKLGLKEGGIPIGAVLVYKNKIIGRGHNRRVQNN
FT                   SAILHAEMDALENAGRLTSDVYRNCELYTTLSPCIMCSGAVLLYKIKKVVIGENKTFLG
FT                   AEDLLLKNGVAVEVLNDERCVKMMKDFIKNNPKLWNEDIGE"
FT   gene            135603..136556
FT                   /locus_tag="MmarC7_0118"
FT   CDS_pept        135603..136556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0118"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding protein; KEGG: mmq:MmarC5_0678
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65188"
FT                   /db_xref="GOA:A6VFG2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG2"
FT                   /protein_id="ABR65188.1"
FT                   /translation="MKIVVLDGYTMNSGDLSWENLEELGELTIYDRTSESEVIERISDS
FT                   EIVITNKIIIDKAVFEKCKNIKYVGVTATGYNVVDTNLAKELGIVVTNVPAYSTDSVAQ
FT                   AVFSYILEHVQNVSKYNESVKSGTWVNSKDFSYRKFPIIELAGKNLGIIGFGAIGKKVA
FT                   EIGIAFGMNVFVNTRTVSNTNLNVKFVSKEEIFKNSDFLTLHCPLTDETKELVDEKTLK
FT                   LMKKSAMLINTGRGGLVNEKDLADALNLDNIARAGLDVLSTEPPKENNPLINAKNTIIT
FT                   PHIAWASYEARKRLMDVTVNNVKSFIEGNPINIVNK"
FT   gene            136606..137799
FT                   /locus_tag="MmarC7_0119"
FT   CDS_pept        136606..137799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0119"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mmq:MmarC5_0679 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65189"
FT                   /db_xref="GOA:A6VFG3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG3"
FT                   /protein_id="ABR65189.1"
FT                   /translation="MKPADVVNFAGRNITQKKTQSFLTIIGVVIGILAIVSLISLGYGV
FT                   QNYITGEITTIGANIISVIPSQNFGGPAVSKTFNDNDVDAVKSVRGVDEVVAVWIGSYE
FT                   LEYRDQSIYGNILVVEPSKFTYVYSTTWGYEPYKGRWIEDSDKYSCMVGYSLATNSFDN
FT                   DIDIGDKITINGTKYKVIGILEETGNPATENSAILSKDVGQALFEIDDEYNRMIVSVKS
FT                   GEDVIRVSEDIQKEVEDSRGDENFSVLTAEQLAESINNIFKVLTIFLVGVAGISLLVGA
FT                   VGISNTMHMSILERRKDIGILKALGAENTTILSIFVVEAGFLGLFGGIIGTIIGILIAK
FT                   AVEYIAAASGYGIIKAWISWELIVGVLIFSFVVGILSGYFPARSGAKLNPVDTLRGE"
FT   gene            137925..138839
FT                   /locus_tag="MmarC7_0120"
FT   CDS_pept        137925..138839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0120"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase; KEGG: mmq:MmarC5_0680
FT                   porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65190"
FT                   /db_xref="GOA:A6VFG4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG4"
FT                   /protein_id="ABR65190.1"
FT                   /translation="MKLRIGTRGSTLAMVQTEYIAGLLNDLGVETEIVIVKTTGDKDQT
FT                   KKLVDLGLGVFTKELDSKMLENEIDIAVHSLKDVPTLWSDELQITATPKRESPDDIIIW
FT                   RKDSDFDIEHDELDVGTSSIRRTSFLQFTHPNLTPKLLRGNVATRIDKLRNREYDTIIM
FT                   AKAGLIRQGIDLSEFNYTKLDMLPAPAQGVIGVASRKADIKINEILEKICDKKTYIEAT
FT                   AERWALKEYGGGCQAPFGAFAVYDTEDGILNLRCELVDEQGTIKRVKSNEGFVICTTDE
FT                   VELAKELGARVGALFKEIETFTY"
FT   gene            138929..140659
FT                   /locus_tag="MmarC7_0121"
FT   CDS_pept        138929..140659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0121"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mmq:MmarC5_0681
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65191"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG5"
FT                   /protein_id="ABR65191.1"
FT                   /translation="MADYNNAVVFYDACGIEYSKQIKKTLERGFERECFLINLDAHENT
FT                   LSKINSALKTSKYVIFMFSSIYSNEQLLSEAKNAFNSDKQIISLKLNDPSLKQQISVHQ
FT                   SEFTDNYSLSKKVSEEVEKLKKMEIRGPDFIESIISFNMGNIYFNFGKYDEAIRCYKKA
FT                   VKIIPDFVDALNNFNSLSNLRLSEIEDKRPAIYKDAKIDEIVPDIFSNAVEEPEETQKC
FT                   TELEPEELEDLILEGEIGAGPEPELEKEVETPVEENIETELETNIEDEMVEIEELNNEK
FT                   EVIFEEEPQEDIEIESDDVDDELISDAEIEEFGIEENFEEIEEDIPETEEISDETEIIL
FT                   EEEIESEIDEVVVEISEEIIEDIEILEVVDESEDIEKIIDADTSGELESFEELLDKNEI
FT                   EEETQELILGDITDTGFAEVLTFANALYESGDFNAAEVEYKKAIILNPNYSEAHNNYGC
FT                   LLEYLERFDEAEVEFKKAIELNVLNIRAHNNLATLLAKAEKYEEAEMHYKKAIELDPEY
FT                   WGAIYNLGAMYATLKRYDDAISQVKSMIKIFRSEGNIKEVLELKKLVKHLKKLKIQNGK
FT                   "
FT   gene            complement(140670..141530)
FT                   /locus_tag="MmarC7_0122"
FT   CDS_pept        complement(140670..141530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0122"
FT                   /product="SAM (and some other nucleotide) binding motif"
FT                   /note="KEGG: mmp:MMP0874 SAM (and some other nucleotide)
FT                   binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65192"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG6"
FT                   /protein_id="ABR65192.1"
FT                   /translation="MEVDWAEYYRKNHGKTQFKSEKESKNFWDTFSKNYAKNVLNNKNG
FT                   WVGHNIDYLKNEFNIDKNTSILEIGPGPGTYTIPLAKEVKEITVVEQSTGMIDILKNRM
FT                   KEECIDNINIINKRWDNFELNREFNPDIVFSSYSLGVDDMEESLKKMNNYAEKYCCILT
FT                   FGTRQAWREIYNKIRESIFEQKPERKEFGMTYILIYNILHQLGIYADVKLSEKSFSQTF
FT                   NNLDDAAEHYLDRFKARGELTLNDEQYSKIKEILSEELTKAEDSWTFTKTSKEAMITWK
FT                   KEQNI"
FT   gene            141716..143314
FT                   /locus_tag="MmarC7_0123"
FT   CDS_pept        141716..143314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0123"
FT                   /product="S-layer protein"
FT                   /note="PFAM: S-layer protein; KEGG: mmq:MmarC5_0683 S-layer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65193"
FT                   /db_xref="GOA:A6VFG7"
FT                   /db_xref="InterPro:IPR006454"
FT                   /db_xref="InterPro:IPR022650"
FT                   /db_xref="InterPro:IPR022651"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG7"
FT                   /protein_id="ABR65193.1"
FT                   /translation="MAISIKKIVSIGLGGLMLGSALSSSAFAVEKVGDVDSFVSDLVST
FT                   DNSNVDIIVGSNSVASDVVSAANIAAKLGSLSFLEQTGEEASATLSIGSKSKSDNFNLV
FT                   GSGVTDSLFAVSVDDDYVSSISNVDFHSSTNLDATGYVSLEDLGNLMEVSDTDPSSWVT
FT                   GSDNDVSAEFMFLRLKTDVADWKVNSDEMSYMTLLFDENTGVPAGLKGMCPGRNIAYLG
FT                   EEWTLMGMSCDADKVVLGKEVYRGALKEGESYSVNGCEIKIDSIITDGTDYKVSAKILK
FT                   DGAVVASTYNEAPTNLMANGIGIRFQKVYESIDSNAAYADVVIVNNVKGMPLGSEVIPD
FT                   YEIYSVLYTGGTFQYTDDFVKGQKNVGLALKYVGDDLTGLGSDDSVKVADYADFLFDDE
FT                   GSSATKLNVFFEMNEEKEVSLIQTQKTNVLNVKILAEEISTGDDESLTIAPIVKLDTET
FT                   SMETSENPLILIGGPVINSITKELSNAGLIAIDNESPATLALAAGAANGNDVLVVAGGD
FT                   RSATTDAANALIAMI"
FT   sig_peptide     141716..141802
FT                   /locus_tag="MmarC7_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            complement(143324..144382)
FT                   /locus_tag="MmarC7_0124"
FT   CDS_pept        complement(143324..144382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0124"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP0876 FO synthase, subunit
FT                   CofG"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65194"
FT                   /db_xref="GOA:A6VFG8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFG8"
FT                   /protein_id="ABR65194.1"
FT                   /translation="MITKSEALDFLKSDSINSILKKLTKINAQTSSKHITFSKNAFIPV
FT                   CNWCRNVCGYCTFRNENFKLLKMNEMNEILTKADTFGCREALFTFGENVDENEKVKEEL
FT                   KKMGYSGILEYLYEISAWCLDNTDLLPHTNCGILSYDELKYLREVNASMGLMLENSSAR
FT                   LCGTIAHEKSPGKDPKLRIEMIENAGKLKIPFTTGILIGIGETLEERIDSIFEIKRIHE
FT                   NYGHIQEVIVQNFRVKPGIPMENYKEPSPVEMFKMIILSKLILEDISIQVPPNLNRETG
FT                   QLFLMAGIDDWGGVSPLTKDFVNPEAPWPDIDELNIFSKELGFNLKERLPVYEKYITKE
FT                   WLDKKILEKIEK"
FT   gene            complement(144406..145245)
FT                   /locus_tag="MmarC7_0125"
FT   CDS_pept        complement(144406..145245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0125"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   mmp:MMP0877 quinolinate phosphoribosyl
FT                   transferase:nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65195"
FT                   /db_xref="GOA:A6VFG9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFG9"
FT                   /protein_id="ABR65195.1"
FT                   /translation="MLKNHALRILEESLNYDVGFGDLTTELMIPKNQESEAVFVAKEES
FT                   VICGIDFVVEFMEKNGLTCTQLINDGDRVIGPFLKVRGNTKTILTLERTVLNFLMHLSG
FT                   ISNKTHRIIKDVREINKTVKIAATRKTHPLLSMIEKYAVFIGGGDTHRFRLDDMVMIKD
FT                   NHIQAVGIKECFKRAEKLSFSKKIEIEVDTIEQLKEVIEHKPDIILLDNFEFKNIEIAL
FT                   DIILGFEQKTGFRPKIELSGGINENNVKDYAKYNVDVISMGSLIHSAVSVDIGLDLL"
FT   gene            145334..145726
FT                   /locus_tag="MmarC7_0126"
FT   CDS_pept        145334..145726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0126"
FT                   /product="Ribonuclease P-related"
FT                   /note="PFAM: Ribonuclease P-related; KEGG: mmq:MmarC5_0686
FT                   ribonuclease P-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65196"
FT                   /db_xref="GOA:A6VFH0"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="InterPro:IPR016434"
FT                   /db_xref="InterPro:IPR038085"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFH0"
FT                   /protein_id="ABR65196.1"
FT                   /translation="MLKTLPPTLREKKRYVALEIIFEDELFQKDVIAIVRNALMNYSGV
FT                   LGCSKANPWLIDYNHPYGILRISRDEVDNLRSSLSLSNEHRKKPINIHIIGISNSVKHI
FT                   REKFLHVPHEPYYKVIQKLKKKGPKR"
FT   gene            complement(145999..147543)
FT                   /locus_tag="MmarC7_0127"
FT   CDS_pept        complement(145999..147543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0127"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); KEGG: mmq:MmarC5_0687
FT                   seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65197"
FT                   /db_xref="GOA:A6VFH1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004503"
FT                   /db_xref="InterPro:IPR041293"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFH1"
FT                   /protein_id="ABR65197.1"
FT                   /translation="MRFKLDGRIIFSKDVEEETQKDIVEVLENRDIFLKGVPEGKENEA
FT                   SKIEGYEFDGKDLKLKMTSGTYTRAHEGIVRLKKPIMEKVGRKHQIGIRDVAIDRYVVT
FT                   LTAEPSKVSELKGLKVPECEVELESEKINIVFENLGDGELKRNIIDRAIKFVKNELDKQ
FT                   DQDLTFEVCKIAPGTIVSDYKAKREITFDTDPTELAEPNGWVKRFPGRGQWFYTAPMAK
FT                   LFRAFESLIIEECIDKIGFDECLFPKLIPLDVMYKMRYLEGLPEGMYYVCPPKREPEMF
FT                   QDFVNEMMIKKEIPIEKLKTLLRDPAYVLAPAQCEPFYSFFDHELVDVDHPSKFFDKSG
FT                   WTYRWEGGGAKGLDRVNEFLRGECVWMGTPEFVETVRDDTLKYAENLAEKLDLEYWTEV
FT                   GDDPFYLEGRKKEDRGIEFPDVPKYEMRLWLPHIKEERKGVAVTSANIHGTHFIEGFGI
FT                   KDYKERKVWTGCTGYGLTRWVIGFLAQYGYNYDDWPELIQKKVGKLPEIPKLITWP"
FT   gene            complement(147607..148626)
FT                   /locus_tag="MmarC7_0128"
FT   CDS_pept        complement(147607..148626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0128"
FT                   /product="isopropylmalate/isohomocitrate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: isopropylmalate/isohomocitrate
FT                   dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase; KEGG: mmq:MmarC5_0688
FT                   isopropylmalate/isohomocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65198"
FT                   /db_xref="GOA:A6VFH2"
FT                   /db_xref="InterPro:IPR011828"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH2"
FT                   /protein_id="ABR65198.1"
FT                   /translation="MRNTPKICVINGDGIGNEVIPETVRVLSEIGDFEFIETHAGYECF
FT                   KRCGDAIPEKTIEIAKESDSILFGSVTTPKPTELKNKPYRSPILTLRKELDLYANIRPT
FT                   FNFKDLDFVIIRENTEGLYVKKEYYDEKNEVAIAERVISKFGSSRIVKYAFDYALQNNR
FT                   KKVSCIHKANVLRITDGLFLEVFEEISKKYEKLGIASDDYLIDATAMYLIRNPQMFDVM
FT                   VTTNLFGDILSDEAAGLIGGLGMSPSANIGDKNGLFEPVHGSAPDIAGKGISNPIASIL
FT                   SAAMMLDHLNMNKEAECIRNAVKKAVECKYLTPDLGGNLKTSEVTDKIIESIKSQMVQ"
FT   gene            complement(148742..149101)
FT                   /locus_tag="MmarC7_0129"
FT   CDS_pept        complement(148742..149101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65199"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH3"
FT                   /protein_id="ABR65199.1"
FT                   /translation="MVNFSKNEIEVIKNVLKRAESISRDVDPKLFIYSEDMYLGRNDSC
FT                   RAALYALENEEFLEDFGEEEIEEIFWDELQLYVDYLYTEKSEIQSENESLGSKHIDEKI
FT                   VEIKKLMKKIRPFDE"
FT   gene            149292..150173
FT                   /locus_tag="MmarC7_0130"
FT   CDS_pept        149292..150173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0130"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein;
FT                   KEGG: mmq:MmarC5_0690 AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65200"
FT                   /db_xref="GOA:A6VFH4"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011414"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH4"
FT                   /protein_id="ABR65200.1"
FT                   /translation="MENIEYEIKYAIDHMMENNYPRKELWNMDSKVPGLLSGIRAGDDG
FT                   VVVGKSVYNMEGPYPLILGSKTALIHTTCDIVAMGAKPLYAMDAIQAANEEEIKIAVDG
FT                   LKKQSIGLDIPIIGGNTQTIESLKSCMSVVVFGELISDKFIRDSGSKDGDVMLMLGHPV
FT                   EGDIGERIQKAKNKFDTFLEILKNNIEVHACKDASRGGWLCNILEMLLKAQYGVEITGL
FT                   PHPRATRYLGTYLVSVPEDEVSNVLDVAVKNRCPLTPFGRVTSEKVLKIGNKEYINNEE
FT                   MKELIKSFPYKY"
FT   gene            complement(150215..151180)
FT                   /locus_tag="MmarC7_0131"
FT   CDS_pept        complement(150215..151180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65201"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH5"
FT                   /protein_id="ABR65201.1"
FT                   /translation="MVLGFLRSKSNKLKKLLEDDMLNDAQKMLDEDDSLTSDLFMYFKS
FT                   NSETLKANAIYLLTKNYLKNNKDISELFSPLKAFLSQKSEVLVLNSLISLKLITDVYPE
FT                   VYENFNSEVSHINKTFVNLDIRNYTGNLIKKYGKFKEYNLSENQKKLQKHVKQLMKSSK
FT                   QESLFGRLMEIGSSLFFVLPEKLEITEEMLEESISKEDLQFNVFTIETLKSGKIKELDP
FT                   LNIVYQLSKLPTLTKGQVDDTMPQTLDLMGCSKNMIVRSMVLNTVYEISQTYPDVLYNH
FT                   LSGLELYAEQYGGNDPVFKAILKEIAKLYNLDKSPLSKLL"
FT   gene            complement(151212..151709)
FT                   /locus_tag="MmarC7_0132"
FT   CDS_pept        complement(151212..151709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0692 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65202"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH6"
FT                   /protein_id="ABR65202.1"
FT                   /translation="MEEEKFYVTQALSESDVFGKLRMLIAENVSGLYNLTVKNSLNHKF
FT                   YSIKFIVKAKSENYAKLCEILQKNEIILVNCYELLFPSYKIVITGDAENCLTMQKELLE
FT                   ILMAYGSVPIKSKLSSDEFIKGSLEVTVTNKDPSNCIKFLELMRKNKDMEYKITPVDES
FT                   EL"
FT   gene            complement(151805..152986)
FT                   /locus_tag="MmarC7_0133"
FT   CDS_pept        complement(151805..152986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0133"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   mmq:MmarC5_0693 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65203"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH7"
FT                   /protein_id="ABR65203.1"
FT                   /translation="MGILSIFETKEPKKLLEKGIDYYNKGKYQKAIEFFNKAIGSEPKN
FT                   PDAWYFKGNAYKMLEKSKLAQDSYEKALSISPTNLEIIKNYAMLLNSLELFKESIEILE
FT                   NVSEPDFKVTEILGDAYLKTGKFEEALVEFDKILEKKPKYKDVLAKKGTALVGLRKFNE
FT                   ALDIYEKILKISPYDTQVWKNIGNAFYTVKRYEKAIQFYDMYLSEHKNNFQVTLSKGDA
FT                   LRKLGKTNEALDLYTKVLENHINSHEPWCRVGLLYYENKDYETALYYLELAYERNPLNP
FT                   SILVKIARTYIKLKNYNKALEFIEKALDKDNGYAKAWCYKGQILNILERHYEAVDCFKK
FT                   AITLNKNVSDFWIQLSNVYKTIGNEEYSKEAYANAVKLEPQLTSPKSTESSRL"
FT   gene            complement(153184..153951)
FT                   /locus_tag="MmarC7_0134"
FT   CDS_pept        complement(153184..153951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0134"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   mmq:MmarC5_0694 cobalt ABC transporter, inner membrane
FT                   subunit CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65204"
FT                   /db_xref="GOA:A6VFH8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH8"
FT                   /protein_id="ABR65204.1"
FT                   /translation="MHGSLRSLEQDAFVESPLHNMDARIKLIFVFAVVLTATLFNNAYL
FT                   MILIEIYILCIMLFSKIPILNLLKRIIMIIPFGGFITLFQPFIRGESIIFYLGIFPVYS
FT                   EGLDFGISLFLKFLVAISSVVLLSSTTPMYEVINAGKKLGIPSIMATLLGMMIRYLFVM
FT                   FDVLESTIKAQKSRALNRKNLGYKELLNTFGSLIGLVFLKSYEQGERTYLGMLSRGYSK
FT                   DSKIKTLSQRIGVNDIVFLAVTTLVLSLGILSL"
FT   gene            complement(154106..154408)
FT                   /locus_tag="MmarC7_0135"
FT   CDS_pept        complement(154106..154408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0135"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: mmq:MmarC5_0695 stress responsive alpha-beta
FT                   barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65205"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFH9"
FT                   /protein_id="ABR65205.1"
FT                   /translation="MIKHIVMWKLKENAEDKKKFENAKIIKTNLESLKEVIPEIKYIEV
FT                   GIDSKKFENNYDVVLVSEFNSFEDLEIYQKNEEHLKVAEFVKSVAESRIAVDYEF"
FT   gene            complement(154528..154848)
FT                   /locus_tag="MmarC7_0136"
FT   CDS_pept        complement(154528..154848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0136"
FT                   /product="cobalt transport protein CbiM"
FT                   /note="KEGG: mmp:MMP0888 cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65206"
FT                   /db_xref="GOA:A6VFI0"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI0"
FT                   /protein_id="ABR65206.1"
FT                   /translation="MNNNSILIAGLIVAVLLGIAAPFLASGNPDGLESAAEKIVNLDVL
FT                   DANLEEAGLEEEGTIAPSPMPDYAIPGMEKIGEIAALIIGILLVTLLSFGVGSLLKSTS
FT                   KN"
FT   sig_peptide     complement(154765..154848)
FT                   /locus_tag="MmarC7_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.886 at
FT                   residue 28"
FT   gene            complement(154841..155479)
FT                   /locus_tag="MmarC7_0137"
FT   CDS_pept        complement(154841..155479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0137"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: mmp:MMP0889 cobalamin (vitamin B12)
FT                   biosynthesis CbiM protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65207"
FT                   /db_xref="GOA:A6VFI1"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI1"
FT                   /protein_id="ABR65207.1"
FT                   /translation="MHIPDGFIPFWESAIFWVISLIFLSLSLRWASKEMNEKTVPLFTA
FT                   LAAGIFAIQAMNMPIPWGTSGHMVGAALTAIVFDSPWAAVLLLAMVLIVQGLFFADGGL
FT                   IVMGTNIFNMGIVGGFAGYYIFKALKKTNFHVAIFIAAWAATFIASLVCAAELAIAGTF
FT                   PIDLGIQFMGLYHAVIGIIEGLITVIVVGYLASARPDLVKSVKKVVLNE"
FT   gene            155675..157915
FT                   /locus_tag="MmarC7_0138"
FT   CDS_pept        155675..157915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0138"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: mmq:MmarC5_0698 DEAD/DEAH
FT                   box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65208"
FT                   /db_xref="GOA:A6VFI2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI2"
FT                   /protein_id="ABR65208.1"
FT                   /translation="MHVLDLLKENKITELRPPQKRVIDEGLFDKLKNFLICIPTASGKT
FT                   LIGEMALLNHILDENRNLTGKKGLFIVPLKALANEKFDEFREKYEKYGIKVGLSIGDFD
FT                   TKEDLSKFHIIITTSEKLDSLMRHNVEWINTVSLAIIDEIHLIGDNERGGTLEVILTKL
FT                   KNLNAQIVGLSATIGNPEELSNWLNAKLIVDEWRPVELKKGIYFENELEFLKNPAKKIK
FT                   KLSKNNLTDLIVDSVEEKGSCLIFCNSKRNAVGEAKKHNLTRYLTKTEQHELNKLSEDI
FT                   LSILDTPTETCRALSECIKKGVSFHHAGLTYQHRKIVEDGFRNRLIKVICCTPTLSAGL
FT                   NLPCRRAIVRDTKRYSQNGLVDIPRMEIQQCIGRAGRPGLDPYGEGIIYIKNEKEAEKA
FT                   YEILIGNVENIYSKLANQKVLRIHILGLISTGEIKDGESLVNFMKNTFYAYQFGNIGAV
FT                   LLNVSEVVEFLEKNKFLETTVHKKTENKVLELSLDSSNNLVLDSKETSFDLTNPNSKVE
FT                   FRSTKLGKRISELYIDPMSSEIIIEELNELKKKCSQLDRSKIDQYLFYLISKTNEMRPL
FT                   LRIRPNEELDLILEMDKMGLKDYSIENIEAFKNSKMFCDWVSEIPEEIILEKYGVEPGI
FT                   LRYKVEQAKWMIYSTKEIAKLIHLDSSEVYRALLEMELRIEYGAKEELIELLKVKNVGR
FT                   ARSRKLYNAGIKSKIEINNNPEKILELFGEKIGKKILGELGMKYGQQTLLNY"
FT   gene            158132..158704
FT                   /locus_tag="MmarC7_0139"
FT   CDS_pept        158132..158704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0139"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: mmq:MmarC5_0699 exonuclease,
FT                   RNase T and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65209"
FT                   /db_xref="GOA:A6VFI3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI3"
FT                   /protein_id="ABR65209.1"
FT                   /translation="MYVFLDTETTGLHPGQIAQLSYLVTDEDLNLKKVFNQYYSVDRMS
FT                   RSAAKIHGLTMEILDELSNGMTFEDTVDEVRDDLEDSIIIGHNISFDIRFLKTEFERLG
FT                   PEYVPKDKFCTMFHFTPICKLPGQKRYKRPKLVELMEFLEQCPHEGLEFTKEAYGCSDV
FT                   GFHDARYDTGILYLCYKKGVLLDHIKK"
FT   gene            complement(158737..159285)
FT                   /locus_tag="MmarC7_0140"
FT   CDS_pept        complement(158737..159285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0140"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmp:MMP0892 acetyltransferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65210"
FT                   /db_xref="GOA:A6VFI4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI4"
FT                   /protein_id="ABR65210.1"
FT                   /translation="MLELKVDSEIVLKEIELFDAEDIFRLIDSDRENLRIWLSFVDSTK
FT                   ELFDTEDFIKSILFLPEEIRDFVTVIIYKGQKIGLIGFKLTDFVNKKTEIGYWISKEFE
FT                   NKGIVTKSIIKMIDYALDTLELNRIQIKCAIGNEKSSKIPKKLNFKFEGIERSAELLNG
FT                   KFIDAEVYSILKDEWNSKN"
FT   gene            159453..161054
FT                   /locus_tag="MmarC7_0141"
FT   CDS_pept        159453..161054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0141"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase; KEGG: mmq:MmarC5_0701 CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65211"
FT                   /db_xref="GOA:A6VFI5"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI5"
FT                   /protein_id="ABR65211.1"
FT                   /translation="MKYIFVTGGVVSSLGKGITASSLGRLLKARGLNVNMIKIDPYLQI
FT                   DAGTMSPFEHGEVFVTDDGGETDLDLGNYERFVDIGLKADNNITTGKIYWSVLSKERRG
FT                   DYLGKTVQVIPHITNEIKDRIKALGKDSDITIIEIGGTVGDIESLPFLEAIRQFKKDVG
FT                   KENVLYIHVSLLPYIRSAGELKTKPTQHSVKELKGIGIQPDILVCRSEIPVSEKIREKL
FT                   ALFCDVEKEAVIECKDARTIYEVPLNLEKEGIGKLVTEKLNLKDSTPDLTEWRAIVDRI
FT                   INPMNEITIGIVGKYVELKDSYMSIMEALGHAGAKNDTKVNIAWINSEELETKNYVEIL
FT                   DKMVDDEKLHGILVPGGFGDRGIDGKVNAVRYAREKNIPFLGICLGMQCAVIEFARNVC
FT                   GLKANSTEFDEETENPVIDYIPEQREITEKGGTMRLGAYPAILTEHSLASELYGSINVS
FT                   ERHRHRYEVNPEYHEILKKNGLIISGMSPDGKLAEFIELENHKYFIATQAHPEFKSRPN
FT                   KPHPLFYGLIKAAIEK"
FT   gene            161077..162009
FT                   /locus_tag="MmarC7_0142"
FT   CDS_pept        161077..162009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0142"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; PFAM: GMP
FT                   synthase domain protein; thiamine biosynthesis protein;
FT                   KEGG: mmp:MMP0894 GMP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65212"
FT                   /db_xref="GOA:A6VFI6"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR026598"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFI6"
FT                   /protein_id="ABR65212.1"
FT                   /translation="MFKTEPFIEESIEEIRKQIDNRRTIIALSGGVDSSVAAVLADRAI
FT                   GDKLLAVYVDTGLMRKNESEEIWKIFKEQMGLNLKIVEAKDIFLKELEGVIDPEEKRKI
FT                   IGRLFIEVFEKVAEEQGEEVLVQGTIAPDWIESEGQIKTHHNIALPGGMVLDVVEPLRE
FT                   LYKDEVRLLAEALGLPDQIAHRQPFPGPGLAVRILGEITDEKLAICKEANFIVSEEIEK
FT                   TELKNELWQYFAAVLDTKATGVKGDIRDYNWVVALRFVSSLDAMTAHTPEIPFDLIKRI
FT                   SKRITSEIPNVTRVVLDVTDKPPATIEFE"
FT   gene            162132..162725
FT                   /locus_tag="MmarC7_0143"
FT   CDS_pept        162132..162725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0143"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mmq:MmarC5_0703 TPR
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65213"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI7"
FT                   /protein_id="ABR65213.1"
FT                   /translation="MKNNYGIQKWHSHGAMLCNSEKYSEALECYDKILSYYPNDFLAVF
FT                   GKGMVFLKLREYEKALQCFNSVLNMNSSYIPAIKNKKMIEEKLKKQESENYTKFSKLGV
FT                   EYYKNGNFENALNYFEKAFEINPYSETLRKNIERTHLKLKETLPIRWNNKGVEYFKVKN
FT                   YQKAYECFEKAVKLNPKFESALKNKAMVQKLIKN"
FT   gene            162747..164018
FT                   /locus_tag="MmarC7_0144"
FT   CDS_pept        162747..164018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0144"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; KEGG: mmp:MMP0896
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65214"
FT                   /db_xref="GOA:A6VFI8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFI8"
FT                   /protein_id="ABR65214.1"
FT                   /translation="MIKNLKKDGILKDSAYMIFSNMYSKFAAYLFYFLIPFILGTEGFG
FT                   IIKGLMPILDTLVIIFCSGIPPAMAKFISGGDFNENSWIYDILKVMFVFSIFGGIFTIF
FT                   LKYLLGGNYSTLPDVYFYAVAVALPFSVVISWSRGILQGNLKIKNLSKTWILENTSKVV
FT                   FLIILSYLFGVVGGILSISVSFLIGGIFGMYLLSKSKLEYSFSNILKNIFSPIKNSDSV
FT                   KKVIYYSIPIALTTASYRLINDLDGIFILSMRGAYDNGVYGYASLLSRLLFLFASAIAI
FT                   VLIPRISKSKDISYFKKATILNISIVLPALLIIFLFSKELLNLFFGISTPESIISLKIL
FT                   SVSAVFMSTYTICASSLQGIGYAKIPVYVLFLGILLNAIFNYTLIPNLGIVGGAIATLS
FT                   SSFAVFVLIWIITFSKLKKIKNNS"
FT   gene            164122..165348
FT                   /locus_tag="MmarC7_0145"
FT   CDS_pept        164122..165348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0145"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; PFAM: arginine biosynthesis protein ArgJ; KEGG:
FT                   mmp:MMP0897 ornithine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65215"
FT                   /db_xref="GOA:A6VFI9"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFI9"
FT                   /protein_id="ABR65215.1"
FT                   /translation="MAENFVVVDGGVVAPKGFKANGHKDRKYGAALIYSETDAVAAGVF
FT                   TTNKVFAHPVALSKDVLVNNSVFRAIVANSGNANCFTKGGMDDAKLLVKKAAELLNIPE
FT                   NQVLSASTGVIGRRMPMDIITTEVERAFENMSSENSNKNASAAIMTTDAFPKTIAVEFE
FT                   VNGKSVRIGGIAKGAGMIAPNMLHATMLGFITTDIEISKEDLTNSLQKATDESFNNAVV
FT                   DGDMSTNDTVYVLANAQSGVKYIDCKDKFDSALAYVSKELAKMIVSDGEGAKKLIEATV
FT                   YGAETKEDAKKASMSIIRSLLLKTAVFGADPNWGRIAAAVGYSGAEMDMSNFDIIISDI
FT                   SLEKQAILVKSGEQIADCGTPELKLAEEIMKEDKIKIIVDLKMGSFENTAFGCDLGYDY
FT                   VRINSEYTT"
FT   gene            165476..166135
FT                   /locus_tag="MmarC7_0146"
FT   CDS_pept        165476..166135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0146"
FT                   /product="ATP/GTP-binding site motif A (P-loop)"
FT                   /note="KEGG: mmq:MmarC5_0706 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030815"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ0"
FT                   /protein_id="ABR65216.1"
FT                   /translation="MMIIGLFGKTGCGKTEILNELKKKYSVVDIEGCANNKGSILGDLY
FT                   DLSSSTQEQFDLCIEKQKKIAEDAGYCIVEFEGRRIGGRDKVTIPEPFSDLKCYNYNIV
FT                   VNCPYECQIKRLLNWYLPKNEIEKEILIDKFIDLKSALSKPEKIELMDEIVDLLKKDEY
FT                   YNAATLIEEGLYSEHYLRHIMKVKHDLEINNEDILKSAEEISKYIDEILKKHGIKI"
FT   gene            166145..166798
FT                   /locus_tag="MmarC7_0147"
FT   CDS_pept        166145..166798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0147"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: mmp:MMP0900
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65217"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR030818"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ1"
FT                   /protein_id="ABR65217.1"
FT                   /translation="MDENILSRLLTFKNDVILVIRLKTGEKVILKDGKIAAGKLTGQIA
FT                   SFISENSKSISKPTVLEFSGEMFYFEPVNIKKYLESIGSELSDEVITVDQFFKSDFENV
FT                   VIIDARSPREFSEKTIPDAVNIPLFLTEEYETIGKLYKSEGKEVAIAKAGVIIQDGIKR
FT                   IVSESLKLDPNKNLIVFCARGGMRSQSIATILKLLGFKVKRLVGGFKSYNLSKT"
FT   gene            complement(166828..167868)
FT                   /locus_tag="MmarC7_0148"
FT   CDS_pept        complement(166828..167868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0148"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Nucleolar GTP-binding 1;
FT                   KEGG: mmq:MmarC5_0708 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65218"
FT                   /db_xref="GOA:A6VFJ2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ2"
FT                   /protein_id="ABR65218.1"
FT                   /translation="MRKSRDANPFKAMPTILYPDELLDKAYNRSEKIAGELRTTTRGLS
FT                   VPKSRIIEDNKIRTTASVISDNLLKIVEKTPSIDNLDPFYREILEIMVGSDEFKKSLAA
FT                   VQWASEIVKKLGTQYSRKVKKAPSPQATSIVRKEFIGRVSSVLKQIYPNMAFLGVARNK
FT                   LKNIPTVKNLPSVVIAGYPNVGKSTLLRTLTDAEPEVNSYPFTTKGLNIGYTEEGIQII
FT                   DTPGVLDRPIYERNDIELHAVVAINYLSDMILFVIDPTEFCGFTIEEQFNLLEEVRKTF
FT                   NAPILVALTKMDVDEIEGLDALEEDLGEYEVMKVSSLKKEGIVDLKGRLLDILDEQGLM
FT                   DLLEEE"
FT   gene            complement(167932..168324)
FT                   /locus_tag="MmarC7_0149"
FT   CDS_pept        complement(167932..168324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0149"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   mmq:MmarC5_0709 protein of unknown function DUF126"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65219"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR012016"
FT                   /db_xref="InterPro:IPR020794"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ3"
FT                   /protein_id="ABR65219.1"
FT                   /translation="MKELTGRIISKGVVEGEAIVSKSSISFLGGVNEEGIVTDKENELF
FT                   GKSIANKIFVFPTGKGSTVGSYVIYGLAKRGLLKGMVNFESEPIVATGAILGKIPLVDK
FT                   VNIDEIKDGDIVVVDGNTGTVKIKEQ"
FT   gene            complement(168336..168563)
FT                   /locus_tag="MmarC7_0150"
FT   CDS_pept        complement(168336..168563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65220"
FT                   /db_xref="GOA:A6VFJ4"
FT                   /db_xref="InterPro:IPR007166"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ4"
FT                   /protein_id="ABR65220.1"
FT                   /translation="MSLKSLAFKNRGQISLEAGVIVIAVAMVAVFAAYLYVKSTVESAI
FT                   QINETTNGTIGIYNNAVNKLTESVGNLSNK"
FT   sig_peptide     complement(168465..168563)
FT                   /locus_tag="MmarC7_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.924 at
FT                   residue 33"
FT   gene            complement(168844..169914)
FT                   /locus_tag="MmarC7_0151"
FT   CDS_pept        complement(168844..169914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:169831..169833,aa:Sec)
FT                   /locus_tag="MmarC7_0151"
FT                   /product="selenide, water dikinase"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein domain protein; KEGG:
FT                   mmq:MmarC5_0711 selenide, water dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65221"
FT                   /db_xref="GOA:A6VFJ5"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ5"
FT                   /protein_id="ABR65221.1"
FT                   /translation="MKCLKIYLKGGKIEEEIKLTQMVTLHGUACKLPDTELENLVKGII
FT                   SEDDLKNTKVGLGDDAAVVIKNGMAIVKTIDVFTPIVDDPYLQGRIAACNSTSDVYAMG
FT                   ISEVIGGLVFLGIPPELPVSVAKKMLQGFQDFCRENDTTIIGGHTILNPWPLIGGAITG
FT                   VGKEEDILTKAGCKKGDVLILTKPLGNQSAMALSRVTEEFEDLIDIPKEEQKYIFEKTI
FT                   ELMTTSNRIALLHLRELENELGEKIANAMTDVTGFGILGHSQEMAEQSNVEIEISCLPV
FT                   IKGTPELASLFGHGLCCGKGAETAGGLLISTKPEYKYKLIQKFEENNVYAFEVGKIINN
FT                   GVGISKLSENVKILEI"
FT   gene            complement(169932..170510)
FT                   /locus_tag="MmarC7_0152"
FT   CDS_pept        complement(169932..170510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0152"
FT                   /product="Protein of unknown function DUF1867"
FT                   /note="PFAM: Protein of unknown function DUF1867; KEGG:
FT                   mmp:MMP0905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65222"
FT                   /db_xref="InterPro:IPR015074"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ6"
FT                   /protein_id="ABR65222.1"
FT                   /translation="MTEYFEYAGVENTENTLKYAVERAKLGIFDIVVASSYGETAKMLL
FT                   DSLEKENLNVNVVVVTYHRGFSGPDIVAMPENIKKDLEKRGAKVFSGTHALSGVERGIS
FT                   KRLGGYGPVEVIAQTLKTLGQGVKVCYEVTVMAADAGLVSTKKEIIAIGGSSRGADSAV
FT                   VILPSNMNTFFDIELRELICMPRNKKKHE"
FT   gene            complement(170520..171452)
FT                   /locus_tag="MmarC7_0153"
FT   CDS_pept        complement(170520..171452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0153"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="TIGRFAM: ribonuclease Z; PFAM: beta-lactamase domain
FT                   protein; KEGG: mmq:MmarC5_0713 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65223"
FT                   /db_xref="GOA:A6VFJ7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFJ7"
FT                   /protein_id="ABR65223.1"
FT                   /translation="MKLTFLGTGAAIPTKYRAHPSISLKFDGEIFLFDCGENTQRQIIF
FT                   TDVSPMKINNIFISHLHGDHILGIPGLMQSIAFQGRTKPLNIYGPKETAKMIENILNVG
FT                   YHSIDYPINVYEISAKSPEKIISSDNYEVFSFPVVHSVPALAYVFKQVKKPRMDLEKVN
FT                   KLGIEIGPDLKRLKDGFNIELNGKIITPDDVTVPPKKGICVGYSGDTIPLNEFAEFLKE
FT                   LKCTTLIHEATFDKSMDKNAKETLHSTVSDALNIAKLSGVNTVILTHISARYDEISAYE
FT                   KDIVEFKAEHPDLHILIAEDLMEYSLKGK"
FT   gene            complement(171480..171872)
FT                   /locus_tag="MmarC7_0154"
FT   CDS_pept        complement(171480..171872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0154"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mmq:MmarC5_0714 transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65224"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ8"
FT                   /protein_id="ABR65224.1"
FT                   /translation="MSKLVLNMPCSTFTLETIMCCVFGLKAFDVAVYFEILKCKPAKIN
FT                   EIAESLNRERSTIQRSAQSLMNAGIIIRKQINIKEGGYYYKYEAVPFADVKERIKKTMS
FT                   EWSRDVCKWVDEIDEKDADELINNLI"
FT   gene            172056..172436
FT                   /locus_tag="MmarC7_0155"
FT   CDS_pept        172056..172436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0155"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmq:MmarC5_0715 putative signal transduction protein with
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65225"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFJ9"
FT                   /protein_id="ABR65225.1"
FT                   /translation="MKVKELMNPTIFTIDGEKSLFEAFKLMNNKGVKRVFVRIDENIDG
FT                   VITYRDLAHIFFEKGVFELMDVTLKDVSTKEILTIDENADVKHAAQIMLHADVSGLLVI
FT                   DEKTDAVGVISQTDILRSLVKG"
FT   gene            172452..172934
FT                   /locus_tag="MmarC7_0156"
FT   CDS_pept        172452..172934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0156"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   mmp:MMP0909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65226"
FT                   /db_xref="GOA:A6VFK0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK0"
FT                   /protein_id="ABR65226.1"
FT                   /translation="MDIYQFAEYIVLNYGYFGIFLIAFTEAVIQPVIPDIFIIGAAAFG
FT                   LDSVTCAFVASFGSLTGGYTGYFLGKKLGTNAFLKIFKEKNFIKGKAFFEKFGVWGVAI
FT                   AGFTPIPYKVFAWLAGIFKMNLLSFGAGTLLGRIPRFLLVAYFGYSLGMLFGLHTP"
FT   gene            complement(172963..173391)
FT                   /locus_tag="MmarC7_0157"
FT   CDS_pept        complement(172963..173391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65227"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK1"
FT                   /protein_id="ABR65227.1"
FT                   /translation="MDLAETRDIKKYLIENELQIYPTQDIPEDFPNIAWEGDNWKDFLK
FT                   IAIFEKASIIFVREEIFKDAHIKSNIIPTTDSDEKIVEFNNKIRSFEKHIGKLAIFTMY
FT                   WVKNDIIYSFTQSSKWAEDFLSISVTLENTEDREILGM"
FT   gene            complement(173430..174011)
FT                   /locus_tag="MmarC7_0158"
FT   CDS_pept        complement(173430..174011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0158"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: mmq:MmarC5_0718
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65228"
FT                   /db_xref="GOA:A6VFK2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK2"
FT                   /protein_id="ABR65228.1"
FT                   /translation="MKILGISGSPRKNGNTSNLVKEALKAAEKEGFETEFISLSGLELN
FT                   PCIACDMCKKEEGCIIVDDMEEILEKIEEADGIIVGSPVYFGGVSAQTKMLIDRSRPLR
FT                   AGFKLKYKVGAAISVGASRNGGQETTIRQIHDFFLIQSMIVVGDSEPTAHYGGTGQGKS
FT                   PEDTKEDNPGIETSRNTGKRVAEVLKKMKL"
FT   gene            complement(174087..174281)
FT                   /locus_tag="MmarC7_0159"
FT   CDS_pept        complement(174087..174281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0159"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   mmq:MmarC5_0719 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65229"
FT                   /db_xref="GOA:A6VFK3"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK3"
FT                   /protein_id="ABR65229.1"
FT                   /translation="MPVITIEAGSVSKEQKEKLIKEFTKSASEIIGLPEEKFIVFIKEN
FT                   TDENVGVGGISLLELKSKR"
FT   gene            complement(174317..174694)
FT                   /locus_tag="MmarC7_0160"
FT   CDS_pept        complement(174317..174694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0160"
FT                   /product="Protein of unknown function DUF473"
FT                   /note="PFAM: Protein of unknown function DUF473; KEGG:
FT                   mmq:MmarC5_0720 protein of unknown function DUF473"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65230"
FT                   /db_xref="InterPro:IPR007417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK4"
FT                   /protein_id="ABR65230.1"
FT                   /translation="MKALALTGVGPYAISEIVKNHIKTLNLKNICNLLVLESSKVGDFL
FT                   FVTNVSKEDVISGTEGLIVQIKKISINNQSGYSKSCDETESVVGKVQVELLGYASCSNV
FT                   VETGLMDPSVVILKARSVYDL"
FT   gene            complement(174713..175420)
FT                   /locus_tag="MmarC7_0161"
FT   CDS_pept        complement(174713..175420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0161"
FT                   /product="protein of unknown function DUF75"
FT                   /note="PFAM: protein of unknown function DUF75; KEGG:
FT                   mmq:MmarC5_0721 protein of unknown function DUF75"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65231"
FT                   /db_xref="GOA:A6VFK5"
FT                   /db_xref="InterPro:IPR004425"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK5"
FT                   /protein_id="ABR65231.1"
FT                   /translation="MEYVSKKEIMYKEPLVITGFPGIGLVGSIASYHILKNLKLEYIGY
FT                   IEDPKLPEIMIVEEGIAYPPVRVYARDDLIVFFSDVMIPPELVYSMSTMISEHLKKINP
FT                   KMVVTLEGFASMNPEKSFWVSSSEDVLNSIVDEDTPALQLGMVGGIPGALMNCCNEEDI
FT                   RAACLITETVGLRPDPRGASKIIENLNKKYNLDADTEELIKEAENIEEKMKSLAKEHAK
FT                   LMSKPKTENPMYM"
FT   gene            175504..176112
FT                   /locus_tag="MmarC7_0162"
FT   CDS_pept        175504..176112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0162"
FT                   /product="nucleotidyl transferase"
FT                   /note="KEGG: mmq:MmarC5_0722 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65232"
FT                   /db_xref="GOA:A6VFK6"
FT                   /db_xref="InterPro:IPR005245"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK6"
FT                   /protein_id="ABR65232.1"
FT                   /translation="MDALIMAGGKGTRLEENVEKPILNICGKPMIDYVIDSLLKSEIKK
FT                   IYVAVSNHTPKTKEYLEKKYCANQNYNQKVNIICTSGTDYVDDLNECIEFFKEPFLILS
FT                   SDIPTIKTKVINSIINEYLIVNNSCNRIESFCVVTKHEDYVGTPSFDMGGYIPLGINIL
FT                   TPKYGEQIETLHVVKDIIVNVNTLSDKKLVETLINKVVE"
FT   gene            176109..176357
FT                   /locus_tag="MmarC7_0163"
FT   CDS_pept        176109..176357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0163"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: mmp:MMP0916
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65233"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK7"
FT                   /protein_id="ABR65233.1"
FT                   /translation="MKLSFKSLNGRSIVGSLGSIIGTVDDIVIDEKTGRIISLNIEPSE
FT                   QSPISPSSENYSFVPYRTVTAIRDVVVIDETKINAKA"
FT   gene            176409..177242
FT                   /locus_tag="MmarC7_0164"
FT   CDS_pept        176409..177242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0164"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG:
FT                   mmq:MmarC5_0724 diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65234"
FT                   /db_xref="GOA:A6VFK8"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFK8"
FT                   /protein_id="ABR65234.1"
FT                   /translation="MKFTKMHGLGNDYIYVDATSQKIENPNEISRFVSDRHFGIGSDGL
FT                   VLILPSEIADFKMRMFNSDGSEAEMCGNAIRCVGKFVYDKKMTDKSTITIETLAGIKVL
FT                   EMTVENDKVVLVKVDMGEPILKAETIPVLSEKHPVIDEEITAKDYCYNFTCVSMGNPHA
FT                   ITYIENVSEFPLEKIGPLFEFHEKFPRKTNVEFVELIDDSTIKMRVWERGAGETLACGT
FT                   GACAVLVASVLKGYVGRKATVKLLGGDLTIEWNESDNHIYMTGPATTVFEGEIDI"
FT   gene            complement(177265..178806)
FT                   /locus_tag="MmarC7_0165"
FT   CDS_pept        complement(177265..178806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0165"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase; KEGG: mmq:MmarC5_0725
FT                   asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65235"
FT                   /db_xref="GOA:A6VFK9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFK9"
FT                   /protein_id="ABR65235.1"
FT                   /translation="MCSISGIVAKDEEGSGSRSLLDNIQKHVINMMKILKHRGPDYSGM
FT                   MFDDEVLYFENFDDVVENTETISRMAMGHNRLAIVGTAVQPIPNDDESIWIICNGEIYN
FT                   HIELRDELSVEHEFKTDTDSEAIIHAYEDELIDVLDGDYAYAIYDKEKNIIELRRDLIG
FT                   VKPLYFIDTDEYFAFASEKKALYYLLMEINGMDYKNAFNYDICRLDPNSRLTYELDENS
FT                   WYIEEELEKINSNYFEEENYELCKNELETTILDSVLKRVKGLEKVGIIYSGGVDSTLIS
FT                   KLASESCEVILYSVGSENSEDLVYAERAAKDMGLNFRKKIISEDEFEDYVVNVARAIDE
FT                   LDVMKLSVGIPIFAASEMAREDGIKVVLSGQGADELFAGYNRYQRILNEKGEDGLKESI
FT                   ISDVFDIHKINLERDDHCTMANGVELRVPFLDKFVIDVGLSIPVGYKIEEPRKKILRDI
FT                   ASKYVPDYIAERPKKAAQYGSGSEKMVYAVAKKHGYSKKEINKFFEEYLLEKIKF"
FT   gene            complement(178900..179667)
FT                   /locus_tag="MmarC7_0166"
FT   CDS_pept        complement(178900..179667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0166"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   mmq:MmarC5_0726 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65236"
FT                   /db_xref="GOA:A6VFL0"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFL0"
FT                   /protein_id="ABR65236.1"
FT                   /translation="MEKPVMCKIIDILDESPTVKTFLLDKEFDFKPGQFAMVWIPGIDE
FT                   KPFGFSSKNSISVAKVGRFTEKIHSLKKGDLLGIRGPYGNNFECIGNKILAVAGGIGSA
FT                   PIISAVEEFSKMNVEVTSIIGGRTKDELLFLDRFEKCGRIFACTDDCSYGFGGFTTEKM
FT                   LELLSKEKFDMVITCGPEIMMKKVVEIAENNDMPIQVSLERYMKCGIGICGQCAVDDEG
FT                   LCVCKDGPVFWNDKLKFVSEFGKYKRDASGAIL"
FT   gene            complement(179698..180945)
FT                   /locus_tag="MmarC7_0167"
FT   CDS_pept        complement(179698..180945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0167"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding protein; KEGG:
FT                   mmq:MmarC5_0727 adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65237"
FT                   /db_xref="GOA:A6VFL1"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFL1"
FT                   /protein_id="ABR65237.1"
FT                   /translation="MSKVKDMGLAPSGHLKMEWAKKHMPVLCRIREDFKKDKPFNGITI
FT                   GMALHLEAKTAILAETLMEGGAKIVITGCNPLSTQDDVAAACVEKGMEVYAWRGETNEE
FT                   YYENLNLVLDSNPDIIIDDGADLIFLIHTQRTELIGKIMGGCEETTTGIIRLKAMAEEG
FT                   ALKFPVVNVNDAYTKHMFDNRYGTGQSAMDGIIRTTNLLIAGKNVVVGGYGWCGRGVAS
FT                   RAAGHGANVIITEVNPIRALEAKMDGFTVLKMEEAAKVGDIFVTTTGCKDILRMEHFLL
FT                   MKDGAVLSNAGHFDNEINKNDLKELSKSVREVRFNIEEYDLGNKKIFVLGEGRLVNLAC
FT                   ADGHPCEVMDMSFANQALSAKFIKDNNGKLENEVYEIPYEQDLKIALLKLHSMGADIDE
FT                   LSPEQRKYLSDWKEGT"
FT   gene            181108..181440
FT                   /locus_tag="MmarC7_0168"
FT   CDS_pept        181108..181440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0168"
FT                   /product="RNAse P, Rpr2/Rpp21 subunit"
FT                   /note="PFAM: RNAse P, Rpr2/Rpp21 subunit; KEGG:
FT                   mmq:MmarC5_0728 RNAse P, Rpr2/Rpp21 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65238"
FT                   /db_xref="GOA:A6VFL2"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFL2"
FT                   /protein_id="ABR65238.1"
FT                   /translation="MKLKKKFLEKSKKIAEERIDILMNLAEKESKDGKTDRSKNYVVLG
FT                   KKIAMRMRMPYPKEWKRRICKNCGSFLIYGKNSRVRTKAKNYPHVVITCLECNSITRIP
FT                   IKTEKK"
FT   gene            181551..182189
FT                   /locus_tag="MmarC7_0169"
FT   CDS_pept        181551..182189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0169"
FT                   /product="putative phage infection protein"
FT                   /note="KEGG: mmp:MMP0922 possible phage infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65239"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFL3"
FT                   /protein_id="ABR65239.1"
FT                   /translation="MEVFDSSIERFEKLKENHQTQNDTENIIEDLKNSSENEEFETVEA
FT                   DFQESENICIENDDFESLAYNLKNSMDNIFTKIKLAMDKPAIQIKKIETGSEGNNNLLE
FT                   SINNKLDILIASNNEQTSKLDVITSEIDNVLSTIDNNSEKIIDALDAQNVKISGLLNLL
FT                   QEIYEGVQDIKYLLKEFTPENIDRASGVVDNLKCKIDNYMDNINEKAEV"
FT   gene            182198..183010
FT                   /locus_tag="MmarC7_0170"
FT   CDS_pept        182198..183010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0170"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   mmp:MMP0923 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65240"
FT                   /db_xref="GOA:A6VFL4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFL4"
FT                   /protein_id="ABR65240.1"
FT                   /translation="MVKVAVTGALGRMGSGIIKTITETDGLDVVAAIDIPNHPKKGQDI
FT                   GELTGLGKIGVSLSTSDELEAILKESGAEVLVDFTAAAPCVNTAKTAAKLGVNLVIGTT
FT                   GFTPEQRAEMENAISENKVAATISQNYAVGVNIFFKTLELLAQKLGDYDIEILEMHHKF
FT                   KKDAPSGTALRAAEIIQNNLNRDSNIIYGREGITGERTKEEICIHALRGGDIVGDHTVI
FT                   FTTDGERLELSHRVTSRQSLVSGAIRAIQFVADKKEGIYNTFDVLDLN"
FT   gene            183019..183615
FT                   /locus_tag="MmarC7_0171"
FT   CDS_pept        183019..183615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0171"
FT                   /product="protein of unknown function DUF358"
FT                   /note="PFAM: protein of unknown function DUF358; KEGG:
FT                   mmp:MMP0924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65241"
FT                   /db_xref="GOA:A6VFL5"
FT                   /db_xref="InterPro:IPR007158"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFL5"
FT                   /protein_id="ABR65241.1"
FT                   /translation="MKEFIIKANKAVTNGEINLKDLPGSSGRLDLLCRCVNSAFFLSHD
FT                   MRRDTIFYSVNYGDPNPPVTLKFVGSELKRVSPDERSIALFIKKALEKDATELWKESTS
FT                   GIYSSKREFRDIILEKKNEGKRIFYLHLNGKPLEDFEFKDDEDFLFVLGDHIGIGDEDE
FT                   EFLEEIGAEKISLSPLELHADHCIILVHNILDRLK"
FT   gene            183626..184066
FT                   /locus_tag="MmarC7_0172"
FT   CDS_pept        183626..184066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0172"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: mmq:MmarC5_0732
FT                   putative CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65242"
FT                   /db_xref="GOA:A6VFL6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFL6"
FT                   /protein_id="ABR65242.1"
FT                   /translation="MDDVPKVVVFKLASNEYCLRVTGVREVLKLQDITSIPNTPSYIVG
FT                   VTNIRGEIMPIIDLRKKLNLFEDVADEDSEKLVMVVEIDGVPIGILVDSVSDVMQISSE
FT                   QIEDIEGIKKNASGEYIEGIAKIGNRLIIILDIKNLIDPQEF"
FT   gene            184109..185209
FT                   /locus_tag="MmarC7_0173"
FT   CDS_pept        184109..185209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0173"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: mmq:MmarC5_0733 response regulator receiver
FT                   modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65243"
FT                   /db_xref="GOA:A6VFL7"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFL7"
FT                   /protein_id="ABR65243.1"
FT                   /translation="MSKIKVLVVDDSAFMRKVLEDILKADDEIEVVATARDGKEAIELA
FT                   KKLEPNVITMDVEMPIMNGIDATKQIMEHKPTPILMLSAITKQGSEATLKALDNGAVDF
FT                   IEKPSGSVSLDIRTIGENIIKKVKAASKSTARIKSSRIFETIKKEEKSDNNALEKTIEK
FT                   ISGLSPEKLNNMAIMIGSSTGGPPVVSEIISNIPKNMPPIFIVQHMPRGFTRVFAERMN
FT                   NNSSITVKEAEHGELVKPDHAYVAPGDSQMILQKRGGNIYILIDEDMPKIHGTKPTVDV
FT                   TAEYVTKYYGKNTIGVILTGIGRDGANGMKMVKNKGGYTIAQNQETCVIYGMPKTAIEM
FT                   NVVDKVMDPTNIPDEIIKFAKKIGGR"
FT   gene            185211..187970
FT                   /locus_tag="MmarC7_0174"
FT   CDS_pept        185211..187970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0174"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; P2 response regulator
FT                   binding domain protein; KEGG: mmp:MMP0927 chemotaxis
FT                   protein CheA"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65244"
FT                   /db_xref="GOA:A6VFL8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFL8"
FT                   /protein_id="ABR65244.1"
FT                   /translation="MDDMEQYKELFMTEAEEHLQSLNQNMVELENCPEDSERIINMIFR
FT                   SAHTLKGSARTLGFEHISSLTHHMEDILDYIRDGRIKVNPEIVDLLFKCLDALETMVSE
FT                   VGDGEDTTSVDVDSLVEIIKSVKNKYLSGEYSEEDFSEDIEITEELVEEESVKNISSNS
FT                   SSIKLANESTTVFIKENSSASAEKPENLDSVLNQMHESASALLTILDALEYTELKDTLK
FT                   NIDELATGLLNETVAVTENSLAVLKSALLAMEQIAKVIETGSDPKNDYSELNEKISSTL
FT                   SETVGESVEDKEIILDHTVFDLEEVSDKLISEINENKKIYHVKAKVVDDCLLKAVRLTM
FT                   VLSKLKEIGEVILSIPSEAELLSSGSGELDVLVSTDLDEIDISNSVCEMEYVLSAGLEL
FT                   KFKNTSSKEVPNIAKPKTQAKCYSSPGQYKIDIKIDEECLLKAVRAYMVLKDLKEKGNI
FT                   LETEPSESKIQEGNLGGNTVTIYYDTDESEDDIKEIILKTPEITGFSIEPIHQDIEISE
FT                   QPEKAKSAEGNGSKKQADNSASKKSQTVRVNIEKLDKLMNLVGEVVINRANFTQIATKY
FT                   DLKELHNAVGRLNMLATELQEEVMGMRMIPVAFVFNRFPRTVRDTAKALSKEIDFEIEG
FT                   SEIELDRTVLDELAEPLTHLIRNSLDHGIEHSDERIKLGKPEKGILKLIATRERDRVNI
FT                   VIKDDGKGIDPEAMRKKVVKKGLYSKEWAEKLTDNEAINVIFLPGFSTAEVVSDVSGRG
FT                   VGMDVVRSKIESLGGSVSVHSEVGKGTEITLHLPLTMAIIQTLLVRLKEQIYALPLTSV
FT                   LDVISVEKDQIKNLEGQEAIIYRNHILPVIWLKDALNTYEVSEPENLYVVVVEKNKGKV
FT                   GVILDEVIGRDEIVVKPLTGILKNINGLAGATILGDGRVALILDLNNI"
FT   gene            187981..188445
FT                   /locus_tag="MmarC7_0175"
FT   CDS_pept        187981..188445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0175"
FT                   /product="CheD"
FT                   /note="stimulates methylation of MCP proteins; PFAM: CheD
FT                   family protein; KEGG: mmp:MMP0928 chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65245"
FT                   /db_xref="GOA:A6VFL9"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFL9"
FT                   /protein_id="ABR65245.1"
FT                   /translation="MVLKVKMGDIGVAKSPESIETLLGSCVAIILYDRGKKVGGVAHVM
FT                   LPKSRNTAERTPGKYANTAIPELIDRLTKLGARKDKLTAKLAGGAAMFKCNSNTIDVGK
FT                   KNIEASKEEVRKVGLRIASEDLGGDTGRTITLSLKDGSVLVRKGAELKVI"
FT   gene            188462..189865
FT                   /locus_tag="MmarC7_0176"
FT   CDS_pept        188462..189865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0176"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mmp:MMP0929 methyl-accepting chemotaxis protein (MCP)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65246"
FT                   /db_xref="GOA:A6VFM0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFM0"
FT                   /protein_id="ABR65246.1"
FT                   /translation="MKTQKPYIPILVTAILSSAIIFVSAYVLMMTSMFDLKILFVLFIV
FT                   SAVISTVVGYTILKKTCLDKVDKFLASSSKIIGKDYDHCDEEMFNTVISDFEKIKKDED
FT                   FLKIYKKEVTNTFGELHTIFKSLENGDFTIRADTNRKHNALQVTTNNAIVNVATMVNDL
FT                   KKQVAYLNSELLKAKEDLVRAEETSEQVADAASQVATAAADQSAKLQDVSDQLEATSEI
FT                   TTAVTSAAEDTVVAASEIEENSEIGVKKVENAIETMQGITNVIENLGKAIQELGDESKK
FT                   INEVTVLIKDVAEQTGLLALNASIEAARAGDAGKGFAVVASEIKSLAEEIKKSVEDINR
FT                   TINGVNKKVEATIDLGISGRDEVDKGVIAIDEVNGAFLKIRESVETTSEKINSIKINAE
FT                   KSASNVESALRNAQDIASISEEFAATAEELTASAEEQSRIMNEIDDAIEEITSASEKIS
FT                   NDVSKFKTQ"
FT   sig_peptide     188462..188539
FT                   /locus_tag="MmarC7_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.736 at
FT                   residue 26"
FT   gene            complement(189888..190700)
FT                   /locus_tag="MmarC7_0177"
FT   CDS_pept        complement(189888..190700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0177"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   mmp:MMP0930 chemotaxis protein CheR"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65247"
FT                   /db_xref="GOA:A6VFM1"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFM1"
FT                   /protein_id="ABR65247.1"
FT                   /translation="MEDMYFKRIKRDIGTKLKIQVDQYKDTYILRRVSVRMRLCKCKDF
FT                   KEYYEFLTKNPSEYEKLENTLTVNVTEFWRDRTVYNELRNVFEKMVTDRKVRTIRIWSA
FT                   GCSSGEEPYGLAVMIKELMEKHNQKFLRVSITATDLDKEILERAKEGKYILKQFKNMDA
FT                   DVIEKYFDKLNDNELQIKKEIKRMVQFKKHDLIKEGPMNDMNMVLCRNVIIYFDKEIQE
FT                   KLFMKFHEALIDDGYLVLGKTEMLHGDSRNAFKPANHRERIYQKLKIN"
FT   gene            complement(190764..191372)
FT                   /locus_tag="MmarC7_0178"
FT   CDS_pept        complement(190764..191372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0178"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: mmp:MMP0931
FT                   putative chemotaxis protein CheC"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65248"
FT                   /db_xref="GOA:A6VFM2"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFM2"
FT                   /protein_id="ABR65248.1"
FT                   /translation="MGVIETINKIVDIGKDAAENTANAFTGLTGEDTDIHFTGLRFVPV
FT                   EYIPEQFSDETCKVVRINFDGILSGTSVLMVNEEDSIKLEKLLLLDLVWDGLVNKTELP
FT                   DYAEIEESVLNEVANVVLASFLNVFANALKSEINITTPEFTKDSGFNIVESLVLEMADK
FT                   GIENALVFDNKIDIVGRFPIKSNIFILIDPEKLENLDKL"
FT   gene            complement(191392..192081)
FT                   /locus_tag="MmarC7_0179"
FT   CDS_pept        complement(191392..192081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0179"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: mmp:MMP0932
FT                   probable chemotaxis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65249"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFM3"
FT                   /protein_id="ABR65249.1"
FT                   /translation="MKFSENEWKELLEIIVDEEASVETMVVKNNYDLKDVAAFENIGKT
FT                   AAEKAASFVQEMSGDCVEVKVFKIELNSAQDFKNMADISESNVFTKIDFSGDICGTGVL
FT                   IFSEESAKSMADSMLVGMGMEGDSEEVFCEMRVSAINETCNLLISAFVDTIANFMNTSL
FT                   NMTPPEFSTGNLGDFIEAELKNYEINSEDTLFTFTSELFSKGIGSGFEVYIVMNPESTD
FT                   KLFEKLN"
FT   gene            complement(192097..192468)
FT                   /locus_tag="MmarC7_0180"
FT   CDS_pept        complement(192097..192468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0180"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: mmp:MMP0933
FT                   chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65250"
FT                   /db_xref="GOA:A6VFM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFM4"
FT                   /protein_id="ABR65250.1"
FT                   /translation="MASIVKTMIVDDSAFMRNILKRILTTTNKYVVIGEASNGAEAIKM
FT                   AEELQPDLISMDIVMPETDGITATKAIKEKTPEIKIVMCTSVDQEQKMIDAVNAGADGY
FT                   IVKPFQAPKILEQFNKLFP"
FT   gene            complement(192552..193598)
FT                   /locus_tag="MmarC7_0181"
FT   CDS_pept        complement(192552..193598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0181"
FT                   /product="Protein of unknown function DUF439"
FT                   /note="PFAM: Protein of unknown function DUF439; KEGG:
FT                   mmp:MMP0934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65251"
FT                   /db_xref="InterPro:IPR007381"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFM5"
FT                   /protein_id="ABR65251.1"
FT                   /translation="MAKSKLVATFNGKGIIATPYTLRDPFTKWRNLKIELYEDSLEFIF
FT                   ENKKIEASFDQIDDIGFELPRKALEIAKNNLDDISIYGSFRLSPPDEDKFSIGYAPEAS
FT                   IYGEPTINAFLKKLFQQLLNKKEMKLQYARIVGGSVDVDAQWEDGYLVFAKKPVKRGVS
FT                   VIEEMVLAAAVTSGDKPKVYDLFNNIESISLEKKKIDDEDKDVLEIKQLRGGETVNSYI
FT                   HIPSTKMLYVLRYISKLTKYHNTVKSLLPKSEDDLDSEIAVESWSGDKLKNEVDQLTPE
FT                   EQEVLAAIYTGITSLELPGMMGMDIDEVERILEKLIDRGFLDLIRIRKEADLTEKGRAV
FT                   TNFIITNF"
FT   gene            193840..194337
FT                   /locus_tag="MmarC7_0182"
FT   CDS_pept        193840..194337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0182"
FT                   /product="Protein of unknown function UPF0254"
FT                   /note="PFAM: Protein of unknown function UPF0254; KEGG:
FT                   mmq:MmarC5_0742 protein of unknown function UPF0254"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65252"
FT                   /db_xref="InterPro:IPR009625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFM6"
FT                   /protein_id="ABR65252.1"
FT                   /translation="MISVATAECFTHGKIGVKIHKMACGYKEVEKDPNYSIINGNVFVM
FT                   ASMFLPSKKGIESLLDVKLPEPDYVFKYSKAYTQENDILVAKIVANALKNKLNCDIAIS
FT                   STAGIGNGAICILTDKKEYNFTSEVYGDLIKGENILKRQENGINKAFDTVIEILKKEYG
FT                   LK"
FT   gene            194343..195185
FT                   /locus_tag="MmarC7_0183"
FT   CDS_pept        194343..195185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0183"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: mmq:MmarC5_0743
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65253"
FT                   /db_xref="GOA:A6VFM7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFM7"
FT                   /protein_id="ABR65253.1"
FT                   /translation="MMDTKTKLLGLIGHPVDHSFSPIMHNTAIEDLGINYVYLAFDVSE
FT                   ENLKNVVSGAKALQITGFNVTIPHKINIMKYLDEIDEDAKAIGAVNTVKIENGKAIGYN
FT                   TDGIGAKRTLEEKAGILIDKNILIIGSGGASRAVCFELAKDNNLTIINRNIEKAKILSE
FT                   EFSKKLKKQKPINYGDLDLDIKNFDIILNTTPVGMHPNTNVDPVIPLKNIKKDAVVMDL
FT                   IYNPIEPVFLKEAIKYGAKTINGLGMLVYQGAVSFEIWTGMKPDIYVMKKAINSKIRL"
FT   gene            195190..195936
FT                   /locus_tag="MmarC7_0184"
FT   CDS_pept        195190..195936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0184"
FT                   /product="F420-dependent oxidoreductase, putative"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase, putative;
FT                   PFAM: protein of unknown function DUF129; KEGG:
FT                   mmq:MmarC5_0744 F420-dependent oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65254"
FT                   /db_xref="GOA:A6VFM8"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="InterPro:IPR023659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFM8"
FT                   /protein_id="ABR65254.1"
FT                   /translation="MITERVKMEVIGLEIPLISGNEDYTLAELISKYPLKDKDIIVIAE
FT                   TVVSKSEKNVILKDTIKPSNEAIELSKKLGKEPEVVQVILDESNETVRLGPNFIVTETK
FT                   HGFVCANSGVDESNTSKGIKPLPKNPDKSANEIRKGIEEITGKNVGVIINDSMGRPFRK
FT                   GSCGVAIGVSGVCGLWDRKGEKDLFGRELKTTEVGIADELAATASVVMGQSNEGIPLVI
FT                   IRNAPVPFNDGTGKELIRKKEEDVFR"
FT   gene            complement(195980..196753)
FT                   /locus_tag="MmarC7_0185"
FT   CDS_pept        complement(195980..196753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0185"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; KEGG: mmp:MMP0938
FT                   cobalamin (5'-phosphate) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65255"
FT                   /db_xref="GOA:A6VFM9"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFM9"
FT                   /protein_id="ABR65255.1"
FT                   /translation="MIDELKGLILFMTRIPIGRSKSDFEGIAKYFMFMPLVGTLISLFG
FT                   VVTAYLLNYLGFTSGNIIGAAVLFTLLYVQGFHHLDGLADYGDAWMVTGNARKKLEVMK
FT                   DVYMGIGGFVFVFFVELLSIFSFAYLFETNEFTLFLKYVIIIETCSRLGLLSCACCGIP
FT                   ANEGTGRYFAKRSNESHLLAGLIFSLGVSMLLQIPKIGVLCSILAVFLGMFIAWKSNNK
FT                   LGCVTGDIFGATAEISRMVFLIVIIAFTPYFALVG"
FT   gene            complement(196769..197446)
FT                   /locus_tag="MmarC7_0186"
FT   CDS_pept        complement(196769..197446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0186"
FT                   /product="HAD superfamily (subfamily IA) hydrolase,
FT                   TIGR02253"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; HAD superfamily (subfamily IA) hydrolase,
FT                   TIGR02253; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mmq:MmarC5_0746 HAD superfamily (subfamily
FT                   IA) hydrolase, TIGR02253"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65256"
FT                   /db_xref="GOA:A6VFN0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011950"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFN0"
FT                   /protein_id="ABR65256.1"
FT                   /translation="MIRGVLFDLDDTLYNSSSFASRARKEALRSMIDIGLNATEEDALK
FT                   ILNKIIEQKGSNYGGHFNDLVKAVTGTYDPKIITTGIITYHNVKFALLRPYSDTIKTLM
FT                   DLRSMGLSLGILTDGITIKQWEKLIRLGIHPFFDEVITSEEYGLGKPNIEFFNYGLKKI
FT                   NLKPEEVVYVGDRADKDMVPAKNVGMTTVRILQGKYSEITDDVSDYTIKNISELSKIIK
FT                   PLI"
FT   gene            complement(197464..197748)
FT                   /locus_tag="MmarC7_0187"
FT   CDS_pept        complement(197464..197748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0187"
FT                   /product="EhbP-like protein"
FT                   /note="KEGG: mmq:MmarC5_0747 EhbP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65257"
FT                   /db_xref="InterPro:IPR019597"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFN1"
FT                   /protein_id="ABR65257.1"
FT                   /translation="MPKMLLLPKLTMSLGGYIRETVEIYQEDGVKEFPHRNVVVGNPTN
FT                   EPIKIDVPAYDDEWVKRHQELGLIVVPVEVGEDFVGIFKMVEEKVKKAD"
FT   gene            complement(197816..199324)
FT                   /locus_tag="MmarC7_0188"
FT   CDS_pept        complement(197816..199324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0188"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: PUA domain containing protein;
FT                   phosphoadenosine phosphosulfate reductase; KEGG:
FT                   mmq:MmarC5_0748 phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65258"
FT                   /db_xref="GOA:A6VFN2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFN2"
FT                   /protein_id="ABR65258.1"
FT                   /translation="MKTILGKIHLKWCKNCNIPVLDTKCAICDSETVEVKVTPPGDARP
FT                   AFKGDLDLINKTIKSQFGIEENLFKNKLVLVNKAPGIEYFQEIVVDGIIFGILNFNEKK
FT                   HEWKIIPTIEGARRLITAGCKKKLLVVKEDVPKFILNKGASVLRPGVAFASEDICIDDD
FT                   VIILIEKPDSSMDFNELDVLGVGRSRMNYEEIVNSEKGMVAKVRKSELPKNSEVLHEIG
FT                   EFDEAIEKMIEANKNAMQKVESNSIGFMRNTVVKIGRPVSVAYSGGKDSLAVLLLAFEA
FT                   FKNSENPVEFDVLFNDTGIEFNETLENIEEISKMYNLEILKTNSGEFWEKLEEYGPPGR
FT                   DNRWCSEVCKVSPLGILIDEKYEKGCFSFVGLRKYESINRSKKPRIWNSPTIKKQMLSA
FT                   PILNWTAMHVWIYILKHKAPYNVLYGQCFDRVGCFMCPAMEIGEIELVKMSYPELWEKW
FT                   EGFLKNHAQKCGKDESWVKGGWRWTNKTRSNQKQDEQINENWLG"
FT   gene            complement(199361..200173)
FT                   /locus_tag="MmarC7_0189"
FT   CDS_pept        complement(199361..200173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0189"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mmq:MmarC5_0749 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65259"
FT                   /db_xref="GOA:A6VFN3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFN3"
FT                   /protein_id="ABR65259.1"
FT                   /translation="MEIFLIYLLLVVVGCIVGFTTGALGLGGGFIMVPTLMYIFQNLGI
FT                   SDDHVVAMAVGTSLSVIFLTSLNSAYSHSKFGNIIWRYSILLGFSGILGTFVGVRIVTN
FT                   YISGDLHRMLFGVILIILSLNMAFNKTNPQVEINKNVNYLPVVLCGFLIGILSSMFGIG
FT                   GGTIAIPILTLFLKTPIKRSIGTSLGMMVIISLSGFLGYLFSPVEIADTYKYLNFIGYV
FT                   SISAALSIGAMSIIFSRYGAKISNNINSKLLKKFFGIILMFVGLTMII"
FT   sig_peptide     complement(200096..200173)
FT                   /locus_tag="MmarC7_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.517 at
FT                   residue 26"
FT   gene            complement(200187..200639)
FT                   /locus_tag="MmarC7_0190"
FT   CDS_pept        complement(200187..200639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0190"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: mmq:MmarC5_0750
FT                   cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65260"
FT                   /db_xref="GOA:A6VFN4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024902"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFN4"
FT                   /protein_id="ABR65260.1"
FT                   /translation="MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKK
FT                   IKGRSPVIPEEQRKIMIEALKPVDRAVLGSLTNKLEPILEIRPDIIVLGPDQTTYQITE
FT                   LKSQLAKHFLYPEVLKVEEYVRCPFHSSFDILKEIVRRWCCKELKV"
FT   gene            complement(200662..201672)
FT                   /locus_tag="MmarC7_0191"
FT   CDS_pept        complement(200662..201672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0191"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mmp:MMP0944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65261"
FT                   /db_xref="GOA:A6VFN5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFN5"
FT                   /protein_id="ABR65261.1"
FT                   /translation="MKENEYRFIMRVFVLISFASVLFVAFPFLDTIAFACAFAYMTEPF
FT                   FNVIKRYTGRNLGAIICILMITVPALSLVVLILTDVVEFLNTLNIQSFVDNSIQFVNYF
FT                   GLQNIAKEDLNSIISELWTFLKPTVNKMASQIYGLPLLFIKGLVTIFLTYYFLKDGYRF
FT                   KDAIMPHVPEVYHVQTELFIRKLHEAYKNLFVVNALTAFTVGLISIAGFWAIGIPNPVT
FT                   LGALSGILTLLPIVGGWTIYMPLSVYYVAVGMYSKAVLLFGFGVIFLSLAPDFAIRPRL
FT                   VNHESSIHPALALVAFLMGPLALGVTGFALGPLIMGTFDAIFRVKNGKDSIINLK"
FT   sig_peptide     complement(201565..201672)
FT                   /locus_tag="MmarC7_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.264 at
FT                   residue 36"
FT   gene            201765..203606
FT                   /locus_tag="MmarC7_0192"
FT   CDS_pept        201765..203606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0192"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /note="PFAM: Aldehyde ferredoxin oxidoreductase; KEGG:
FT                   mmq:MmarC5_0752 aldehyde ferredoxin oxidoreductase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65262"
FT                   /db_xref="GOA:A6VFN6"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFN6"
FT                   /protein_id="ABR65262.1"
FT                   /translation="MNILIDGSRQNYEVLSGEEFPISFGIDLHDKYETWKYDAYDKKNL
FT                   FCFGKGVLPIVGGHRLIFSFRSPLWDGFHFSAMGGAGYTFKDTGVQNVAITGKCEVPSI
FT                   LVINGEEDELKIKFIPFTEEIRDIYEFNDKIIELFKEKNYRAFLVGSASKTTNMGAIYS
FT                   QTIRNGKIVEGSEDWAARGGGGSVLYQAHNILGVVFFGKKTPEKNVKSVVEEHYQKQYS
FT                   KVILEHTEKYRYSEERKTGGTFGNNYHVTMDLTPIFNWRMPFIDKNRRLKLHKKILEYF
FT                   VSRFDKEAIETKNWTNCGEPCPVVCKKYRNGLHVDYEPYEANGPCIGVFDLYAADHVVH
FT                   TIDKLGFDAIEFGNLCSFVFELLDNGMLKPEEVGIEKPVFDISNFENDADILKNSKHNA
FT                   EQAVKLAEIIAFQTNEFGKLCKFGARRAAKILNKKYPERVENKKFEDFGVYDSFGENGQ
FT                   ISPTMYWAIGNFMPYLIQGKYLTHYQCGVFLEPEELAELSVKNSIEEITLENLGICRFH
FT                   RKWVSPIIDKLVNEVSDVDITKESMELFKKIAKYDSNIGYPLVESKRVKELIISGAFEF
FT                   ENEKWSEEFEKGNFEEYIKRVLEKYSELLDIEWKLKE"
FT   gene            complement(203655..205064)
FT                   /locus_tag="MmarC7_0193"
FT   CDS_pept        complement(203655..205064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0193"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: mmq:MmarC5_0753
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65263"
FT                   /db_xref="GOA:A6VFN7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFN7"
FT                   /protein_id="ABR65263.1"
FT                   /translation="MSEDLSMKCGLEIHVQVDTNSKLFCQCPTNYKDVEPNTNICPVCI
FT                   GHPGAKPMPPNKKAIDMAIMVAKMLGCEMVIDKDIYFQRKHYNYPDLPSGYQKTSVPIG
FT                   EHGTFLGVGITEVHLEEDPGQYKPDLGTVDYNRSGTPLIEIVTDPDMKSPEEAREFLRQ
FT                   LLRLFRYIGNLRGEGTMRADTNISIKYNGIQGNRVEVKNVNSIRGVYKVLKYELIRQKN
FT                   VLRRGGEIKLETRAFMESQMITKGMRSKETADDYRYIPDPDLQPIVLSNDWVEKVEAQM
FT                   PETPMNKEKRFVEQYGIKEDDAKVLVSDLELADVFEKVVAELGNDKDGISLAVTWIRNE
FT                   LKRVLVYNKIEFFETNLKPEHMVELINSIKDKTISQKIGKTIIEQMVEHKGEKTPKELI
FT                   SEMGLTVIEDTSELEKACEEAIKNSEKAIEDYKSGNQRALNSVVGQVMKLTRGRAEPGT
FT                   VVEILKKKIDG"
FT   gene            complement(205240..206106)
FT                   /locus_tag="MmarC7_0194"
FT   CDS_pept        complement(205240..206106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0194"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PFAM:
FT                   Histidine biosynthesis protein HisG domain; ATP
FT                   phosphoribosyltransferase catalytic region; KEGG:
FT                   mmp:MMP0947 ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65264"
FT                   /db_xref="GOA:A6VFN8"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFN8"
FT                   /protein_id="ABR65264.1"
FT                   /translation="MILLALPNKGRISKPVNEILEKAGLKISVHGRSLFAQTVDPEIKV
FT                   MFARAKDIPEFVRDGVADVGVTGYDLMLERDTEEELEMLLDFKFGNARLVIAAPENSTV
FT                   NSIKDVKDGMKIATEFPGLTKRYLEKKGLNLEIIELSGATEIAPFIGVSDLICDLTSTG
FT                   TTLQLNRLKEVENVVSSTTRLVANKKSMEDPEKCAKINQVLSGIKSVLYAQSKRLIMMN
FT                   APKDKVSEITSIIPGMGGPTVSEILSNDKMLAINAVIDENKVFETVTNLEMLGARDILV
FT                   VPIERIL"
FT   gene            206374..206730
FT                   /locus_tag="MmarC7_0195"
FT   CDS_pept        206374..206730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0195"
FT                   /product="Protein of unknown function UPF0058"
FT                   /note="PFAM: Protein of unknown function UPF0058; KEGG:
FT                   mmp:MMP0948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65265"
FT                   /db_xref="InterPro:IPR002753"
FT                   /db_xref="InterPro:IPR036519"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFN9"
FT                   /protein_id="ABR65265.1"
FT                   /translation="MHKEQLMELHQFFVHVFKEMVPEGKDCVYLKTYEELDVKPHHIHK
FT                   LKTEQRAAIFLLAACLADGLSERDNTIPENLSKRLAENAFKYINMQSEKYQNLKNVKNS
FT                   IDVQCKRENVRNTV"
FT   gene            206787..208121
FT                   /locus_tag="MmarC7_0196"
FT   CDS_pept        206787..208121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0196"
FT                   /product="tRNA cytidylyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   tRNA nucleotidyltransferase, substrate binding; KEGG:
FT                   mmp:MMP0949 tRNA nucleotidyltransferase (CCA-adding
FT                   enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65266"
FT                   /db_xref="GOA:A6VFP0"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFP0"
FT                   /protein_id="ABR65266.1"
FT                   /translation="MKKLNIGDYNDILNEVLNDISPTEVEKKELKVFSDKIIAKIKDIS
FT                   KKPVVDIIQVGSTARDANLKDDHDIDIFLRFERETDRDTLKESGLKIGKEVIDYFNGKS
FT                   WVEYAEHPYVSGEIEKFNLDIVPCYGIENCEKIISAVDRTPLHNEFLIMSYKNKNLSDD
FT                   IRLLKKFLKGLGIYGSDLKTAGFSGYLCELLILKYGGFLTLISDVKTWKPTKSIVLNEI
FT                   YEMYDLKKDHVFSKFDDPLVVYDPVDLNRNVAAALNEENLCKFIFYSKMFLKNPSKDFF
FT                   YGFDKKITDFLNRRERGYLLTLEIKRPENIVEDVIYPQMEKIQKSINKLVKEHDFEYLR
FT                   YQNFADENTCYLSWEFLVNELPSVKLRIGPPVYSEPGVMNFITHNEHYFVKGCNVCAYK
FT                   TRKYKNIQILFEDIVNGKFRKIITYPKYVCPENAEIRLGTFVERT"
FT   gene            208134..209564
FT                   /locus_tag="MmarC7_0197"
FT   CDS_pept        208134..209564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0197"
FT                   /product="Protein of unknown function DUF530"
FT                   /note="PFAM: Protein of unknown function DUF530; KEGG:
FT                   mmp:MMP0950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65267"
FT                   /db_xref="InterPro:IPR007503"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFP1"
FT                   /protein_id="ABR65267.1"
FT                   /translation="MDSSVLIKECNDFLDCLTNFGDELKDFESKKEDSAYPISETLESN
FT                   LKILENFREKMELQGFDTPYIGVGRLKGGEDDDIYEIINYSSYLRRMVDEKKGSLERVK
FT                   YAIVSHKIAIGNIQEDEGNKTILPYLSFDGSYKEMLSKIPPFFIKAYKRILSAFETEGK
FT                   GILSSITLSLVILENGKRKFKRIKIEEEDYEGYIKKTFGDAIITSLKKNYSKNKLLNDQ
FT                   YVKKILSLAYLSAYADEIIQKIDEKLKESLSDEERCIVKKYKMICSDFKGDDCESGIID
FT                   VRAMDETKLKKMNLKMDLEEKGLYQNGKPLKKLKESLKAEDEIFENISLEVPLKNLSKD
FT                   LLTYYLKKSADERTRSNQFPSILVTPSSAHLNWLIVENIEPKKILDLKFLLEKELPKYE
FT                   IPIKNLGGVSIYLHYDWDFVESFGFEKTEIEGILKLMAAMNDVKELLNDKIDVKKLEEF
FT                   NKIKKDKTKNFLNALGKL"
FT   gene            209575..210495
FT                   /locus_tag="MmarC7_0198"
FT   CDS_pept        209575..210495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0198"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: mmp:MMP0951
FT                   cobalamin biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65268"
FT                   /db_xref="GOA:A6VFP2"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFP2"
FT                   /protein_id="ABR65268.1"
FT                   /translation="MTNPIYLILADFFDRYIGEPPEKIHPVVFIGKLICFFENVFKSTN
FT                   SVNKTRDLLFGFLNVILVLAIVFFMTYEIEQIINSISNSYIKISIYSIILSFSIGHKSL
FT                   IEFSKAPIKFIVNNDLEGAKKSVQCIVSRNTSELDKKHILSASIESASENITDSIIAPL
FT                   IYAAIFGLPGAFLYRAVNTFDAMIGYKSEKYQYYGKTAAYLDDILNFIPSRIAGMLLII
FT                   SAPFYGGNIKSAIYGYFNEGNKTPSPNSGYTMATLANSLNMELEKIGYYKLGKGEITIE
FT                   KALNSLKAVDYSVLLFLIIYTVLLM"
FT   gene            complement(210576..210971)
FT                   /locus_tag="MmarC7_0199"
FT   CDS_pept        complement(210576..210971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0199"
FT                   /product="translation initiation factor eIF-5A"
FT                   /note="TIGRFAM: translation initiation factor eIF-5A; PFAM:
FT                   Eukaryotic initiation factor 5A hypusine (eIF-5A); KEGG:
FT                   mmp:MMP0952 translation initiation factor IF-5a"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65269"
FT                   /db_xref="GOA:A6VFP3"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="InterPro:IPR022847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFP3"
FT                   /protein_id="ABR65269.1"
FT                   /translation="MAGTKPGDLGGVKVGQYVVIEGVACKVMDTAHSKPGKHGGAKVRL
FT                   VAVGIFEPVKKEHVGPASSRIDIPLIDKRKGQVLALMGDNVQIMDMETYETLEIPMPDD
FT                   VEGIESGVEVEYFEAMDRYKITRVISK"
FT   gene            complement(211114..211866)
FT                   /locus_tag="MmarC7_0200"
FT   CDS_pept        complement(211114..211866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0200"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: mmp:MMP0953 precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65270"
FT                   /db_xref="GOA:A6VFP4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFP4"
FT                   /protein_id="ABR65270.1"
FT                   /translation="MLYVVGIGPGNEEYFTKEAENALNSVDLIVCYTGYKKYVERFDTE
FT                   IYVSGMTKEVERVEYALKEAENKNVALVSNGDATIYGLASLAYELNEKNLHNVKINVVS
FT                   GLTSASVCSSILGAPLNHDFAVVSLSNLLTPLETILKRINCAIESDLVLAIYNPLGKKR
FT                   KEPFLKTIEIISNYSKNRNIDYIIGIVKNAGRNDCEYKITTINNLVDNLDEFMQYIDMS
FT                   TTLVVGNSNTKIIDGMMITPRGYMSKYE"
FT   gene            complement(212147..212620)
FT                   /locus_tag="MmarC7_0201"
FT   CDS_pept        complement(212147..212620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFP5"
FT                   /protein_id="ABR65271.1"
FT                   /translation="MEDQTIIFEECYSTARNISSAILKYFIKYNEFEKKGYDIDPYNYT
FT                   KLTIHNMLVFRLIEKEIDMMDLSYEEKNTVALLKKYKNRDISELSPKNYLKFSVWASLD
FT                   GNIKYRLSDCRQELKDDDKWDMVTAYLVPHTNIIKISNDIFLKTAIKNDLIEL"
FT   gene            213190..214053
FT                   /locus_tag="MmarC7_0202"
FT   CDS_pept        213190..214053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0202"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: mmp:MMP0955 succinate--CoA
FT                   ligase (ADP-forming); alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65272"
FT                   /db_xref="GOA:A6VFP6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFP6"
FT                   /protein_id="ABR65272.1"
FT                   /translation="MILLDENTRAIVQGITGNQGKFHTKNMLECNTNIVAGVTPGKGGQ
FT                   DVYGIPVYDTVLETVEKYDANASLIFIPAPFVKDAAYEAIDAGIDLVTIITEHIPIQDS
FT                   MDIVAYGKKHGVNIIGPNTPGLASPKVGKLGIIPMSILKEGNIGMVSRSGTLTYEIASQ
FT                   LTSSNYGQSSCVGIGGDPITGLRYIEVLEMFEKDSETDAVVMVGEIGGNAEENAAEKMI
FT                   SKMKKPVISYIAGQSAPEGKRMGHAGAIIEKGVGTAKSKMEALENAGAHVAKRISDIPL
FT                   LLKEII"
FT   gene            214101..216545
FT                   /locus_tag="MmarC7_0203"
FT   CDS_pept        214101..216545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0203"
FT                   /product="DNA topoisomerase I"
FT                   /note="TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM domain
FT                   protein; DNA topoisomerase type IA central domain protein;
FT                   DNA topoisomerase type IA zn finger domain protein; SMART:
FT                   DNA topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein; KEGG: mmp:MMP0956
FT                   DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65273"
FT                   /db_xref="GOA:A6VFP7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005739"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFP7"
FT                   /protein_id="ABR65273.1"
FT                   /translation="MTGLIICEKPNVAKKIAEALGKPKKKSHNSVPYYEVERSGENVIV
FT                   ASAVGHLYTLQEKTKTKFGDYPVYDIDWVPASTLDEKKYIQKYIDALKKVSKEANKFYV
FT                   ATDWDIEGELIGYHALNFSCGQKNAHRLRFSSLTKKEIVKAYETPNEIDFGLVDAGDSR
FT                   HKIDWYFGINVSRALMQAVSSVKRWKTLSTGRVQGPALAFLVDKEMEIKNFVPTPYWVL
FT                   EALLDNELIAIHELEKFWDEEQANEAFEKVKGQKEATVSDVKKTMKSIPPNPPFDLGAL
FT                   QREAHNMFRFSPKKTQEIAQKLYEKGYCSYPRTSSQKLPDDKAYMDEILKNLSKNKNYK
FT                   PYIERILSENRKPISGKKDDPAHPAVHAVDVPKEHLPDDELKLYELIARRTIALYWDNT
FT                   EREYSKINLDINGEPFKLSGSRTVKEGWHEIYYYTKFDEIELPDLKEKDVINVNNINFE
FT                   AKETKPPKRYTMASIIKELEKRKLGTKATRADILEKLTKRGYVIEDGSLTVTDLGIGVT
FT                   ETLRKYCPEIVEETLTRDLEDKLELIQDKKIKKEDVITETQNKLTKILGEFRLKEKEIG
FT                   NELVDKLDSTNRSLQIIGKCKCGGDLIIIRTKGKKRFVGCSNYPDCDVTFPLPQKGRIK
FT                   VLNEVCETCHNPIIGLDRVKICVNPDCTTRISEEDKKEIEKAEKEEKICPKCGGKLLIK
FT                   KGPYGVFRGCENYPKCKYTEKLNGESNEKEIVGKCPKCGSDLFKRRGRFGEFIGCSNYP
FT                   KCRHTEKIEKKKDDNADGTKAEKNEEPKPKTTKKSAPKKTETKKTTKSTAKKTTAKKTT
FT                   KK"
FT   gene            complement(216581..217486)
FT                   /locus_tag="MmarC7_0204"
FT   CDS_pept        complement(216581..217486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0204"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmp:MMP0959 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65274"
FT                   /db_xref="GOA:A6VFP8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFP8"
FT                   /protein_id="ABR65274.1"
FT                   /translation="MVYDLIIIGGGPAGLTAGIYAMRAKISTLCLEKENEGGKIAEAGI
FT                   VENYPGFESIKGFELAQKFSEHAKHFELPIIHEEVEKIDTSSKPYKVITKNEKYEAKSI
FT                   IIASGSRYKKPGLNEDDYMGKGVCYCVMCDAFFFLNKEIIVLGRGTSAIMAAYNLKDIA
FT                   KKITIVTDRPELRAVEKIMEERMNLMTNLEVVLNAKPIKIVGTEKAEGVKVSINGTEKT
FT                   IFAEGIFMSFGYVPNTEFLEKSDIKLNKRKFIETDENCKTSVDGIYACGDVTGGILQVS
FT                   KAVGEGVTAFTGALSSIQKE"
FT   gene            complement(217573..218574)
FT                   /locus_tag="MmarC7_0205"
FT   CDS_pept        complement(217573..218574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65275"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFP9"
FT                   /protein_id="ABR65275.1"
FT                   /translation="MVCQKEFTNLYFKHTYPQYWNRIIEKYGLKPVNTNEFTALSSHRF
FT                   IGILGDFISKNITAGPCLLTHQEIKSLNYNTTEEEVLKMLMRHPTLEDYVSIALETNED
FT                   FETNIIIETYEYAKLIEYKTKISFEDALELTKKAAENLINYYNKKLSNNVNYHLTHKNS
FT                   EDARLRELSLEFKTYFLNNANLSKKAKEIIKENPEESTWLRIKASFLPEFIKKDESTII
FT                   EPASSIEGMIYASVLSNSSGIVTRSPQTLNNKPVMNEGIENEILYLNNDISEELKKLIL
FT                   PKTKKTQYGCPAYNIFAFLDTEDISKIEINCNDENIGGCVFNLKEKLESFKP"
FT   gene            218917..220416
FT                   /locus_tag="MmarC7_0206"
FT   CDS_pept        218917..220416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65276"
FT                   /db_xref="InterPro:IPR018694"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ0"
FT                   /protein_id="ABR65276.1"
FT                   /translation="MEEIYSKMVDEAMAAQWADVDIIKEKRGHEFKIKHAKGYVDVANK
FT                   MEAVGNQDASVFKLHKDSINAHFDVLCDLTKTVRPEDDPFVEHYQTPAILEIMYKEDPE
FT                   FRKSVEKFIQTIEKSEALIGREVLRRYGGFYGPTCVVDFALIPGSTSNIVNRILKNVDM
FT                   PLEHKQAILASKSWGMNTSYGFGEKFANAVEAGKSLTDAVNEEIEMIKFIYDKPIEAQA
FT                   KLMDDFGHESFDVQKYMAEYKKKMKSAVLAAMESEVHYGNIVTLPAYCVGDIAHHIAQS
FT                   TFNMCKDDVIMAIIESVSNVMDNTLRSNVKNFKNEYEVLSLATGSTAAATECILELDGF
FT                   NAPTVVDLLTKRFHNYVQLYPTRGAAAELHNHDFMDMIYRGWKLIDKARRVKNGSDAPI
FT                   TPKVGNFKVDLNPIFKNQVIMNPQRYAYPACAITVRFSALMRLADYPCLLTSEPITATL
FT                   MTNIIALHKETPGAPARVCKDCATACLVDFRHQYCQYKEAI"
FT   gene            220449..220664
FT                   /locus_tag="MmarC7_0207"
FT   CDS_pept        220449..220664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0207"
FT                   /product="zinc finger protein"
FT                   /note="KEGG: mmp:MMP0962 zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65277"
FT                   /db_xref="InterPro:IPR017211"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ1"
FT                   /protein_id="ABR65277.1"
FT                   /translation="MKCYLCKLEGKDTDAVASCIVCGMGVCMNHVVREEVDQWEGGYPF
FT                   PATKLKKTIPRMLCMPCYNALQEGKK"
FT   gene            220661..221380
FT                   /locus_tag="MmarC7_0208"
FT   CDS_pept        220661..221380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0208"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: mmp:MMP0963 aquaporin related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65278"
FT                   /db_xref="GOA:A6VFQ2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ2"
FT                   /protein_id="ABR65278.1"
FT                   /translation="MSLVKRLLAECLGTGVLVFFGPGAAAMTLMITNNTGTAGIGLLGG
FT                   LGDWFAIGFAFALAIAAVIYSLGRVSGAHINPAVTVGLWAVKKFPTKEVIPYIIAQLTG
FT                   AAIGSILFFACVGLDSVTVGGLGATAPFSGISYFQAILAEFIGTFLLMFVIMGVAVDKR
FT                   APAGFAGLVIGLTVGAIITTTGNIAGSSLNPARTFGPYLIDSIYGLNLWYYFPIYIIGP
FT                   LLGAIVAAFTYEYLNRE"
FT   sig_peptide     220661..220741
FT                   /locus_tag="MmarC7_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.717 at
FT                   residue 27"
FT   gene            221510..221767
FT                   /locus_tag="MmarC7_0209"
FT   CDS_pept        221510..221767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65279"
FT                   /db_xref="GOA:A6VFQ3"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ3"
FT                   /protein_id="ABR65279.1"
FT                   /translation="MGAISEYFEIKNEIGELKEEVSKKINDSNEFANSRSESMRHINKK
FT                   IISKKKRLKNAENRIIIYYIFPLFMITIILAYFYLRLNFL"
FT   gene            complement(221816..222394)
FT                   /locus_tag="MmarC7_0210"
FT   CDS_pept        complement(221816..222394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0210"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: mmp:MMP0965 formylmethanofuran dehydrogenase
FT                   subunit E related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65280"
FT                   /db_xref="GOA:A6VFQ4"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR026328"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ4"
FT                   /protein_id="ABR65280.1"
FT                   /translation="MNEDYQKTIEFHGHECPGVAIGYRVSKYVLDHYERSEDEQLVAIV
FT                   ENNSCSVDGIQQMLGCTFGKGNLKFKDNGKHVYTFYSRDNNKALRMYLKYNLADKVGTF
FT                   NKKFNEGTLTEEEKKEMFERRKEAIKHLLEAPEEELFDVKWVKIEEPTKARLYPSLTCD
FT                   NCGETFMEIKGRTIDGKIVCKECFQKLVH"
FT   gene            complement(222460..223179)
FT                   /locus_tag="MmarC7_0211"
FT   CDS_pept        complement(222460..223179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0211"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: mmp:MMP0966 uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65281"
FT                   /db_xref="GOA:A6VFQ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ5"
FT                   /protein_id="ABR65281.1"
FT                   /translation="MKVILVGAGPGDEGLITLKGVEAIKNADVIVYDDLIGEKLLKHAK
FT                   EESELIYVGKRKGKHSYKQEEINEILVNKAKENKNVVRLKGGDSFVFGRGGEEVLALKE
FT                   EGIEYEMVPGITSSISVPEIFGIPVTHRKVATSFTVVTGHEAVDKAENEMQVKLSELNA
FT                   DTIVILMGITTLEKHVKELLKNPKRNENTPVAILMDGTRENQRMVKGTLSNIVEKAKLE
FT                   NACPPGIILVGNVVNVL"
FT   gene            223404..223835
FT                   /locus_tag="MmarC7_0212"
FT   CDS_pept        223404..223835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0212"
FT                   /product="Protein of unknown function DUF509"
FT                   /note="PFAM: Protein of unknown function DUF509; KEGG:
FT                   mmp:MMP0967 serine/threonine dehydratase,
FT                   pyridoxal-phosphate attachment site"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65282"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ6"
FT                   /protein_id="ABR65282.1"
FT                   /translation="MIIKGIRDAEVPDEIFKMGLEFQILNADLIATKTHVLHSIYQAKT
FT                   KNNISKNIWMEILLRASGQKQISNAIKVLGARKGNICVICTDEKTFKQIKNIVNGFVDD
FT                   SVLELNEEKEKKIREVFEINLHGKLIERVCEKIALIEVQ"
FT   gene            223848..225122
FT                   /locus_tag="MmarC7_0213"
FT   CDS_pept        223848..225122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0213"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: mmp:MMP0968
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65283"
FT                   /db_xref="GOA:A6VFQ7"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ7"
FT                   /protein_id="ABR65283.1"
FT                   /translation="MIVKKISELNEKDLDVIINRNKTNISGILPTVSEILENVQKNGDN
FT                   ALKEYTKKFDGVEIDNFKVTSEEIDKAYEKIDSKVVESLEKAYMNIKEFHEIQFKNLTE
FT                   WEVEKNGIKAGQIIRCVEKAGCYVPGGRAFYPSTVLMTVTPAKVAGVKKVVVTSPPNGT
FT                   EGNPATLVASDIAKADEIYKIGGAQAIGALAYGTKSIPKVDIIVGPGNIFVTAAKKLVY
FT                   GEVSIDFPAGPSEVLIMCDESSNEEYVAMDFLAQAEHDPNASCVITVTSKEKAEKIKER
FT                   ILMEIKTAKRTEIIEKSILNSAIVIGSLDECIELSNAYAPEHLEIMTKNPREVLKSIEN
FT                   AGSIFLGNYAPVPVGDYASGTNHVLPTSACAKMYSGLSVETFIKKPTVQELTKEGLMEI
FT                   GNIVTTLAEAEGLFNHSEAVKRRLN"
FT   gene            225155..225574
FT                   /locus_tag="MmarC7_0214"
FT   CDS_pept        225155..225574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65284"
FT                   /db_xref="GOA:A6VFQ8"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFQ8"
FT                   /protein_id="ABR65284.1"
FT                   /translation="MMQQLKILISVFVVMMILMVGMKTLNDSELLDTTDSFTETYFDYA
FT                   DSTLELSEKVVNTTENISGNSSKEEAIETVSQAVEDFDDSLDYIMNMEKYLNDPDYSKE
FT                   SEEEVPETPEKTELKTPETEPSEPEDGIVIEVDLK"
FT   gene            225603..227324
FT                   /locus_tag="MmarC7_0215"
FT   CDS_pept        225603..227324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0215"
FT                   /product="DNA ligase I, ATP-dependent Dnl1"
FT                   /EC_number="6.5.1.1"
FT                   /note="TIGRFAM: DNA ligase I, ATP-dependent Dnl1; PFAM: DNA
FT                   ligase domain protein; ATP dependent DNA ligase domain
FT                   protein; ATP dependent DNA ligase; KEGG: mmp:MMP0970
FT                   ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65285"
FT                   /db_xref="GOA:A6VFQ9"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFQ9"
FT                   /protein_id="ABR65285.1"
FT                   /translation="MLFIDFCKILDKIEKTTKRLEKTDYFVELIDFIKTNGKPENLKQV
FT                   SQITIGRVFAEFENKEIGIGPNLLLEAVKTTGISEKDLKSKIKETGDIGIAVENLSSNI
FT                   KQVSLFSQALTLEEVYSTLKKLSEIEGNSSQKKKTRIISNLLILATPVESRYISRLILE
FT                   DMRIGMNIPTILASFSNYFNINKETVEKIYAVTNDIGLLGEKLISGSNIENDSELQLKV
FT                   FRPIKPMLAQLTPSIEAAIIETKMPQFETKYDGARVQVHKSDGNVKIYSRRLENITNSV
FT                   PELVEEIKKIDIDNIILEGECVAMDLSSGKPRPFQDILRRFRRKYDIDKMAEKIALRIY
FT                   FFDVLYYEKGLIDTPLKDRREILEKLFGTNNWDTELSKIEKEIFSNKMLFSSFKLNSDD
FT                   PILAKEFFNWSLSIGHEGIMIKNPDAPYTPGSRVKTMYKVKPTLENLDVVVTRAKIGMG
FT                   KRKDWYGSYEISVKDYEDNLHVIGNVGTGLTEDDLEKLTKIVNEIKIEDLGEEVILEPK
FT                   IVLEVTYEEIQTSEKYEMGYALRFPRVVQIREDKSINDINTLDDVKKIYEIERNRK"
FT   gene            227347..228696
FT                   /locus_tag="MmarC7_0216"
FT   CDS_pept        227347..228696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0216"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: mmp:MMP0971 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65286"
FT                   /db_xref="GOA:A6VFR0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR0"
FT                   /protein_id="ABR65286.1"
FT                   /translation="MAIHPIDFRYGTPEMKKVWEEETKLQKMLEVEAALAMAEAELGMI
FT                   PKEAAEEINRKKSTEFVKLERVKEIEMATRHDVVSVVKAFAEQCEGDAGEYIHFGSTSN
FT                   DIIDTAQSLQFKDAFEVLEEKLKTLRGELLKKAEEHKNTVCIGRTHGQHAVPTTYGMKF
FT                   ALWATEIQRHVERLESSKKRLCVSMITGAVGTMAAIGENGILVHNRVGEILELDPVLIS
FT                   NQVVQRDRHGEFMATLALIAQTLNKIGVTVRSMQRSEIKELEEEFDASKQTGSSTMPHK
FT                   RNPITFEQICGLSRIVKANALAEFDNIPLWEERDLTNSSSERCLFPESCVILDHILNLS
FT                   IKGMRKLSVNLENVNKNLEMTKGLIMAERVMMFLANSGMGRQTGHETVRRCAMKAHDEG
FT                   RHLKEVLLEEPEVMKYVSLEEIEKMFDYKTYIGLAPEIVENVLNEAKNWE"
FT   gene            complement(228771..229184)
FT                   /locus_tag="MmarC7_0217"
FT   CDS_pept        complement(228771..229184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65287"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR1"
FT                   /protein_id="ABR65287.1"
FT                   /translation="MQKIRLFSGILFIMLILMSLCACINSNYSSDDKDQRDEISNAFTS
FT                   IIKNSGGKILEINNSENSWSEITVMVNKDFIGSVTLNTNWNTDCYGKCIIDSIRNSGVI
FT                   AENSIITVNYYLNDELISVYSSETGPKVYYKFE"
FT   sig_peptide     complement(229092..229184)
FT                   /locus_tag="MmarC7_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.480 at
FT                   residue 31"
FT   gene            229676..230323
FT                   /locus_tag="MmarC7_0218"
FT   CDS_pept        229676..230323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0218"
FT                   /product="Protein of unknown function DUF166"
FT                   /note="PFAM: Protein of unknown function DUF166; KEGG:
FT                   mmp:MMP0976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65288"
FT                   /db_xref="InterPro:IPR003745"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR2"
FT                   /protein_id="ABR65288.1"
FT                   /translation="MKVFIVSDGPFGERAYDTIKKEFECEYIILDIPKPESIDDFTEFP
FT                   KEQLEKIKSADILITYTLNPDITLDLVEQVHDNVGYIIVGAWKGKGLKNQLESFKNVIC
FT                   PDIMCELEENGNKVFDEFVLKFGKPEVEIKVENDVATEIKVIRGSPCGGTAFIAEDLIG
FT                   KNISDISTNAGLRIQHYPCRAGRIRLFSDEKSGRYKAATFHHDAFEKALKKR"
FT   gene            230328..231110
FT                   /locus_tag="MmarC7_0219"
FT   CDS_pept        230328..231110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0219"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   mmp:MMP0977 CO dehydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65289"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR3"
FT                   /protein_id="ABR65289.1"
FT                   /translation="MKIAITGKGGVGKTTFSGTLACILSEKYKVYAIDADPDMNLASSL
FT                   GITEKIIPISKMKELIKERTGAEQDSSFGEVFKINPKTGDLPEKLSVNYDENGNLKIMV
FT                   MGTVEKGGTGCVCPASVLLKALIRNLILKKDEVVILDMEAGIEHLGRKTAEAVDVMIVV
FT                   SEASSKSMETVERIKKLAEEIGIKKIVCVLNKISNENEKSFAEENLNRIGLEILGCIPY
FT                   DSEVSVADMKREPLVNYENSKAQNEIRKISEKIMNLKN"
FT   gene            complement(231123..231302)
FT                   /locus_tag="MmarC7_0220"
FT   CDS_pept        complement(231123..231302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65290"
FT                   /db_xref="InterPro:IPR019300"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR4"
FT                   /protein_id="ABR65290.1"
FT                   /translation="MCESAVYLDDGTVIMADVMKIVVNGDTLELYDILNNKKEIKAKFN
FT                   VLDLEGHKIVVTEL"
FT   gene            complement(231402..231866)
FT                   /locus_tag="MmarC7_0221"
FT   CDS_pept        complement(231402..231866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0221"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP0979 conserved archaeal protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65291"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR5"
FT                   /protein_id="ABR65291.1"
FT                   /translation="MKSLMVIDARKCTECNDCIEACKKEHGVARAIKTQSIPVFCLQCH
FT                   PDKAPCKQVCPVNAIEELDGALVVDEESCILCRLCMIACPIGALTINNDKKSVQKCTLC
FT                   IETDRLLPACVEACKSNVLKLFSVEDLEELKREKSHMDIVIDSLKMYGDK"
FT   gene            complement(231871..233244)
FT                   /locus_tag="MmarC7_0222"
FT   CDS_pept        complement(231871..233244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0222"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit"
FT                   /note="PFAM: CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit; Fe-S cluster domain protein; KEGG: mmp:MMP0980 CO
FT                   dehydrogenase/acetyl-CoA synthase complex subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65292"
FT                   /db_xref="GOA:A6VFR6"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="InterPro:IPR016218"
FT                   /db_xref="InterPro:IPR023427"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR6"
FT                   /protein_id="ABR65292.1"
FT                   /translation="MKVTAMDIYKLLPKTNCGKCGEASCMAFAAKLSQKEAELSSCPQL
FT                   KGADFEKLTNVLAPAVKEIKIGTGDKAVTIGGDEVLYRYELTYYNQTALAVDLSDDMDD
FT                   SAFDQKLAEIKNLEFERTGEILKLDAVALRNKSGDAEKFKKAAEKLKDAEIPVILCSFD
FT                   SNAMEAALDVLGPKRPLIYAATENNIDEMANLALKHNCPVALFVPNDLEKMKQISRKLR
FT                   ESGVKDIVLDPGTYIGEAIGDTMDNFIMIRRLAVEGKDEDFRFPILAVPAVCWINPKED
FT                   EILTKMKEATTAAALMNRYADVMILHGVDIWEMMPVLTLRQSLYTDPRKPQSVESKIYE
FT                   FGTVDENSPVIMTTNFALTYYTVAGDLKSGKVNCYLLVLDTTGKAVDVAVAGGQFNGKA
FT                   AAELIKDTGVEKLVNHRKLIIPGLAASVSGEIEDESGWEVIVGTRDSSEIPAFLAKIW"
FT   gene            complement(233258..234412)
FT                   /locus_tag="MmarC7_0223"
FT   CDS_pept        complement(233258..234412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0223"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase, delta
FT                   subunit"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase, delta
FT                   subunit; PFAM: CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit; KEGG: mmp:MMP0981 CO dehydrogenase/acetyl-CoA
FT                   synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65293"
FT                   /db_xref="GOA:A6VFR7"
FT                   /db_xref="InterPro:IPR004486"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR7"
FT                   /protein_id="ABR65293.1"
FT                   /translation="MDTMSQILKLLEKTDSIEINEFRMDVDELELTIMPTLQNVVQKVV
FT                   EKQIEAKKEFESQIEFKYPVKDYAGKVNEVKLGGKNRKTVKLGGQTSLYRFEEPQPNAP
FT                   TVTFDVFDIPMNGLPRPIKENFEDVMHSPGEWAEKAVKEFGADMITLHLIGTDPKVKDK
FT                   SLKDAAKDLEEVLQAVKVPLVIGGSGNPKKDPLVLEMAAEVADGERCLLASANLDLDYQ
FT                   KIAQAAVKHDHAVLSWAISDVNMQKVLNKALMKEGLTHNDIVMDPTTCALGYGIEFSID
FT                   VMTRTRLSALKGEEILQMPMSSGTTNAWGSREAWMKKDEWGPTKYRGPIWEVVTGLTMM
FT                   LCGVDIFMMLHPLSVKTLKEIGTTLTYEYKSKESRDISDWINKF"
FT   gene            complement(234427..235179)
FT                   /locus_tag="MmarC7_0224"
FT   CDS_pept        complement(234427..235179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0224"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   mmp:MMP0982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65294"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR8"
FT                   /protein_id="ABR65294.1"
FT                   /translation="MIIAVTGKGGVGKTLLSSLIVRNLTKRGKDILAIDADPDSNLPEA
FT                   LGVEVTKTVGDAREELKKEVKSGNTSPEMDMWNSLDYKIMESIIETPEFDLLVMGRPEG
FT                   SGCYCAVNNMLRKIIETVSSNYDIVVIDTEAGLEHLSRRTTQNVDTLLVVTDSSKRGIL
FT                   TASRIKELAKELDISFKKLYLVLNRIKPENEKSVRETVKDFGLDIIGIIYDDELTASYD
FT                   MEGKPLFELPDDSETVNSVSKIVEKILG"
FT   gene            complement(235189..236562)
FT                   /locus_tag="MmarC7_0225"
FT   CDS_pept        complement(235189..236562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0225"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   beta subunit"
FT                   /EC_number="2.3.1.169"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, beta subunit; PFAM: CO dehydrogenase/acetyl-CoA
FT                   synthase complex beta subunit; KEGG: mmp:MMP0983 CO
FT                   dehydrogenase/acetyl-CoA synthase complex subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65295"
FT                   /db_xref="GOA:A6VFR9"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR023432"
FT                   /db_xref="InterPro:IPR038571"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFR9"
FT                   /protein_id="ABR65295.1"
FT                   /translation="MFGDIPVEISPMYEGERIRAANMFVELAGPKSVGAELVLVSDNAE
FT                   DGKVEVIGPELKDMEEGKIYPFGLLMEVSGEKLEKDLEGVIERRIHEICNYIQGFMHLN
FT                   QRDKIWCRVSKDSHAKGFELKHLGQALSILFKDEFPIIEAISIKIFTEETKVKEFVEKA
FT                   VSEYQKRDSKARDLSEDDVDVFYGCIMCQSFAPTHVCIITPDRPALCGGINWFDCRAAA
FT                   KIDPEGPIFEVPKGDLLDPVTGEYTTLNSTVADKSQGTFDKVYLHSIFGHPHTSCGCFE
FT                   AVAFYIPEVDGIGIVHRDFKGDTPMGIPFSAMAGQCSGGKQVEGFAGLCIEYMRSPKFL
FT                   QADGGYERIVWLPKEIKEKVLESIPEELRNKIATEEDVSSIHNLKKFLTEKDHPVLKRI
FT                   AELEAPVEEQMEEAEVESAGELVQFAQIPEMAIPTSGGIKIILKNAKIYAEKIIIKKK"
FT   gene            complement(236574..237092)
FT                   /locus_tag="MmarC7_0226"
FT   CDS_pept        complement(236574..237092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0226"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   epsilon subunit"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, epsilon subunit; PFAM: CO dehydrogenase beta
FT                   subunit/acetyl-CoA synthase epsilon subunit; KEGG:
FT                   mmp:MMP0984 CO dehydrogenase beta subunit/acetyl-CoA
FT                   synthase subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65296"
FT                   /db_xref="GOA:A6VFS0"
FT                   /db_xref="InterPro:IPR003704"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS0"
FT                   /protein_id="ABR65296.1"
FT                   /translation="MDGNRTTPWQPTVIAGPKYGMLVTPAIAKMMLKKAKNPLFVIGSL
FT                   IKDDEGLISQCKEIVETWNLPVAATGNIYKSLTENGIKSKRYGTIEIVNLLKDPEWKGI
FT                   NGEGQHDLVLFIGVTYYLASQGLSSLKHFAPHLKTVTLCKYFHSNADASFPNMSDSEWT
FT                   NYLEKMSKI"
FT   gene            complement(237102..239438)
FT                   /locus_tag="MmarC7_0227"
FT   CDS_pept        complement(237102..239438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0227"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   epsilon subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, epsilon subunit; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; Prismane; KEGG:
FT                   mmp:MMP0985 CO dehydrogenase/acetyl-CoA synthase complex
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65297"
FT                   /db_xref="GOA:A6VFS1"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR004460"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS1"
FT                   /protein_id="ABR65297.1"
FT                   /translation="MTYKKNGRKLDDDFWKTKKLSISVGEVSIGRPKQELDEPMGPTPK
FT                   PSVTDLRSWDFKLLKRYPPFYAPFCDMCCFCTYGKCDLLGKKGACGITAEAQQARTVLL
FT                   ASCIGTAAHAGHGRHMLHHVIKEKGKDFPVDMGKNIEIEAPIIRTVIGKKPVTVGDLDE
FT                   SLSYVEEQLSHLLSACHTGQEGNALDFESKALHAGMMDDLAREVADITQIVAYDMPRGD
FT                   GDEPLVELGLGTVDKDKPVVLCIGHNVAPGAEILDYIEDNDLYEDVEVCGICCTAIDIT
FT                   RYNQAAKVIGPLSKQMKFIRSGVSDVIVVDEQCVRTDVLEEAKRNGAVVIATTDKMCLG
FT                   LPDKTKEDTELVINELVNGNIDGALILEPKKVGKVAVEVAKKIAKRRKSLKCLPDISEI
FT                   PKLAKECTECGWCVRVCPNNRPIMDAVTAAAKGDLKKLADLYEYDMCYTCGRCEEECER
FT                   NLPLVSFITKAGDHLVKNQKFKIRAGRGPVQDVEIRKVGGPIVLGDIPGVVAFVGCSNY
FT                   PNGGIEIAKMAEELLKRRYIVVATGCSAMSIGEYIDEDGLTLYEKYDGVFDASGLANIG
FT                   SCVSNAHISGACIKIANIFAKKPLSGNFEEVADYILNRVGACGVAWGAFSQKAAAIASG
FT                   FNRWGVPAVLGPHSSKYRRLYLGRIDKEDMWDINDLRSGETVKGEPAPEHLLYAAETME
FT                   EALVSTVKMCIRPNDTPKGRQLKLSHYIDLYKKYFGEIPPDLELFVRNERDIPITYKKD
FT                   VMDDLTSKNWTPREAPKEPSLLGRK"
FT   gene            complement(239724..240515)
FT                   /locus_tag="MmarC7_0228"
FT   CDS_pept        complement(239724..240515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0228"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   mmp:MMP0987 dimethyladenosine transferase related protein
FT                   (rRNA methylase)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65298"
FT                   /db_xref="GOA:A6VFS2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFS2"
FT                   /protein_id="ABR65298.1"
FT                   /translation="MRQSKKLGQCFLKDKNFVKKAINRAELTDKDIVLEVGLGEGALTK
FT                   ELAKIAKKVYVIELDERLKPFADEITSEFENVEIIWSDALKVDLKTLGFNKIVANLPYQ
FT                   ISSPITFKFLEEDFEVAVLMYQYEFAKRMAGKPDTKEYSRLSVAVQYNADVEFICKVPP
FT                   SAFSPKPDVNSAIVKLTKREPKYHVKDEEFFKKVLKAIFQHRNRTIKRALIDSSHEIGI
FT                   ERNILKEILEKIENKFEFTERVFKTPPEKIGYLSNLLYDEI"
FT   gene            complement(240526..241413)
FT                   /locus_tag="MmarC7_0229"
FT   CDS_pept        complement(240526..241413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0229"
FT                   /product="RNA methyltransferase related protein"
FT                   /note="KEGG: mmp:MMP0988 RNA methyltransferase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65299"
FT                   /db_xref="GOA:A6VFS3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS3"
FT                   /protein_id="ABR65299.1"
FT                   /translation="MLSKGAVIDKLRSYKPCNNCNGPISKTISLADLKRNERKRKCDCG
FT                   HSQLDDVMLDVLNLMVEFDEFQNNDLNAVTLRDAGTPLVEIGYPLKYLPVVSNDELIVM
FT                   KDVSKPCAKEILKIPEVKGVISNSSKNTELSRADDSGEVNSLIAGDDFRCDIFVLKSIM
FT                   DCVVICKNQSKVHIEFPRPFNPKIAKIDRLNLNGKVVIDGFCGSGTLGLAALKKGAKKV
FT                   IFSDINPHALKDVIYNLKLNFSKEVFERIEIINSDFLNLNVTGDICFVDLFPHVNREPF
FT                   LNKAKTISKQVVLI"
FT   gene            complement(241544..243538)
FT                   /locus_tag="MmarC7_0230"
FT   CDS_pept        complement(241544..243538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0230"
FT                   /product="DNA topoisomerase VI, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase VI, B subunit; PFAM:
FT                   ATP-binding region ATPase domain protein; DNA topoisomerase
FT                   VI subunit B transducer; KEGG: mmp:MMP0989 DNA
FT                   topoisomerase VI B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65300"
FT                   /db_xref="GOA:A6VFS4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS4"
FT                   /protein_id="ABR65300.1"
FT                   /translation="MAEDTNVVVEESLFDEFKEHSISEFFRKNRHMLGYSGRLRSMTTI
FT                   VHELVTNSLDACEESEILPEIAVEIKKIGSETFGVNIEDNGPGIPPEFVPKVFGKMLAG
FT                   SKLHRLVQSRGQQGIGAAGVLLFAQMTTGKPLKITTSTGNGTIHEMEIKMSIERNEGDV
FT                   VSHKTREGFWRGTRVEGEFKDVTYNRREQGPFEYLRRISLSAPHAKITLEDPEETIVFE
FT                   RTVNDIPERPEVMKPHPYGLTTDELLHISRITDSSRVSSMLNSELSRVTMKRIKELEEY
FT                   VLRDTLLENYRSSVFWDTIVGCYLNFDFTKYFDIYGHYFDKKEIEDVKQLINGLPEGLG
FT                   ELKTYCMKYLVTQYLVQKLDDEELKEQKNHFKKKPENFMEYMEKKYLNASLLDEFRRKL
FT                   KNITKSPEEFVKSLVDLAMVSDTELEKYRKAIRDLLKKNPKEMTWKDSEIIVNVLQDMD
FT                   FMAPSTVGLRPIGEENIEKSLNTLEPEFLKTLTRKPKTYKGGIPFAVEVGLAYGGEAGR
FT                   SGDESKKMEIMRFSNHVPLLFDTSGCGLTNAVKSVNWRRYGLRSDEDAPVTVFVNLIST
FT                   HIPYTSAGKQAIASSNEENEEIFNEIRQSLMICARELEKHISKIRREKEEEQKKKYVMK
FT                   YAVIFAEGLASITGRPKEEIEANVVNLLR"
FT   gene            243871..244635
FT                   /locus_tag="MmarC7_0231"
FT   CDS_pept        243871..244635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0231"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="PFAM: Protein of unknown function DUF516; KEGG:
FT                   mmp:MMP0990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65301"
FT                   /db_xref="GOA:A6VFS5"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFS5"
FT                   /protein_id="ABR65301.1"
FT                   /translation="MDYLFISSKTDPASQNIKKHVQNYGYNVFELEKKSTQSNFSDFPD
FT                   SEMYIFLSKHASESKKPTLTVHTPGNLTEDNSHGGNPEEISPCNPVFNTLMLQNINKYN
FT                   EMEEYKELGFEVSFEVLHHGPTDLKTPSAFVEIGSSEEQWQIDDAAEIITNSLIDTLNS
FT                   IQNSEYEEKEKIIGIGGGHYSPKFTKLALREEYYVGYLTPKHAKLSENILNQLISKQEF
FT                   DFVGIDWKGLYGEDKRKYVEFFDENDISWQRV"
FT   gene            244722..245489
FT                   /locus_tag="MmarC7_0232"
FT   CDS_pept        244722..245489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0232"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: mja:MJ0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65302"
FT                   /db_xref="GOA:A6VFS6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS6"
FT                   /protein_id="ABR65302.1"
FT                   /translation="MKDILEKFKTGNLSLEEAEKKLKLNYFDELGGFCKLDTNRKLRTG
FT                   IPEVIYAEGKRCEDVAKILKELAFKNNIALATRVNDTEELKKYFKDETDLILEINELGR
FT                   TAVLKKQGFEVEKTEKIGILAAGTSDIPIAEEAAESAKIMGCEVIKNYDVGIAGIHRLF
FT                   TPVKNMIEEDVCCIIAVAGMEGALPSVISSLVDIPVIGVPTSVGYGYKLTPLLTMLHSC
FT                   SPGLVVVNIDNGFGAGVFAGLIASNISKRIKRG"
FT   gene            245491..247074
FT                   /locus_tag="MmarC7_0233"
FT   CDS_pept        245491..247074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65303"
FT                   /db_xref="InterPro:IPR019249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS7"
FT                   /protein_id="ABR65303.1"
FT                   /translation="MDIIEGKFVKMGSNYKELFDELPDDFLGHIRLSLKSNGQFKESHL
FT                   FLKDKKIIAGYSEYEGEFFGNDAILNAMKMADLGAIVDIFSYTDSMLSMMQNSDAKLFS
FT                   TEKPVKKSVVEKKKVMIANDTRISVPEGSPIKLGASGDFEKYFGRYTLVELFKKSDGNY
FT                   LRGYITYDGRSPIAAVYQAENKLTFGDIAFEIINRLVEEDDNAAIDVYEYSKSKLDYFV
FT                   EEYPESVLSNKISEPVKTEKKAEVPNYVPKVEEIEIEEDLDEGEAVEVEEEISREELMK
FT                   KLGLRTPDDEMIEDLLEEIFEPSKTEINAIESELLEKINKYLEESTNALQFDSELSIEY
FT                   SDEGEFIAKCFINTTSDGEYGVKSAVDPKIIKKDITNIFDSYVIDIIPEITIINQKSEK
FT                   PEPNYSVNKYEIDLEKELNKIKTKHSEKKKTESEQLKEKIERGIYEYLENVNDISEFEV
FT                   HMSLNQDNGNKCKCSIVVVPKKLLGFIKGSLNTDKIKKEISEILTMNNVEIEFLNITVE
FT                   KFTTSYSKYR"
FT   gene            247319..247840
FT                   /locus_tag="MmarC7_0234"
FT   CDS_pept        247319..247840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65304"
FT                   /db_xref="GOA:A6VFS8"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS8"
FT                   /protein_id="ABR65304.1"
FT                   /translation="MENLSLFTVSLGAGLFGSYYTLIKMKKDEKNTKKEEQDLLELEVI
FT                   EGLQKLKTHAVSKNPEKASDTYDLLELALSHDLLDVTVVNEEGLTIISTLKDPEEVAGQ
FT                   YSGVFQTLNKIMGNVEKTSIKSGDEYIYISTIEKNEMPFYIIANSYIEMDPIDEKELQN
FT                   EVIGILGQYI"
FT   gene            complement(247955..248155)
FT                   /locus_tag="MmarC7_0235"
FT   CDS_pept        complement(247955..248155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0235"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mmp:MMP0993 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65305"
FT                   /db_xref="GOA:A6VFS9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFS9"
FT                   /protein_id="ABR65305.1"
FT                   /translation="MKTRIKEYRAKYDMTQEELGKLVGVRRETISFLEKGKYNPSLKLA
FT                   HLISKALNATIDELFIFENDE"
FT   gene            complement(248152..248538)
FT                   /locus_tag="MmarC7_0236"
FT   CDS_pept        complement(248152..248538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0236"
FT                   /product="putative hypothetical protein"
FT                   /note="KEGG: mmp:MMP0994 putative hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65306"
FT                   /db_xref="GOA:A6VFT0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT0"
FT                   /protein_id="ABR65306.1"
FT                   /translation="MDSRFKNRVSLGFLIMLFGIFIEYVFHVSNLITAILINAGVILII
FT                   YNLYYHIKYCEVPSKDERIRKIANAGLAYSWVLTFLVMNLIFWVDYFNWFEITVAQVIG
FT                   IIYFVMLISALLFQQYFKRQGDVE"
FT   gene            complement(248547..248978)
FT                   /locus_tag="MmarC7_0237"
FT   CDS_pept        complement(248547..248978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65307"
FT                   /db_xref="GOA:A6VFT1"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT1"
FT                   /protein_id="ABR65307.1"
FT                   /translation="MFGKPEWFERRKYGGWGLHPKTWQGWLYIAVMILPYIIFQSLPYW
FT                   DETTRTYVTVVWVLFLLLDIGHIMVNLDKDERESKIEAISERNAAWAMVLVLVAGIMYQ
FT                   SITSALNQIFHVDWFLIAALFGGMIVKTISNYYLEKSEL"
FT   gene            complement(249133..249276)
FT                   /locus_tag="MmarC7_0238"
FT   CDS_pept        complement(249133..249276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0996 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65308"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT2"
FT                   /protein_id="ABR65308.1"
FT                   /translation="MDKKFFECKVCGDIHWGKKAPNPCPTCMTKDSYVEITKEELPKKL
FT                   GM"
FT   gene            complement(249509..249802)
FT                   /locus_tag="MmarC7_0239"
FT   CDS_pept        complement(249509..249802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0239"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   mmp:MMP0997 blue (type 1) copper domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65309"
FT                   /db_xref="GOA:A6VFT3"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="InterPro:IPR035668"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT3"
FT                   /protein_id="ABR65309.1"
FT                   /translation="MESPVDTSTNFEAQNEATVLIEDFSYKPSSITVRVGATVIWIQKD
FT                   SVRHSVTSNEGVFDSGLLSKGISWNYTFNEAGTYDYYCIPHPYMKGTVEVVE"
FT   gene            250226..250873
FT                   /locus_tag="MmarC7_0240"
FT   CDS_pept        250226..250873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65310"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT4"
FT                   /protein_id="ABR65310.1"
FT                   /translation="MIKISYKPLIALALAVMMSLVAVSAAPTGDQGNTRYINSSGEIND
FT                   SGKYLLMNDITGPIIITSDDVTFDGNGYCISGDSFGVYLIDCKGATVRDTTISCQLAGI
FT                   VLQNATNCMIEKNNVTGCYHGIALLCGSDENKIINNDVCNNNLGCYGGGGILALSCDCD
FT                   GNKIHANTVLDNGYWYFTSWWPDLEKEFVPNDISLDEEVNDISGNHVTPEEE"
FT   sig_peptide     250226..250300
FT                   /locus_tag="MmarC7_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.608 at
FT                   residue 25"
FT   gene            complement(250967..251554)
FT                   /locus_tag="MmarC7_0241"
FT   CDS_pept        complement(250967..251554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0241"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="PFAM: protein of unknown function DUF340 membrane;
FT                   KEGG: mmp:MMP0999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65311"
FT                   /db_xref="GOA:A6VFT5"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT5"
FT                   /protein_id="ABR65311.1"
FT                   /translation="MNFTVLVLIALILGFIVGKIYRIEFGNMYEIMLYIQILIIGIDLG
FT                   KSSGLRGVKKVGKFGILLPLFTIIGSLIGGIIASIVLNIPLKYALAIASGMGWYSLCGP
FT                   ILAEYSTIYGVMGFLVNLAREVLTIIGYSFVIKKFPKDMAITIGGGTSMDSTLPIIVKF
FT                   GGKDIMILSFVHGFILTLLIPFITPFILMLPI"
FT   gene            complement(251551..251799)
FT                   /locus_tag="MmarC7_0242"
FT   CDS_pept        complement(251551..251799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65312"
FT                   /db_xref="GOA:A6VFT6"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT6"
FT                   /protein_id="ABR65312.1"
FT                   /translation="MNIIYILIVGLIIGYLFKSKFEKIDLSKPINLALLLLIFFMGVES
FT                   GKVDLNAFSTFVVSMEFSIIVMVTSLLTAVFLGGRFR"
FT   gene            252014..253234
FT                   /locus_tag="MmarC7_0243"
FT   CDS_pept        252014..253234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0243"
FT                   /product="protein of unknown function DUF650"
FT                   /note="PFAM: Protein of unknown function DUF650,
FT                   archaea-like; Protein of unknown function DUF651,
FT                   archaea-like; KEGG: mmp:MMP1001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65313"
FT                   /db_xref="GOA:A6VFT7"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT7"
FT                   /protein_id="ABR65313.1"
FT                   /translation="MELFRSKTCALCKGRKLLCGRPRCPILEKFRVAKAVESRINKKDI
FT                   FGASPPSVFVGEFGYPNVRIGPMVPPVEGDTSFMDDPSKWENVTIPEIMEYRSMLVMGE
FT                   TNANVSVNKNSNFLNNIQELAMANKPVDSEIELKKAPKLELITGGFTPPVGPRESMLKF
FT                   RLAENPKIPRKSDYIVNDDLKANEGMISLYDSGFDEYYIIKLLSTGLLGINKKLVPTKW
FT                   SITAAQDLLGKYVKKKILENNQINDYEVYYKNFLGNRYAVLLIPDMYAFEMLEVWLKGS
FT                   LFSGENYQILGDFEDITGMKGYADEITGAFYAARLSILEYLKKRKKQSKILVFREITPE
FT                   YYAPVGVWQIRTGVKLAMENRLGKFNDLKSALLEIKKYLDVPMKDYETKSKILKSNQRQ
FT                   VTLDKFF"
FT   gene            complement(253245..254024)
FT                   /locus_tag="MmarC7_0244"
FT   CDS_pept        complement(253245..254024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0244"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain; KEGG: mmp:MMP1002
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65314"
FT                   /db_xref="GOA:A6VFT8"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFT8"
FT                   /protein_id="ABR65314.1"
FT                   /translation="MNKPVLVSFLVSGDPNPDATLKFMKALDKYSGVIELGIPFSDPVA
FT                   DGPTIQAADVRALSNGFKIAKSFEVLKEFRKESDTPVILMTYYNPVFKRGIETFVMQAK
FT                   EAGANGLIIVDLPLQEATEYREICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLIS
FT                   TFGITGARESFEQMTFDFIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAF
FT                   VDIIKNYGDSEEALVKLEELAKELSEGIEKGYEKRNK"
FT   gene            complement(254025..255209)
FT                   /locus_tag="MmarC7_0245"
FT   CDS_pept        complement(254025..255209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0245"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: mmp:MMP1003 tryptophan synthase, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65315"
FT                   /db_xref="GOA:A6VFT9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFT9"
FT                   /protein_id="ABR65315.1"
FT                   /translation="MTCEGYFGEFGGQYIPEVLMPAIDELKEAYSELKDDEEFQNELSY
FT                   YLKNYAGRETPLYYAENLTKKLGGAKIYLKREDLLHGGAHKTNNTIGQALLAKRMGKTR
FT                   IIAETGAGQHGVGTSMAGALFGLETEIFMGRLDTERQQPNVFRMKLLGAKVTPVDTGSK
FT                   VLKDAVNEAMRNWTATFENTHYLIGTVMGPHPFPTIVRDFQSVIGKEVKKQIMEQEGRL
FT                   PDHLVACIGGGSNALGLFHAFIQDKDVRMVGIEAAGKGLNTSLHGASISKGKKGVLHGM
FT                   LSYFLQDEDGQIEEAYSISAGLDYPGIGPEHAYLHDSGRAEYASATDDQALNAFMELTR
FT                   SEGIIPALESSHAVAYAIENAGNMDKDEIMVINLSGRGDKDLNTVIDIMQKRGM"
FT   gene            complement(255206..255832)
FT                   /locus_tag="MmarC7_0246"
FT   CDS_pept        complement(255206..255832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0246"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: mmp:MMP1004 N-(5'-phosphoribosyl)anthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65316"
FT                   /db_xref="GOA:A6VFU0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFU0"
FT                   /protein_id="ABR65316.1"
FT                   /translation="MFIKICGIKTPEELEIVESYGNATGVILECASKRRIGLETAKNLV
FT                   NLSNIPVFAVSTTSEVLVWENIIKLTNTNYLQMHSDIDQKTIDFIKNEYGCFIMKSFKI
FT                   PETSESPEIDAEKIISDIETYEVDRILLDTGKGCGQTHDHRISQIIAKKFDIILAGGLD
FT                   PDNVFDIVKNVKPFGVDVSSGVEANNSKDEELIKRFCENVKSVKL"
FT   gene            complement(255847..256437)
FT                   /locus_tag="MmarC7_0247"
FT   CDS_pept        complement(255847..256437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0247"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mmp:MMP1005 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65317"
FT                   /db_xref="GOA:A6VFU1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFU1"
FT                   /protein_id="ABR65317.1"
FT                   /translation="MIVIIDNKDSFVWNLADYASIYDSVKVVPNTISIEELKKLNPDGI
FT                   IISPGPGAPENKRDVENCPEIIKNMDVPVLGVCLGHQTIAHIFGGKVGRIPPVHGKSSL
FT                   ITHDSKGIFKDVKNPFTAGRYHSLAVLEVPENFTVTATTDDGIVMGLRHNDIPIEGVQF
FT                   HPESVLTEFEEKEGLKIIENFVKFAKNYKSSKK"
FT   gene            complement(256418..257737)
FT                   /locus_tag="MmarC7_0248"
FT   CDS_pept        complement(256418..257737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0248"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein;
FT                   KEGG: mmp:MMP1006 anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65318"
FT                   /db_xref="GOA:A6VFU2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010116"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFU2"
FT                   /protein_id="ABR65318.1"
FT                   /translation="MYKLDYVNPLKLYGVLRDEGKYPVMLESRAKGQINARYTYISSNP
FT                   EYMLRIGNKTKMDNETISKESNPFKALKENFKITQKGDRFTGGYVGYVAYDCIHNYIGG
FT                   KIEEPSVFGYYDHMYVYDHVTRNFYYHSENNNPEELRNAEYIVEKAKNFKIEEEDGGIE
FT                   VLGCDADLDDYVKMVEKTKEYIYSGDAFQVVPSREYRLKNEFSAFQLYRNLRNVNPSPY
FT                   MFLLEFDKDVVGASPETMASVQNNILKVNPIAGTAPIGKTETETKKLAESLLKDEKERA
FT                   EHMMLVDLARNDVRKVSKSGSIVLERFFDVVRYSHVQHIESEVLGTLKDNSTIFDAIEA
FT                   AFPAGTLTGAPKFRAMEIIDEIEKSRRKIYGGAVGYFSNSGNADLAIGIRMAEIDSVCR
FT                   VRAGGGVVADSVPENEYYETERKMAAMMKALGVQNDCDNR"
FT   gene            complement(257730..258695)
FT                   /locus_tag="MmarC7_0249"
FT   CDS_pept        complement(257730..258695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0249"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase family 3; KEGG: mmp:MMP1007
FT                   anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65319"
FT                   /db_xref="GOA:A6VFU3"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFU3"
FT                   /protein_id="ABR65319.1"
FT                   /translation="MLNKLIERENLSFEESYELFNMLLNESEMRIAAYLVALQTKGVTA
FT                   DEIAGFAKAMRDNAVKIDLGEVTDTCGTGGDGSKTINVSTAVSIILSCFTKVAKHGNVS
FT                   ITSKSGSANVYEALGCKIPETPEDAKKSMDKTNFAFLFAPKYHPALKKIMPVRNELKVK
FT                   TIFNILGPLANPANPKYQILGVNSPDLLDNVAIALSKVGGIKKALVLYGDGLDELTPNG
FT                   TSKITEYNGKFETYEVTPKDFGLDYAKIMPCESPDESAKRLIDVFSGKLNEDRNFILMN
FT                   AAAALYTSENASDFLDGVEIAKEAIESGKVLKKLEEIRNV"
FT   gene            complement(258695..259384)
FT                   /locus_tag="MmarC7_0250"
FT   CDS_pept        complement(258695..259384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0250"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   mmp:MMP1008 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65320"
FT                   /db_xref="GOA:A6VFU4"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFU4"
FT                   /protein_id="ABR65320.1"
FT                   /translation="MAINFKKQANAIKNFDKNPIIAEIKVHSPKYGDLLKGRSEMDILR
FT                   IYEEAGAVGISYITDKQYFNGNFNIFKKICENTELPVLRKDFLTTKDEIEKTASAGGST
FT                   VLIIARLLKEKTAEFVDFALECGLDTLVEVHNREEIEIAKSTNTTMIGINNRDISKLEL
FT                   DDGTVSLTEKLADLIPKDRILVSESGIANLTDLKTALKYADAALIGTSFMTAENQKEFV
FT                   KSFVGGK"
FT   gene            complement(259717..260973)
FT                   /locus_tag="MmarC7_0251"
FT   CDS_pept        complement(259717..260973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0251"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; KEGG: mmp:MMP1009
FT                   dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65321"
FT                   /db_xref="GOA:A6VFU5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFU5"
FT                   /protein_id="ABR65321.1"
FT                   /translation="MVLLKNGKIVSDNKITESDILIEDGITQKIEKNIDYSGEIIDLKG
FT                   NYVFPGMIDSHVHFRWGNPEKEDFVSGSEAAIAGGIVYAIDMPNNTPPVTSKEIFYKKM
FT                   NEGNEKSKINLYYAYGVTENNYLETVEEAKVYKIFTVKSVGDLFISDYSKLREILDQNK
FT                   IFAIHAEHKNIILENSKKYQLNSFENHCKIRSRESEIEAVKEVLNVLEKIDNESKNKPH
FT                   VHFCHISVKEALDLIKTAKKTFKNVKITVEVSPHHLFLNCEMAEDLKGFGKFNPPLREK
FT                   EDNLALLNGIVDGIVNIVATDHAPHLIDEKLNSVENCPSGIPGIETMVPLIMNLVNEGK
FT                   ISIFDAYRVLSKNPSEIFKINNKIEVGNSANMSIIDMDKKYKISAKDFKSKAKFTPFEG
FT                   KTVEGKPFATLVNGKIYIL"
FT   gene            complement(260994..261890)
FT                   /locus_tag="MmarC7_0252"
FT   CDS_pept        complement(260994..261890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0252"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: mmp:MMP1010 pseudouridine
FT                   synthase:pseudouridine synthase, Rlu. related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65322"
FT                   /db_xref="GOA:A6VFU6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFU6"
FT                   /protein_id="ABR65322.1"
FT                   /translation="MESQKNVLKLVVDSKIAGHKLIDVLRNNFELSNKMIKKFDKEKKI
FT                   FVNSKNISLKSKLKENETVSVEIDCGINTIDPENLALNIIYEDDDLLIVDKPKNMVVHP
FT                   TKNVLSKTLANAVSNHQKINNQNYKIRFVNRLDMDTTGLLIIAKDPYSHQHLAKQMDEG
FT                   ILEKIYIAVVNGHLDLKEGIIEDSIDLNDDGIKRELSNVGKISKTKYKVIEELKNASIL
FT                   EINLLTGRTHQIRVHLSNIGNPIIGDVLYGEISDLINRQALHSHILSIIHPITKEKMKF
FT                   SSNLPKDIENLIENLKD"
FT   gene            complement(261998..263665)
FT                   /locus_tag="MmarC7_0253"
FT   CDS_pept        complement(261998..263665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0253"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: mmp:MMP1011
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65323"
FT                   /db_xref="GOA:A6VFU7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFU7"
FT                   /protein_id="ABR65323.1"
FT                   /translation="MKDTVMAYLLENSIKFKGKPNPKAAMGKILGENPDLRSNVKELNE
FT                   VISEVVKEIESMSLEEQQAKLDELAPEGLGQKTERKRKEIELKNVKGNVVMRFAPNPSG
FT                   PLHIGHARASVLNDFFTKKYNGKLVLRLEDTDAKRVLPEAYEMIQEDLKWLGVKVDEVI
FT                   VQSERLEIYYEYGRKLIEMGHAYVCDCDAEEFRNLREQGIPCKCRDTTPEENIALWEKM
FT                   LAGELENVAVRLKTDIVHKNPSIRDFPIFRIERTPHPKNGTKYHVYPLMNLSVTVDDHL
FT                   LGMTHVLRGKDHIVNTEKQEYIYNYFGWEIPEYVHYGILKIEGPVLSTSKMHAGILSGE
FT                   YSGWDDARLGTLRALRKRGIRPEALYKLMVEIGIKQADVRFAWENLYAANKDIIDKDAR
FT                   RFFFVESPKKLVISGAESKKIDLRMHPDRNELGNRELLFDGEIYVSDDLEVGTMYRLME
FT                   LFNIVIEKIENDVIYAKYDSDDLAVAKSNKASIIHWIPVKDSIPVTVIDENAEKIEGFA
FT                   EKDFAVVNEDDFVQFERFGFVRVDEKEDNGYTCYLTHK"
FT   gene            complement(263814..264563)
FT                   /locus_tag="MmarC7_0254"
FT   CDS_pept        complement(263814..264563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0254"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: mmp:MMP1012
FT                   exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65324"
FT                   /db_xref="GOA:A6VFU8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFU8"
FT                   /protein_id="ABR65324.1"
FT                   /translation="MKMISWNVNGIRACLKNGFMDFLERESPDIMCIQETKVQSGQVQL
FT                   GLDGYFQYWNYAEKKGYSGTAIFTKIKPNNVILGIKNTEHDGEGRVLTLEFDKYYLINV
FT                   YTPNSQRGLTRLEYRQKWDQDFLNYIKTLENEKPVIFCGDLNVAHKEIDLKNPKNNVKN
FT                   AGFTPEERIGFDNIVDSGFIDTFREFNKEPDNYSWWSYRFNARSKNIGWRIDYFCISKI
FT                   LRDNLKDAFIMSEVMGSDHCPVGIIFE"
FT   gene            264852..268097
FT                   /locus_tag="MmarC7_0255"
FT   CDS_pept        264852..268097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0255"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain oligomerisation; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; MGS domain protein; RimK domain
FT                   protein ATP-grasp; KEGG: mmp:MMP1013 carbamoyl-phosphate
FT                   synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65325"
FT                   /db_xref="GOA:A6VFU9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFU9"
FT                   /protein_id="ABR65325.1"
FT                   /translation="MKREDIKKVMILGSGPIVIGQAAEFDFSGSQACKSLKEEGIYTIL
FT                   VNSNPATIQTDTNIADKVYLEPLTPKILEKIIEKEQPDAILPTMGGQTGLNLAMELSKR
FT                   GILEKHGVELLGSTESVIETSEDRDLFNKAMEEINQPIAKSAAVHSVEEAIKATEELGY
FT                   PAIVRPAFTLGGTGGGIATNEEELIEITKKGLKYSMIRQVLIDQSLLGWKEYEYEVMRD
FT                   KNDTCIVVCNMENIDPMGIHTGESIVTAPSQTLSDEFHQKLRDASLQIIRHLKIEGGCN
FT                   VQFAVNPEMTDYVVIEVNPRVSRSSALASKATGYPIAKIAAKIAIGRTLDEIQNDVTKE
FT                   TPASFEPTIDYVVVKIPRWPFDKFRTVDKRLGTSMKSTGEIMAIGRNLQEALQKAVRSL
FT                   DIGRFGLIADGKDKEYSNSEIVDILEHATDERLFVIAYALDKGWSVDGICERTGINPFF
FT                   IEKIKKIIDCKKELEVISRLPVDDEKLKEILLKAKSLGFSDVQISKIFSKTENEIRELR
FT                   NRLEVIPVYKMVDTCAAEFEAKTPYYYSAYERYFDEEQNESVSSDRKKVIILGSGPIRI
FT                   GQGVEFDYSTVHAIFALKELGIEAIIVNNNPETVSTDYDTSDKLYFEPLVYEEIMNIIE
FT                   NENKNGQLLGVIVQFGGQTAINLAMKLYNSGVNILGTSPQSIDLAEDRDQFIHVLEKLK
FT                   IPQADGATAFSEEQALKVVEKIGFPALVRPSYVLGGRAMQIVYNTEDLKDYMREAVKVS
FT                   SDHPILIDKFLEEAVEVDVDAVCDGESVFIGAIMEHIEEAGIHSGDSACVIPPQTLSKE
FT                   VIEKIAEHTTKLALELGVIGLLNIQYAVKDGVVYIIEANPRASRTIPYVSKSVGVPLAK
FT                   IATNAIMGKKLKEMGYSGLAKAKYVSVKEAVFPFLKLPGVDPVLSPEMKSTGEAIGIDQ
FT                   DFGKAFYKSQLSANMELPTSGTVFISVRNRDKDNITKIAKKYHDLGFEIVATKGTAREL
FT                   RLFDIPVREVSKISESMQNSVLDLMQKGEVDLLINTSSGDKAKTDGYYIRRAAVELNIP
FT                   CMTTLQGAYAAIKAIEAIKSGELGVYSLNELEN"
FT   gene            268162..269229
FT                   /locus_tag="MmarC7_0256"
FT   CDS_pept        268162..269229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0256"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1014 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65326"
FT                   /db_xref="GOA:A6VFV0"
FT                   /db_xref="InterPro:IPR005909"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV0"
FT                   /protein_id="ABR65326.1"
FT                   /translation="MSMADYLKNIREKHLKKRKERNPDYPIAVWIQDDVFRDKSMGKSF
FT                   TIILRTKGCKWAYDSGGCTMCSYLMDASPAEITSENLKNQFEYAVEKYKDQLNKNMSIK
FT                   LFTSGSFLDTFEIPIETREYIFKRIEEMGAKEVAIESRAEFVTPENMQSIKNILSCNIE
FT                   IGVGIESMNEKIRNVAIHKGVPTKTIENAFSVAKEYDVGIKAYILIKPPFISEKEAIID
FT                   SIDTANKCIEMGCSRISFCPASIHKGTLIETLWKKNQYRPPFLWSILEILKEVKSKNPD
FT                   ALVMCDTAGVSSKRGAHNAIDCTCNDKIKDIFNEFTVTQKIEKLDLECECKKQWIEYVE
FT                   YEQKNIVPLGDEKLI"
FT   gene            269346..269645
FT                   /locus_tag="MmarC7_0257"
FT   CDS_pept        269346..269645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0257"
FT                   /product="Transcription factor CBF/NF-Y histone"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/archaeal
FT                   histone; KEGG: mmp:MMP1015 transcription factor
FT                   CBF/NF-Y/archaeal histone:histone-fold/TFIID-TAF/NF-Y
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65327"
FT                   /db_xref="GOA:A6VFV1"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV1"
FT                   /protein_id="ABR65327.1"
FT                   /translation="MIPKGTIKRIMKENTDMNVSAESVAALVEILQEMVVTTTKIAEEN
FT                   AEKDKRKTLKARDIEQCDAERLRKKVVEVSERTEKVNMLTNEILNVIANELERY"
FT   gene            269851..271089
FT                   /locus_tag="MmarC7_0258"
FT   CDS_pept        269851..271089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0258"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65328"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014651"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV2"
FT                   /protein_id="ABR65328.1"
FT                   /translation="MKEQVIDIATKDVVTVNPDTPISKAVGIMENRKFHNLIIEKDDDI
FT                   YLVTMHDLLLGNSVHQQVEDLMFKPYCVRMNTQVLDAAFEMINSGQRVAPVINENDKLI
FT                   GIITDYDVMRCASQSELLKDVKIDKIMTKSPVTIDIDESIGKARSLMMKYNIGRLIVLD
FT                   TEGNPMGMVTEDDIVKKVFKPKTKMTVGELTGDKMPRMAQPVSMIVNKPLITADEDDSI
FT                   AAVADLMEKQDIRGVPIFKNDILRGIVTRLDILKYLRDLRAESMVEVEIQGDFDEDQRE
FT                   LAERILFNEIKKIAVYSKKIHWIKLAVKKERDKGGVPYYSVKTYVKTPRKLYVAEGKPK
FT                   LSATKRIEWDGEEIELIAEKQRWDFIEVLKDALDSVKKQMSIDREKRQSKALNSGKKEI
FT                   MAEEFSETPENEE"
FT   gene            complement(271135..272541)
FT                   /locus_tag="MmarC7_0259"
FT   CDS_pept        complement(271135..272541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0259"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   mmp:MMP1017 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65329"
FT                   /db_xref="GOA:A6VFV3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV3"
FT                   /protein_id="ABR65329.1"
FT                   /translation="MVTVMKFGGTSVGNGERIRNVAKIVVNKTNEDKDVVVVTSAMTQV
FT                   TNSLVEISAQALDVRDIAKINNFIEDLRRKHEIAIEQAIENHDIRVEVSKTIQSSINDL
FT                   EKVLVGVSYLGELTPKSKDFILSFGERLSAPILSGAIRDMGKHSLFLAGRDAGIITDDT
FT                   FTCAKVLRLDVADKIEPLLRDGFIPVVTGFVAGTEEGHVTTLGRGGSDYSAALVGRGLM
FT                   ADMVEIWTDVSGVLSADPRMVENVKKIPKMSYIEAMELAYFGAKVLHPRTMEPVMEKKI
FT                   PLRIKNTFEPENEGTLITDASETSNGVIKAITTIKDVILINIFGGGMVGVSGTAARIFN
FT                   VLGKSNANVILITQGSSETNISIVIYDGELEAKKCVRELRSEFGECHLVKDITFDKEVC
FT                   VVSVVGSGMKGAKGIAGKLFDAVAESGANIKMIAQGSSETNISFVINEDKLESCLKTLH
FT                   KTFVEDEVNF"
FT   gene            272696..274174
FT                   /locus_tag="MmarC7_0260"
FT   CDS_pept        272696..274174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0260"
FT                   /product="isopropylmalate/citramalate/homocitrate synthase"
FT                   /note="TIGRFAM: isopropylmalate/citramalate/homocitrate
FT                   synthase; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain; KEGG: mmp:MMP1018
FT                   (R)-citramalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65330"
FT                   /db_xref="GOA:A6VFV4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024890"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV4"
FT                   /protein_id="ABR65330.1"
FT                   /translation="MVNIFDTTLRDGEQTPGVSLSPSEKLEIAIKLDELGVNIIEAGSA
FT                   ITSKGEREAIKLVAEQKLNAEISSFVRALPVDIDAALSCNVDSVHLVVPTSDLHMEYKL
FT                   RKTREENLKDAMHAVDYAKEHGLIVELSAEDATRSDVEFLKELFKKGEELKADRICLCD
FT                   TVGILTPVKSMELIKTMKAAVTIPISIHCHNDFGMATANTLSAISAGADQCHVTINGIG
FT                   ERAGNASLEEVVMSLKSLYDMETNIQTEKLYKISRIVSKYMKLSVPANKALVGDNAFAH
FT                   EAGIHVDGLMKSTETYEPIGPEVVGNRRKIILGKHSGKAALKYKLELMNIGLSHEQFEE
FT                   VYSKIKAFGDLGKYISDVDLKTVISQVQGVELERKVILDEITVMSGNKVSPLASINLKF
FT                   ANDCNIKDNIREAAYGLGPVDAAINAVKKALTGVADIELEDYSVRAMTGGTDALIEVVV
FT                   HLRKGNEVVEVRKAHGDVVMASVEAMMDGINLLI"
FT   gene            274230..275030
FT                   /locus_tag="MmarC7_0261"
FT   CDS_pept        274230..275030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0261"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: mmp:MMP1019
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65331"
FT                   /db_xref="GOA:A6VFV5"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV5"
FT                   /protein_id="ABR65331.1"
FT                   /translation="MFKKSAFILLLCIILNIASVSAIPYLDAEISSPEIERGTIEKIYV
FT                   EVEEISGTSNAYNITIIPEIYDDNVKISPENIEIPTLNDGTIVKVSFKIDASKNTELGE
FT                   KSGKIFIEYYDFDSKNDEYVGPKSIQKSFTYEIIEGYGIYSINSNPENISVYLNGNYVG
FT                   NTPLNVSIKEGNHFLRLSSEIFGNYSEKITVKVGESINLFKNFEKIENLENVSKNIIIS
FT                   EHNSKNVSEVFEISKNISFKGILVYFGFLLVALLIIFAVSKNKY"
FT   sig_peptide     274230..274298
FT                   /locus_tag="MmarC7_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.684 at
FT                   residue 23"
FT   gene            complement(275036..276040)
FT                   /locus_tag="MmarC7_0262"
FT   CDS_pept        complement(275036..276040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0262"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mmp:MMP1020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65332"
FT                   /db_xref="GOA:A6VFV6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV6"
FT                   /protein_id="ABR65332.1"
FT                   /translation="MNNNEYDILARGFIIFSFFALSYMLWPFIGIIALAVAVAYMTKPL
FT                   YDVLRPKFGKTYGAIICLLGIVIPSLLLVILVAEDVVTFLLSLDIENIISKVTPILNDM
FT                   GYLRVDGPEVSKPVSDIWSLSKPLLDSAATQISAIPSLLMKLLFLSFMTFYFLKDGDRM
FT                   QDSFMLYVPTEKKENAKIFLNEIHKALKTLFIGNAVTSVIVGFISIIGYWLIGIPNPIT
FT                   LGALSGILNILPVVGGWTIYVPLTIYYLLTGEIVKGILLGLFGIIFLSLAPDFAIRPRV
FT                   ISKDGDLHPAFVLIAFLIGPLVFGIPGLAIGPIIVATVYAIHKVRKSIENREK"
FT   gene            complement(276167..277732)
FT                   /locus_tag="MmarC7_0263"
FT   CDS_pept        complement(276167..277732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65333"
FT                   /db_xref="GOA:A6VFV7"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV7"
FT                   /protein_id="ABR65333.1"
FT                   /translation="MSKLSKIILAIGLLSIITTAVSALEIDEPQYNPTVIHPGDDVDVW
FT                   IDVTNDEGSDEKIEDLRITVDSKYPFEIKQVNPTKGVYTISTLAEGESDTAYFKLHINE
FT                   DASSRDYRFDVKVSYDIVEYKNGDKVVTTRSFTKVYYIPVYGLANFEINSYGVTLTPAK
FT                   TEDVQLKVTNKGTGTAKQATLTIGSNSLINPVDTTKLYLGSLSPDVTKLLSVSLHASGD
FT                   TTEGSYLIPATLSWIDEDGTENFEVINIGFIVEGDINLGISNVITDPTEIKAQETYVKI
FT                   DVDITNNGHGEAKNVEIDLLSEDPFTDSWSNSNFKNIGILNSGDTKTAIFYIDVDKDAQ
FT                   SGHYSVPLNITYMDVFDEEHSELEYIDLYIKPKPVLEILPETYTLKAGDENTITLTLQN
FT                   IGSEKAESVKITAIKNTAQPFEYTQKTDSIGTLDTNESGEGQLIIDVDSDAANKEYLIT
FT                   VEVRSVGDSEQGDDNVYISQKTIRVNVEGGSNSTVVYLVVLILVAGVGYYMYLKRKKGK
FT                   EQTE"
FT   sig_peptide     complement(277661..277732)
FT                   /locus_tag="MmarC7_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.841 at
FT                   residue 24"
FT   gene            complement(277734..278891)
FT                   /locus_tag="MmarC7_0264"
FT   CDS_pept        complement(277734..278891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0264"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mmp:MMP1022
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65334"
FT                   /db_xref="GOA:A6VFV8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV8"
FT                   /protein_id="ABR65334.1"
FT                   /translation="MKAEKILQKIAEASEKRPFVVVAVVIVLTIFMAFMATGVESQTDY
FT                   EKMVPQDDPVIVSMNEIRDEFGGTETVMLGIKLVASDSSEKVTDIRDPRVLELVDFLEQ
FT                   DIGSMDMVTSVSSKVDVLRAYNNDVIPNDIATVKTIYQNLPESSKNGIFNDDYSMVVVY
FT                   ATTDAGTEDKKKLVKEINARLEESPIPPGVEVVTTGTPALSELIRRMMDESQAVTGAAS
FT                   LLAIFTILLLYFRNFVKSILPLIPVIVAVVWAAGAMAIFGIPMDTATSVMGSLLLGLGI
FT                   DYGVHLYHRYEEELREGKSLEEAINIAVVSTGSAVLVTTVTTMAGFAALTIAPLSMMSN
FT                   MGKVCTLGIFFCMAAVICLLPPLIVIEERHTRPFLNKLTLKLKGE"
FT   sig_peptide     complement(278775..278891)
FT                   /locus_tag="MmarC7_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.582 at
FT                   residue 39"
FT   gene            complement(278972..279574)
FT                   /locus_tag="MmarC7_0265"
FT   CDS_pept        complement(278972..279574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0265"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mmp:MMP1023
FT                   transcriptional regulator, TetR family member"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65335"
FT                   /db_xref="GOA:A6VFV9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFV9"
FT                   /protein_id="ABR65335.1"
FT                   /translation="MSTREKIVQNAAKLFLKKGYNQTSLNEIAEKSGITKGGIYHHFKD
FT                   KNELFVEMAEYFKSKFMSLLTKMEQEPSLENLLKNYFENSEIVMHEIAEYLELTLKDIR
FT                   FFPEFQSRFILDSIQYGPEDMDFTMHTKMMYSILKNKIELAKKNGEILDDIDSKELSLE
FT                   IVAIIEGYSNLRRLKLIDESYEYGNRTIERLWSRIKK"
FT   gene            complement(279686..281818)
FT                   /locus_tag="MmarC7_0266"
FT   CDS_pept        complement(279686..281818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0266"
FT                   /product="MCM family protein"
FT                   /note="PFAM: magnesium chelatase ChlI subunit; MCM family
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; KEGG: mmp:MMP1024 MCM family related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65336"
FT                   /db_xref="GOA:A6VFW0"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW0"
FT                   /protein_id="ABR65336.1"
FT                   /translation="MEFDEEVFLTFYGDKLKKYMKDQISQKMVKNNVFEFDIGDFLKNY
FT                   SDSCDINDQIIENPKLVEDPLLYIFKDAYMELFGEDDHIKKELEKTQIAFKNPLGCDKK
FT                   IDEITSSEMNRLVKFEGNIIKAAKVCALLKKACFVCRACGEISYKTVHDYFEQPRSYCK
FT                   NQNCRSEMSIDYDSSAYVNIQELEIQQPIDLMRNPDDPPRSIRVFLENSDGIYSGRVDV
FT                   VGTVMKKLTRPNMPVFEIYAKSNYVKLGESFQKIEVKDIINNYDLINTLDELGKKENII
FT                   DILSNYLIPQIKGYDLVKKSIFLQQVKACTKFLPDGSELRKDSHILLITDPGIGKSTML
FT                   RKISRLFPQNSYASVTTATGGGLTANVVREATEIGDGWVVKPGVFVRANEGTACIDELT
FT                   VDKNVMKYILEAMESQTIHVNKGGINVKLPARCAVLAACNPKRGRFDRNMGVVEQIGIP
FT                   APLLSRFDLIFPLKDSPDRRRDAEIAEHILDTHVETATKNYSKVLGSIEVDGITVDENL
FT                   IKNYIIYARTCAYFDENHHLYAGEVDEKKIKSPPLSKDAKKLIRDYYVDMRKLGEGNNP
FT                   VPVTARQLEAAIRISEMHAKARLSREVEEKDAKIAIDIIEECLKQVAYDPETGKFDIDK
FT                   GMGELPKSKMDKMDRIVDIIRELSVLSTSGLADEDDIVEKASEFQISEKEVSDLLLKLK
FT                   KSADVFSPKYGYYRLT"
FT   gene            complement(281831..282334)
FT                   /locus_tag="MmarC7_0267"
FT   CDS_pept        complement(281831..282334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65337"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW1"
FT                   /protein_id="ABR65337.1"
FT                   /translation="MDVYDILFLKCTEYEVVVNERHVPLWMLTEGDEERINFDLPWTNL
FT                   QDLAIYLYELKREQQKSKELLKCNLEEIIVGISYLKSKKSGSLLSDESMAIKACMDYLS
FT                   EFITARINCIYRYHYPMKTPANKSLFDEVILKFPQKKDIKAKNRQDFEEVISRLKKYDF
FT                   TLQN"
FT   gene            complement(282457..284157)
FT                   /locus_tag="MmarC7_0268"
FT   CDS_pept        complement(282457..284157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0268"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG: mmp:MMP1026
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65338"
FT                   /db_xref="GOA:A6VFW2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFW2"
FT                   /protein_id="ABR65338.1"
FT                   /translation="MDVENLIITTLKDKVEELTGNEMDIRLDEPPAINMGDYSTNISFR
FT                   LAKDLKKAPKVIAEDIANSLNISGIEKIEAVNGYINFFMNYSDFSKETVSKIIDEKENF
FT                   GKLEKRHEKVILEHTSANPNGPFHIGHGRNMVIGDSLKRILVASGYDVETQYYVNDMGR
FT                   QEAIVVFGNEKFELDKSKKADHAIGEVYVETNKLLAENEELEQEILNLMKNYEEACEAG
FT                   IENELTEKFKNAVDYSLGGFKETLSTLNIYHDKFVWESEFVKSGMVREVIKRLMDTGKV
FT                   VEDEVFRLDLSDYGLEKKLVLARLNGTSLYSTRDIAYHINKMENCDFAVNLLGADHKLT
FT                   AVMVNKTLALLGYNEAEVVFYEFISLPEGSMSTRRGRFISMDELFEEAKSRAAEEVRKR
FT                   GVAESEEEIEEIAKKIAVGAVRYNIVRIAPEKPMVFRWDEALDFEKVGCPVIQYAHARC
FT                   SRILENVEIISNDNLFAYEMNENEKTIVKLLSKLPKIVEKAAEVRKPQIVANYVLDVAQ
FT                   GFNKFYANCPVLKEENQIIKNSRIAIVNNTKMVLENTLDLLGIEMPGKM"
FT   gene            complement(285555..285950)
FT                   /locus_tag="MmarC7_0269"
FT   CDS_pept        complement(285555..285950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65339"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW3"
FT                   /protein_id="ABR65339.1"
FT                   /translation="MQAVNICSNHDYLEKNHLKLILNGLETGFIAMREFRETLEKPDDE
FT                   DIIYRKLCIDIADDNRIIFNEFQKIHISELNYEESKVLKDGYLKLDRFIAGYVIKEDQI
FT                   MDEIKKGNLIGYSKDVEEYYVLYCNEF"
FT   gene            complement(285964..286353)
FT                   /locus_tag="MmarC7_0270"
FT   CDS_pept        complement(285964..286353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65340"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW4"
FT                   /protein_id="ABR65340.1"
FT                   /translation="MMAESGIDAEYERIGIPESIIAISNLFMCAIKDFENVGTFKPFPK
FT                   IYQDNSVFSEEEDFVYVVRKQKIKLGDLQATSTNILKDDSLVVLQILDAKAIDESQIIE
FT                   ELKKGNVVEYSKERNFFYSIPAENY"
FT   gene            complement(286817..287122)
FT                   /locus_tag="MmarC7_0271"
FT   CDS_pept        complement(286817..287122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65341"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW5"
FT                   /protein_id="ABR65341.1"
FT                   /translation="MIAIPNNMQYMIMPHSELKTVKKELIDEAKKRAEEFLKSMDLKNF
FT                   DEELENNDLTFSLGLKTQKLNVMCLKIRKTAKGKYRFYIVSENFVDIDYTVRNWKN"
FT   gene            complement(287134..288348)
FT                   /locus_tag="MmarC7_0272"
FT   CDS_pept        complement(287134..288348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65342"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW6"
FT                   /protein_id="ABR65342.1"
FT                   /translation="MEALAELRPKIHENVNPKYPTLNDPRITLDRCTFTVYSDEIHKQI
FT                   DEWKRNNSIPKGSETYRKDVYQKWEHFKCRTEDKRGHTSGLQFPLENFEGENIAWMQIS
FT                   MREPHMAIVYVNMLKYYRKKQNIKKPNYGFHDTNFLPVDYTDNKQLLKDFAHLYYISCL
FT                   EIRREYQKLIKKLFNYELTKIDVTPKSIEIPCEYLHRDVMEYEWLSDVAKCKSVVKHSD
FT                   LTRTMYFNKNSKKIKSQLKFYQKAPGICRMEITLHKNFASDYLKLSTPEMLEQHILCAI
FT                   HDVLKLYGLSLDKITPFKLNHEDLLTQFALAFNLEKDYLKFLIYGNIGEMTFDKDNQGL
FT                   RNKLLKRGLIEKGDKRGVYVKTDMINFLKSVLGKYFVCNCGWLMYFDSDDGSYTCPCCN
FT                   SKRFF"
FT   gene            complement(288350..288790)
FT                   /locus_tag="MmarC7_0273"
FT   CDS_pept        complement(288350..288790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65343"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW7"
FT                   /protein_id="ABR65343.1"
FT                   /translation="MEAPNLEQIPEVIEIQLPHGSVKLFPGTEAIDKKDAKGNIIKNSK
FT                   GYPDKDYIKSLKAKGRINISGGTKNYGFLQFSYLDIKTIINEYQENEEVKQLVDYYADI
FT                   ENIENLKLLKNGGMSKTQILENAKVMNLNEDLVKEIVFGEGL"
FT   gene            289394..289948
FT                   /locus_tag="MmarC7_0274"
FT   CDS_pept        289394..289948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0274"
FT                   /product="regulatory protein MarR"
FT                   /note="PFAM: regulatory protein MarR; KEGG: mmp:MMP0465
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65344"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW8"
FT                   /protein_id="ABR65344.1"
FT                   /translation="MLRLIAKKHVKEILRLLESNDEMYFSEIKKALELNPRNLTDLLNE
FT                   LYESKLINKRIDEDNVKLSKVYYRITYEGKLILDVYEMLEDLEGKTNFVALIKYQNEKL
FT                   FEKIQKFEEGDIISARATIGPNSAILDFRLVEKDGEKTLEVSDFSKGLAEELFVYGNDR
FT                   IITVYEILKKIGTVENLYPTK"
FT   gene            290047..291705
FT                   /locus_tag="MmarC7_0275"
FT   CDS_pept        290047..291705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65345"
FT                   /db_xref="GOA:A6VFW9"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFW9"
FT                   /protein_id="ABR65345.1"
FT                   /translation="MGIKKYLINIWNKFNELNKITQYYTKYAFFICAIFSVVFTVFTLK
FT                   VINWNANPSDFATMLLYLFSTSAQSQAAFGGIIISVTLVGLQLISEKYNTKLTTIFLGS
FT                   KTFWLVIMAYIFSILFDIAVSTIIPVNSNVIEPIFWILNKFHLIFVGFFLLYFNFMMVP
FT                   FYLGFIIQCSKPRVLISYLCSGLTHEKINEKLKKEEYIFDPFEQLFKKIMHEESPNNFD
FT                   FLFEYFFNGWYYVAEKNIYCDKTIDKKYYFKFNYEFFILCLSLANYAVKTKNGEYLEHI
FT                   FRCIYKMFERMNKRITWNFEESNYMGDFIDDTVSKIENLSKNNGFESERESLQCILLNI
FT                   YKIGLNAINIGQVKNINCNMDYCAHVLFDIYESEHITFRNLLNNLIVELIELIPKSNEN
FT                   RSIKYILQSISEKVDSKLKSMYSKNTMGGKIWLYRGTFIQTFEFYLIIALLQNYDDSVE
FT                   EYIDEFILPLDKFLKPYGPVWQLKKLENSKKFIYLGWIEPLVSIDEYYDNFEKIKEYIT
FT                   KKIREKRIEDIENWKSKANKLDTLFIIDTEGNFKE"
FT   gene            291924..292226
FT                   /locus_tag="MmarC7_0276"
FT   CDS_pept        291924..292226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65346"
FT                   /db_xref="GOA:A6VFX0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX0"
FT                   /protein_id="ABR65346.1"
FT                   /translation="MIKSQIRYMVSKIYLENLKVGTKIKMNIETRIRKYFKKDISHMLF
FT                   SVLSVMLLTFIVLNVFQLVIVRNPFLNELLHNLDILTGFFMVVSAIGIVVMEIIF"
FT   gene            complement(293719..294120)
FT                   /locus_tag="MmarC7_0277"
FT   CDS_pept        complement(293719..294120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65347"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX1"
FT                   /protein_id="ABR65347.1"
FT                   /translation="MSKFEGKDVTLNYDPLADAMYIKRKNIEAEYDHTIEVDNIYLDMG
FT                   VTKTGEKIITGVEIIDASEIFGVTKFDLSNIIGTSGLIEVYKETVKINIILEVLKRNKP
FT                   FEKSINAKALNEYGLSNESFNIQATSAIA"
FT   gene            complement(294113..294409)
FT                   /locus_tag="MmarC7_0278"
FT   CDS_pept        complement(294113..294409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP0483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65348"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX2"
FT                   /protein_id="ABR65348.1"
FT                   /translation="MEIEEFLEIIKTLSKTNYELTEHFVHRLKERNFKFDELYNIIKTK
FT                   KCKGIINQNSDTFKLYYEYDSKKDIILVIAYRFNKFYFISPIPQDSKRRTKHE"
FT   gene            complement(294485..295333)
FT                   /locus_tag="MmarC7_0279"
FT   CDS_pept        complement(294485..295333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0279"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   tac:Ta1314 site-specific integrase/recombinase XerD related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65349"
FT                   /db_xref="GOA:A6VFX3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX3"
FT                   /protein_id="ABR65349.1"
FT                   /translation="MQDEISKRYLEFCTGLSKSTINSYKYGLRTFQKYANKRWRDVMVN
FT                   DVILFYTNHKATKNSKMSVLGTVSRFYDWGIEEKYLLDNPVKKFLKTLRREKKERNYLT
FT                   TSQANYLLSNIKRYDYYVITMFILKTGVRISELVNLKVQDVDLDSKIAFIGSGKGKKDR
FT                   YVFFDRDLAFHLREYIKERSYRDPKCDNLFLGVYRGHFSQRSLTLYKEYINEVAPNIHI
FT                   RITPHILRHTFATSMLERGIDLKSLSLILGHEDLSTTSIYLHKNKEALQREYQRVMEIN
FT                   F"
FT   gene            complement(295349..295879)
FT                   /locus_tag="MmarC7_0280"
FT   CDS_pept        complement(295349..295879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65350"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX4"
FT                   /protein_id="ABR65350.1"
FT                   /translation="MPRTEVYFHDEEKLKLYKKESKELGFNSFSDFIRFSIVFTLKNYE
FT                   KEKNPNITDKLDHILNILNTLELKNNATQDKLLKSVHHISRELRENSTGKEKRELIDKA
FT                   FEIIGNVYPQTLTFAELVEKMGITDNPRLVNMFREVVIQDPLFNDYIERRGDKFIAFEN
FT                   PSGRFASVEFQEL"
FT   gene            296036..298078
FT                   /locus_tag="MmarC7_0281"
FT   CDS_pept        296036..298078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0281"
FT                   /product="protein of unknown function DUF814"
FT                   /note="PFAM: protein of unknown function DUF814;
FT                   Fibronectin-binding A domain protein; KEGG: mmp:MMP1028
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65351"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX5"
FT                   /protein_id="ABR65351.1"
FT                   /translation="MKTEMTNVDISAAVSELQKVINGKLDKAFLVNNQDGKELILKVHI
FT                   PEIGSREIAIGLGKYKYITTTEYEREKPRNPPSFVMLLRKHLKNIKITSVAQHNFDRIV
FT                   IFNFEWNELKYKLIIELFGDGNAILLDSEDKIILPLKIERWSTRKIVPKEIYKFPPQKD
FT                   LDPKNLEYSLAKELFIEEFHKEENKDTEVVRIISRIFGLAGVYSEEICLISEIDKNLKN
FT                   PKNEEIKKLFEGSKSFFKRAFNEIKPKSVLKNGEFIDIDPIDLKMHENLKENEIKHYES
FT                   FLTALDEYFSRFIMKKEIKQAESKLQKLVKKQERILKSQLETKEKYEKQSILNHKRGDL
FT                   IYANYSLVDEIVSTIKLAREKMDWNGIKNVIKENKTHPVLSKIINVNEKNAELTLNLSA
FT                   DYGNGLIEDTVPVDLRKNAFENADIVYQKSKKFKNKVHGVIEALKISEKKLAELKEKEK
FT                   LDSEVLKEKEENIKKKERKVLKWYEKLKWTVIGGYLIVAGKDATTNEMLIKRYVEKNDI
FT                   VFHTLMEGAPFTIIRTEGSEEIPDENILFEVAKFAASHSRAWKLGIGSADVYWVRPDQI
FT                   SKTAESGEFLKKGAFVIRGKRNFIRSAALELGIGMLEYDGKLRITTAPESVTKETFKKW
FT                   LLLKPGKLKKSDLVKELLKEFGEFEVDDEDILRALPPGESEIKLK"
FT   gene            298167..298526
FT                   /locus_tag="MmarC7_0282"
FT   CDS_pept        298167..298526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0282"
FT                   /product="putative hypothetical protein"
FT                   /note="KEGG: mmp:MMP1029 putative hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65352"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX6"
FT                   /protein_id="ABR65352.1"
FT                   /translation="MKNTIQRSFEIKDYRIPKTEFGDFWMTFETREKLKTKITYVPENG
FT                   EKFTALEVKSVIEEIISKSKYFKENLPENIKVEVLFKNLSNDYYNPTENEIPDFEFKDM
FT                   DEISVLFYFIVDYYI"
FT   gene            complement(298530..299276)
FT                   /locus_tag="MmarC7_0283"
FT   CDS_pept        complement(298530..299276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0283"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: mmp:MMP0455 probable amino-acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65353"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX7"
FT                   /protein_id="ABR65353.1"
FT                   /translation="MLKFKILLILTAFMILISGCISNSENAEKETLVVGITPECYPINY
FT                   MDAGIHSGFEIEYITGIAEKMNMEPEFRIYEFANLLHAVETNRVDCAISLITVTPEREE
FT                   LVVFSKSYINTTSIQVVDKNTGIETVDNCTVGVIKGTVQDGCAMRLKENHEFILYKYRT
FT                   TTELERAFDQEKINVMIVDEIYFEYVLYPENNNLTSIFECPFGENISIAVNKENTELLS
FT                   DINNAITELEEDGTYDNLKNKWLLNE"
FT   sig_peptide     complement(299193..299276)
FT                   /locus_tag="MmarC7_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.576 at
FT                   residue 28"
FT   gene            complement(299445..300041)
FT                   /locus_tag="MmarC7_0284"
FT   CDS_pept        complement(299445..300041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0284"
FT                   /product="protein of unknown function DUF106 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF106
FT                   transmembrane; KEGG: mmp:MMP1030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65354"
FT                   /db_xref="GOA:A6VFX8"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR038978"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFX8"
FT                   /protein_id="ABR65354.1"
FT                   /translation="MFESIYSAFYNALDAIFLPMVQTMDPAIFIFVTAFLVSFIINLAT
FT                   KVLVNQDRMAELKNELQEFQVKAKKASKDPELMAELQKEQQKMMTMQMEMMKMSFKPMI
FT                   YTWVPIIIIFAYLRHVYDFGGIYHTMMPAWDGAIVQLPVIISKIIFIGIWHWIGGIFYH
FT                   GGFGVVSDTILGWLGWYILCSMGTSMVLRKLMGIK"
FT   gene            complement(300106..300684)
FT                   /locus_tag="MmarC7_0285"
FT   CDS_pept        complement(300106..300684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0285"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: mmp:MMP1031 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65355"
FT                   /db_xref="GOA:A6VFX9"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFX9"
FT                   /protein_id="ABR65355.1"
FT                   /translation="MKNKVVVVTGVPGVGGTTVTQKAMDILSEEGLNYKMVNFGSAMFE
FT                   VANEEGLASDRDQMRKLDPETQKRIQKMAGRKIAEMAKEYPVAVDTHSTVKTPKGYLPG
FT                   LPAWVLTELNPDMVIVVETDGDEILMRRLSDESRKRDLETTASIEEHQFMNRAAAMSYG
FT                   VLTGATVKIVKNKNGLVDNAVEELISVLR"
FT   gene            complement(300802..302727)
FT                   /locus_tag="MmarC7_0286"
FT   CDS_pept        complement(300802..302727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0286"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type; KEGG: mmp:MMP1032 replication protein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65356"
FT                   /db_xref="GOA:A6VFY0"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFY0"
FT                   /protein_id="ABR65356.1"
FT                   /translation="MNIDKLKQKILSKISQEELEKKVKEKIEENSGLLGEESAVMLVAQ
FT                   ELGIEITYGDEEEYDFTISDIADGQKNVEVTGKIIEISPAKDFNRKDGSTGKLASITIG
FT                   DNTGITRLTLWNDKTDLIEGLKKGDVVKIENAFSRKWNDKVELNSGSELSIDKLKKYDE
FT                   SRYPILKENYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLILKDDTGSIR
FT                   GTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIVEESAKEEKPVEKMNISEL
FT                   ADFDGEYVTISGNVANISGSREVQFSDRTAEVQDMYLNDGTGMVKIAFWGANRNILNDL
FT                   KEGDYLNVSNCKLRTYTDNTGEKRADLTYNYMSDLKKDETASEKIVEKITAIGDILSGS
FT                   SDNADVTVIGMVTNAYPVNEFSRSNGGTGKVRNIVLEDSTGSIRMALWDSDAEIEISEG
FT                   DVVKLIHGYAKESGEYMDLSTGRFGRIEVNPEGISIKSPRNYIAELEDGISTEISGTVV
FT                   DYRKQDVILSLCPNCRKRLNLVDNKYMCEVCGEVAPNELLVSNLTIDDGTGVINCRLYG
FT                   NNVEKVTELSKNKLKEMNLDALSNVLGKDVLFYGTPSFRNDELEFAVKRVNFVDASKEL
FT                   EVLKQH"
FT   gene            302881..305811
FT                   /locus_tag="MmarC7_0287"
FT   CDS_pept        302881..305811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFY1"
FT                   /protein_id="ABR65357.1"
FT                   /translation="MNIKRIVSDLKKESWYTKLDAVNRLGNITYETQDDADYVIKNLLI
FT                   ELESPKTVMQARTLWATNNIIKEYPQLAYKIVPHLLRLSNCENNAIKEISNELLNKPLI
FT                   KYAIARYSTLLSKSIHSEDYYEKLSAIVNIWKMAPVNPELIDNLLPELIESITDKNHLK
FT                   LGIFSWILMESEDNETIDEIVDLINKVYLHLDLNAQYPPSYIKKLINSSDHVMKFVALS
FT                   LIEKNPENVNNEVMEDLLKLFTSPNTDRYVKAKMFYTIGMLSQTKPYLKTILIHEVNKI
FT                   INNEKDWLLIFTALVGFYTIGEKITNSDLLNHSNSLIRGIAIQLIDSRASEQILSCFND
FT                   NHVTTYLSIIDRLIMPDISNDVKLKFLNELSNPDNYPYVTEHIDENSAARLRNSVGEIV
FT                   HSWNSEHWISKINLMNDLGNLAKNNSEYVDSSIELIIKSMEDNYGMVRAQGLWIVRAIL
FT                   YNSEDPFHILEALDGHLEPLLKINDPNIFVRLNYVLLLRSFSEFLKGIEGCEDKLSELA
FT                   GYLMYISLNDPTKIVSEVAKLILKYDFDTELDKKDITLDNFKDYLEIFPYSSVGIIKYL
FT                   LKQNQHDEKVVSMLVDICRTHYTFGCDIFCILYGIDIDVSSEELYGKLNDYLIYSSEES
FT                   QNSMKLLIKMHLTENNWKVRMLGISILDKISVLNLQFVDNFITDLIHISLFDKIFEIRE
FT                   RAGILLEKINYGSPKIDMKISINYFFKSNEELLEIIKNGDPGIDEAFYTLSVRDKEIDN
FT                   IEKLMTVVSKFKNDEHWYRRAYAYKILENLLKNPRADHYHYEIINWCLECAEDKNPMIS
FT                   KISKDILEKLGRTVQPSTQTNAYDRIRRIENLLESGDWTIKVEALQSVRDFINEGHYGY
FT                   LDIVMEKLDDPHWKVKNAALGILADIDPELIKPAIPKIIGLLNDGDESVILKTLLTLKK
FT                   FGQKDPKILEKVMPTLEKLENYGTWSIKEEIMRLKLSYYNKLRQKH"
FT   gene            305838..306437
FT                   /locus_tag="MmarC7_0288"
FT   CDS_pept        305838..306437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0288"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: mmp:MMP1034
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65358"
FT                   /db_xref="GOA:A6VFY2"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFY2"
FT                   /protein_id="ABR65358.1"
FT                   /translation="MNKFIVFEGIDGCGKTTQAKLIAEKLNAKFTFEPTDGKIGKSIRE
FT                   ILSGSKCQKETLALLFAADRVEHVSKIEEDLKKSHVVSDRYVYSSIVYQMSQGIPKDFI
FT                   YTINDYAKTPDLVVLLDVDLNEALKRMESREKEIFEKIEIQKKIKEGYYSLINSENEKF
FT                   MPKYGFIIIDTTSKSITQVFDEILNAIIDKIPDIIQ"
FT   gene            306511..306924
FT                   /locus_tag="MmarC7_0289"
FT   CDS_pept        306511..306924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0289"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   mmp:MMP1035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65359"
FT                   /db_xref="GOA:A6VFY3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFY3"
FT                   /protein_id="ABR65359.1"
FT                   /translation="MELGYITIIIGMGLILLEAFLPGLNFPVAGVAVLIYGIFLLYAPQ
FT                   WALPSAILAGLITAYIMKRFVYRTGLDVKIGAENLIGEHGDLVDEIGENNYGHVIIHGE
FT                   RWQAKSEIPIKKGSKVVVTGIEGVSLLIEELSE"
FT   gene            306974..307780
FT                   /locus_tag="MmarC7_0290"
FT   CDS_pept        306974..307780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0290"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: mmp:MMP1036 band 7
FT                   protein:stomatin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65360"
FT                   /db_xref="GOA:A6VFY4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFY4"
FT                   /protein_id="ABR65360.1"
FT                   /translation="MSFWLNLLFGIFILVLIIKSVIIVNQFELGLVFRLGKVRGRLNPG
FT                   VNFIIPFIDVPIKVDVRTKVIDVPPQEMITRDNAGVRIDAVIYYRVMDVNRAILEVQNF
FT                   QYAIINLAQTSLRAIIGSLELDDALNKREYINSQLLETLDRDTDAWGVKVEKVELREIE
FT                   PPTDIKNAMTQQMKAERLKRAAILEAEGEKQSKILKAQGSAESMKIEAEGQAKAIQIVA
FT                   ESAQTYFKNEAQLYKALDVTTNTLKDNTKFVISENIMDIAKKFIKQ"
FT   gene            307860..308339
FT                   /locus_tag="MmarC7_0291"
FT   CDS_pept        307860..308339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0291"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   mmp:MMP1037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65361"
FT                   /db_xref="GOA:A6VFY5"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFY5"
FT                   /protein_id="ABR65361.1"
FT                   /translation="MNITIISVGKIKEKYLSDAINEYSKRISRYSKIDIIEVADEKTPE
FT                   NPSEVEKSKILEKEAERILKYLKKDSFLITLEILGKELTSESLAKKINDLSISGKSDIT
FT                   FIIGGSLGLSKNISEISDFKLSFSKMTFPHQLMRVILLEQVYRSFRIINGEPYHK"
FT   gene            308596..308904
FT                   /locus_tag="MmarC7_0292"
FT   CDS_pept        308596..308904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0292"
FT                   /product="A1A0 ATPase, subunit H"
FT                   /note="KEGG: mmp:MMP1038 A1A0 ATPase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65362"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFY6"
FT                   /protein_id="ABR65362.1"
FT                   /translation="MSAIDTIREIKHAENNAVNAIEEAKKKAAEIKLAAIEEGKTIISD
FT                   AETTAEASAKELVSKYEKEAKEKADEIMAKEGKAIAEMANIAKVKILNIKLEDVIEF"
FT   gene            308938..310998
FT                   /locus_tag="MmarC7_0293"
FT   CDS_pept        308938..310998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0293"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: V-type ATPase 116 kDa subunit; KEGG:
FT                   mmp:MMP1039 A1A0 ATPase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65363"
FT                   /db_xref="GOA:A6VFY7"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFY7"
FT                   /protein_id="ABR65363.1"
FT                   /translation="MRPARMNKIRAVILDEKVDPVIRQLHESGLVELYDLSTKLEDPEW
FT                   NALMTPAPSAEYGRNVASLTIKVSRILDLFSNVSVGEKAGLSGVLNPKVPAKKKLSFSS
FT                   SEEIISNVENVLESVEGEISEPASKLAELENRKTILEMLKDSVKYLSGFDLDLKFLGEG
FT                   SYTYIVSGLVSQENMSELESSLEEATEGYVEIVKGNPVNKSEKEQKIPVIVATLKQCAD
FT                   VVSAELRKSGFERLDIANVEGTPSEIFNDTEKELLGIENETKAILEKLNALSKKWTEEV
FT                   LVLHEVLEIEKERAEAYSMTGKTERTHLIEAWTPKKHVKKVQEIIESASEGYAVVEVSE
FT                   PDEPVEKIPVMLDNAKAVKPFEMLTEMYAPPKYNEIDPTMMIMPGFLIFYGIMLTDAVY
FT                   GLLLTLAGLVLWKRMGKVSNGAYNLGYILTLSGLSTVFFGILTGGYLGDFMYQFLGMDI
FT                   YTTGFALVNPLGESTYISAAKPLLSLGGIDVNNGPMAILLFSIVAGIIHLFIGLTVGLK
FT                   ESLSKGSVLDAFLNQGMWILLILAIVATVVTGNMMIAGGAVIAVIALCMIKGFMNGGIL
FT                   DALLGAMDITGFLGNVLSYARLLALCLATGGLAMAVNIMAKLLGDAVPVIGILIAIVML
FT                   VFGHAFNFVMNGLGSFIHSLRLHYVEFFGQYYEGGGKRFSPFKAKREYTSN"
FT   gene            311052..311720
FT                   /locus_tag="MmarC7_0294"
FT   CDS_pept        311052..311720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0294"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: mmp:MMP1040 A1A0 ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65364"
FT                   /db_xref="GOA:A6VFY8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFY8"
FT                   /protein_id="ABR65364.1"
FT                   /translation="MVFENPLLLGAIGAGLAVGIAGLGSGIGAGITGASGAGVVAEDPN
FT                   KFGTAIVFQALPQTQGLYGFLVAILILFVFKSAPEWAMLAAGIGTGLAGLSAIGQGIAS
FT                   AAGLGAVAEDDGIFGKAMVFSVLPETQAIYGLLVAILLLVGVFASPGVTTIAALGAGLA
FT                   VGFAGLSGIGQGITAAGAIGATARDPDAMGKGLVLAVMPETFAIFGLLIAILIMLGIMF
FT                   "
FT   sig_peptide     311052..311177
FT                   /locus_tag="MmarC7_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.286 at
FT                   residue 42"
FT   gene            311781..312392
FT                   /locus_tag="MmarC7_0295"
FT   CDS_pept        311781..312392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0295"
FT                   /product="H+transporting two-sector ATPase E subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase E subunit;
FT                   KEGG: mmp:MMP1041 A1A0 ATPase, subunit IE"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65365"
FT                   /db_xref="GOA:A6VFY9"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFY9"
FT                   /protein_id="ABR65365.1"
FT                   /translation="MGAEKITSKIVEDANKNAEKILAEALNEKEAILTEAKEEASKKEQ
FT                   AIAKKGEKDAEMTKNRILAEARLSAKKKLLEEREKTIQLTLEKLEEDLVKLPQKEEYKD
FT                   ILLKLIISGVYSVGGGELELLLNKKDFEVIDDSTLWALEKEMEDRLKKVTVLKKGEAKS
FT                   IIGGCIIKTADKTKVSDNSLEATFERNLDSVRAKIAEMLF"
FT   gene            312403..313578
FT                   /locus_tag="MmarC7_0296"
FT   CDS_pept        312403..313578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0296"
FT                   /product="ATPase, A1 complex, subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATPase, A1 complex, subunit C archaea;
FT                   PFAM: H+transporting two-sector ATPase C (AC39) subunit;
FT                   KEGG: mmp:MMP1042 A1A0 ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65366"
FT                   /db_xref="GOA:A6VFZ0"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFZ0"
FT                   /protein_id="ABR65366.1"
FT                   /translation="MVDALTQLMESAGMPTDVFMTLFVLAGIAIFLVIMIFLIRYLSET
FT                   APFAYVNARVRSMESRLLKDHKINELIESAGTTELIGFLEDTDYGPYLSEVMGQSEDPV
FT                   VVEKALDIHLAHVYQTLANISPDGARKILKLLEKKFDVKNIKTLLRAKYVGLDAEETFK
FT                   LLIPLGTIPESKLRELSETKAIEEIVSALEGTGYSSVLSEGLTQYEQNGKLTTLEMSLD
FT                   KLILENLWKNVSVDGTEKDLFKEFIGTMIDIENLKIILKGKADGLSSEAISNYTTSKGY
FT                   ELASWKLKELADVESIEGVISSLEGTKYAPMMAENLEEFEKTKSVYVFEKALDSYLVKM
FT                   GKKLSLRQPFGIGPIIGLITSKELEIRNLKIIIKGKIEGLSASEIREILVS"
FT   gene            313600..313899
FT                   /locus_tag="MmarC7_0297"
FT   CDS_pept        313600..313899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0297"
FT                   /product="Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /note="PFAM: Vacuolar H+transporting two-sector ATPase F
FT                   subunit; KEGG: mmp:MMP1043 A1A0 ATPase, subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65367"
FT                   /db_xref="GOA:A6VFZ1"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFZ1"
FT                   /protein_id="ABR65367.1"
FT                   /translation="MRIGVVGDPDVVVGFRLAGLTDVYEVKSPEQAAKAIEELNSNSEI
FT                   GLIITTERIGEEIRDTISGVKKVVVEVPDKNGPIVRENDPVKVLVRNAVGVDIK"
FT   gene            313915..315675
FT                   /locus_tag="MmarC7_0298"
FT   CDS_pept        313915..315675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0298"
FT                   /product="ATP synthase, A subunit"
FT                   /note="TIGRFAM: ATP synthase, A subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: mmp:MMP1044 A1A0 ATPase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65368"
FT                   /db_xref="GOA:A6VFZ2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFZ2"
FT                   /protein_id="ABR65368.1"
FT                   /translation="MVVGKIIKISGPVVVAEGMKGSQMFEVVKVGNEGLTGEIIQLTED
FT                   EAIIQVYEETAGIKPGEGVTGTGAPLSVELGPGMLKAMYDGIQRPLNEIENATDSIYIP
FT                   RGVSVPSISRVIKWDFEPTAAVGDEVITGDVIGTVQETASIVHKIMIPFGVSGKIKEIK
FT                   SGSFTVEETVAVVETADGEKEIQMMQKWPVRKPRPSKGKQAPVIPLITGQRVEDTFFGL
FT                   AKGGASAIPGPFGSGKTVTQHQLAKWSDVDVVVYIGCGERGNEMTEVIEEFPHLDDIKT
FT                   GNKLMDRTVLIANTSNMPVAAREASVYTGITIAEYFRDQGLGVLLTADSTSRWAEAMRE
FT                   ISGRLEEMPGEEGYPAYLSSKLAQFYERAGRVECLGSENKQGFVCIVGAVSPPGGDFSE
FT                   PVTSNTLRIVKVFWALDANLARRRHFPAINWLTSYSLYIDDIAGWWQQNTAADWRSLRD
FT                   EAMSLLQKEAELQEIVQLVGPDALPDRERVILEIARMLREDFLQQDAYHEVDSYCSPIK
FT                   QYHMLKIIMTFYKKGLDAVAKGADPAGISAVTVKGDIARMKYLVEEEFVNTKVPEIINK
FT                   MESELGALIK"
FT   gene            315710..317098
FT                   /locus_tag="MmarC7_0299"
FT   CDS_pept        315710..317098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0299"
FT                   /product="H+transporting two-sector ATPase alpha/beta
FT                   subunit central region"
FT                   /note="PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; KEGG: mmp:MMP1045 A1A0
FT                   ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65369"
FT                   /db_xref="GOA:A6VFZ3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFZ3"
FT                   /protein_id="ABR65369.1"
FT                   /translation="MDAMQKTIEYTSVSRIAGPLMVIDGIEGIAYGEIVDITTPNGDKR
FT                   TGQVLEAREEIAVVQVFEGTSELNTSETKVRFTGDTAKIGVSYDMLGRIFNGAGKPLDG
FT                   GPEIIAEKKLDINGYPLNPVSRNPPNAFVQTGISTIDGTNTLVRGQKIPIFSGSGLPHN
FT                   KLATQIARQAKVRGEGEQFAVVFAAMGITGEESNYFMDEFKKTGALEKAVVFINLADDP
FT                   AIERILTPRIALTTAEYLAYEKGMHVLVILTDLTNYCEALREIAAARNEVPGRRGYPGY
FT                   MYTDLACLYERAGRVKGREGTVTQIPILTMPDDDITHPIPDLTGYITEGQIVLSRELNR
FT                   KGIYPPVDILPSLSRLAGNGQGEGKTRDDHSKVISQAYAAYAEGRGLRDLVAVVGEEAL
FT                   TERDRSFLKFADAFENSIVTQGVDEDRSIEETLDYVWDLLTILPREELKRVSDELIEKY
FT                   LPKK"
FT   gene            317145..317789
FT                   /locus_tag="MmarC7_0300"
FT   CDS_pept        317145..317789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0300"
FT                   /product="V-type ATPase, D subunit"
FT                   /note="TIGRFAM: V-type ATPase, D subunit; PFAM:
FT                   H+transporting two-sector ATPase D subunit; KEGG:
FT                   mmp:MMP1046 A1A0 ATPase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65370"
FT                   /db_xref="GOA:A6VFZ4"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFZ4"
FT                   /protein_id="ABR65370.1"
FT                   /translation="MADVNPTRMELLKLKGKIKLAEKGHKLLKQKRDALMMEFFEILDQ
FT                   ASGIRDKVNDALSQAYKDLIMAQAVMGTLSVKEASFAAKNDNIDLDVDMRNIMGIDVPV
FT                   FEISNVKRDISNRGYSPYGVSSKLDEAAKNFEEALELITELAEIETSIKLLAQEIITTK
FT                   RRVNALEYVVIPKMNATKKYIAMRLEEMERENFFRLKIIKARMDAKEAEEA"
FT   gene            317811..318176
FT                   /locus_tag="MmarC7_0301"
FT   CDS_pept        317811..318176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0301"
FT                   /product="Protein of unknown function DUF22"
FT                   /note="PFAM: Protein of unknown function DUF22; KEGG:
FT                   mmp:MMP1047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65371"
FT                   /db_xref="InterPro:IPR002572"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFZ5"
FT                   /protein_id="ABR65371.1"
FT                   /translation="MFRITGKIKEIEEKIESKKQGETKLEIVGQKVPVFAAETVEIKAG
FT                   EIKPINISKICLPKKTVLMPSAYIQHKLGNMVSLGEETPVPFEHERCLEYAIFVAVKEG
FT                   TIKEGELIGTIVVLHAE"
FT   gene            318233..318622
FT                   /locus_tag="MmarC7_0302"
FT   CDS_pept        318233..318622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0302"
FT                   /product="Protein of unknown function DUF61"
FT                   /note="PFAM: Protein of unknown function DUF61; KEGG:
FT                   mmp:MMP1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65372"
FT                   /db_xref="InterPro:IPR002746"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFZ6"
FT                   /protein_id="ABR65372.1"
FT                   /translation="MDKEIYKFLHNLKSNFKRKTLNELLKEDKPYLIVNGQRHRIKKKE
FT                   LEFIKESISGDIRLPIILEVDSSYDSGTVKIEGIEEVKLISKILGKKVSLFSEENILYI
FT                   YKPELREVRRKLPTTTQYLFRIGLN"
FT   gene            318820..319089
FT                   /locus_tag="MmarC7_0303"
FT   CDS_pept        318820..319089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0303"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: mmp:MMP1049 related to EhbB of Methanothermobacter
FT                   thermautotrophicus"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65373"
FT                   /db_xref="GOA:A6VFZ7"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFZ7"
FT                   /protein_id="ABR65373.1"
FT                   /translation="MNEYVLYFTMISLVFGAFSALKLAFRKETSNVLIGEGLMAVIIAT
FT                   FLVILAEIYSIAYVETVALLLLVCGPIGTIAFSKFMKKGNPADL"
FT   gene            complement(319123..319770)
FT                   /locus_tag="MmarC7_0304"
FT   CDS_pept        complement(319123..319770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0304"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   mmp:MMP1050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65374"
FT                   /db_xref="InterPro:IPR002790"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A6VFZ8"
FT                   /protein_id="ABR65374.1"
FT                   /translation="MWKKLGNLKKFYVKTSKKGTNKMALLIDGPNMLRKEFNVDLDKVR
FT                   DALEQFGDIVVGRVYLNQYASDKLIEAIANQGFEPRISAGDVDVEMAVDGTELIFNKNL
FT                   DTLVYMTRDADFLPAIRKAKERGKQIIVVGAEPGFSTAIQNIADHVIRVEEDFELDKEK
FT                   LEQKKREREHSISASESGPEENTEVQKNSEPKKSSTDSFKDGISNSINWLKK"
FT   gene            complement(319843..320637)
FT                   /locus_tag="MmarC7_0305"
FT   CDS_pept        complement(319843..320637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0305"
FT                   /product="stationary-phase survival protein SurE"
FT                   /EC_number="3.1.3.5"
FT                   /note="TIGRFAM: stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE; KEGG: mmp:MMP1051 survival
FT                   protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65375"
FT                   /db_xref="GOA:A6VFZ9"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VFZ9"
FT                   /protein_id="ABR65375.1"
FT                   /translation="MTMEILLVNDDGIYSNGLLALKNVIGEEFDANVTVVAPTNQQSGI
FT                   GRAISLFEPLRITKTKLADCSEGYAVSGTPTDCVVLGIHQVLKKVPDYVISGINIGENL
FT                   GTEITTSGTLGAAFEGAHHGAKALACSLQVTMDHLKFKEGESPIEFLTTARIVKNVFKK
FT                   FLGDEFPCDVVNINVPDNATENTPVEITKLAKRMYSMHVEERIDPRSRSYYWLDGYPVM
FT                   DEEDGTDVYAVRNKRNVSVTPLTLDNTAKNLDEFKEKYAKKF"
FT   gene            321068..321877
FT                   /locus_tag="MmarC7_0306"
FT   CDS_pept        321068..321877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0306"
FT                   /product="regulatory protein Crp"
FT                   /note="SMART: regulatory protein Crp; KEGG: mmp:MMP1052
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65376"
FT                   /db_xref="GOA:A6VG00"
FT                   /db_xref="InterPro:IPR012015"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG00"
FT                   /protein_id="ABR65376.1"
FT                   /translation="MKKRNITEFQILSEVVRRQPHIKQKEIADILGITVQGVSEHMRNL
FT                   IKDEHIRNKGRGEYLITEKGMAFLKTWISDFKNYLNDVNQNLYRYKDVWPAIASENIAP
FT                   GDTVGVYMKKGVIYVSKNIESDATAKVFLGGNSGDDVAIHEIHGHIEVHNGKVIVLKIP
FT                   SEVMGGSRNVDYEIVRNTLEEHPDAVIATAGTVGTVIVNKLEIHPDIRFAVSEGIVSAC
FT                   NRGCDVIAIITGKMAEKIIKTIDKNKISYTLLNASKMTDSDENPMFL"
FT   gene            complement(321910..322791)
FT                   /locus_tag="MmarC7_0307"
FT   CDS_pept        complement(321910..322791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0307"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: mmp:MMP1053
FT                   heterodisulfide reductase; subunit B2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65377"
FT                   /db_xref="GOA:A6VG01"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017678"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG01"
FT                   /protein_id="ABR65377.1"
FT                   /translation="MKYAFFLGCIMPNRYAGVESATRTVMEKLGVELVDMPGASCCPAP
FT                   GVFGSFDQKTWLTLAARNLVIAEEMGTDIVTVCNGCYGSLYEAAHMLHENKEALAMVNE
FT                   QLKEVGKEYKGTVKVRHFAELIYNDLGVDKIRENVVKPLSVNIGVHYGCHFLKPTSAKG
FT                   LGGAENPTMLDELVEATGAKSVAYKDKMMCCGAGGGVRAKELDLALSMTQEKIENMLAV
FT                   GADATVNVCPFCQLQFDRGQIEIKEKLGKEYGFPVVHLSQLLGLAMGMEPKDVALDVNF
FT                   ISPEPLLQKLGY"
FT   gene            complement(322826..323380)
FT                   /locus_tag="MmarC7_0308"
FT   CDS_pept        complement(322826..323380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0308"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="KEGG: mmp:MMP1054 heterodisulfide reductase; subunit
FT                   C2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65378"
FT                   /db_xref="GOA:A6VG02"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017680"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG02"
FT                   /protein_id="ABR65378.1"
FT                   /translation="MMKAEELNKGFVNEIIEAGTPVPGEKEVASLKSCYQCGTCTGSCP
FT                   SGRRTAYRTRKVIRQALLGIDSVLDSDDIWKCTTCYTCYERCPRDVKVTEIIKTIRNLA
FT                   AKKGNMATPHKMTAVYVLKAGHAVPANEDTAKLRKSIGLAEKAPIAQFSQKDMDEIRTI
FT                   AKNLKFDELIGFDWKTMGLKQ"
FT   gene            323512..323817
FT                   /locus_tag="MmarC7_0309"
FT   CDS_pept        323512..323817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0309"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   mmp:MMP1055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65379"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG03"
FT                   /protein_id="ABR65379.1"
FT                   /translation="MIEEIVKESEKGILIDIEVTTNAKKNEIGKINEWRKRIEIRIREQ
FT                   PIEGKANKAIVKFLKGIFKSEIFINSGTTSSQKTVLIPDKTKEDVVKILKKEIKSI"
FT   gene            323841..325043
FT                   /locus_tag="MmarC7_0310"
FT   CDS_pept        323841..325043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0310"
FT                   /product="protein of unknown function DUF181"
FT                   /note="PFAM: protein of unknown function DUF181; KEGG:
FT                   mmp:MMP1056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65380"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR017667"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG04"
FT                   /protein_id="ABR65380.1"
FT                   /translation="MENDINYTLAAYRICTPEETFEKIEPIIKEIGVTRTARIDGLDRI
FT                   GIPVFSSIRPSAKEGAISVYAGKGATEIQAKVSSTMEAIERYSAEFDEKSKLEITKAPE
FT                   NPVNLDDLILPDGKSAEYIDTDGIEWVYGKDIISGKTFEVPINSAVHPHDGKKLFRSNT
FT                   NGLASGNSEEEAVFHGMLEVIERDAWSISELSKNTYKKLNVENAKNPLIFELLEKFKKA
FT                   KVNIILKDLTSEVGIPTIAAISDDDVLKDPALLCMGVGCHLHPEIAVLRALTEVAQSRA
FT                   TQIHGAREDTNRGDVVRRISYDRLKRAHKKWYSFKNEINIEDMPNEAKLNLKKDIETVK
FT                   STLKQHGFDKIITVKLNKTEIDVSRVIIPKMEMYSVDRDRISLWIKDRIRRNLESNLNL
FT                   I"
FT   gene            325078..326046
FT                   /locus_tag="MmarC7_0311"
FT   CDS_pept        325078..326046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0311"
FT                   /product="Protein of unknown function DUF1722"
FT                   /note="PFAM: protein of unknown function DUF523; Protein of
FT                   unknown function DUF1722; KEGG: mmp:MMP1058 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65381"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG05"
FT                   /protein_id="ABR65381.1"
FT                   /translation="MRNFKKPDVLISKCIEHGRCRYDGQMISSDFVKSTKKYFNYVSVC
FT                   PEVEIGLSIPRNSLKIVFENGKFEFIQNITNNKYTSKITQFSSDFLDSIENIDGAILKH
FT                   KSPSCGIKNVKVYTTKGNPTIQKTEGFFAREVLNRYPHITIEEDSRLRNKRIKDHFLTK
FT                   LYTLKDFKEVKESESIKELVEFHTNNKFLFMAYNQKQNDFLGNTVGNHNKNFDKIIKIY
FT                   EKHLELLLKRPSSIGSNINVLMHIFGYLSNKLSKDEKALFIDSLQRYHNELDCLCVPII
FT                   LLKSWVIRFNVDYLKKQTYFEPFPSELADNSEIFKRDYWKG"
FT   gene            complement(326065..326141)
FT                   /locus_tag="MmarC7_R0002"
FT                   /note="tRNA-Ala2"
FT   tRNA            complement(326065..326141)
FT                   /locus_tag="MmarC7_R0002"
FT                   /product="tRNA-Ala"
FT   gene            326272..327723
FT                   /locus_tag="MmarC7_0312"
FT   CDS_pept        326272..327723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0312"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: mmp:MMP1059
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65382"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG06"
FT                   /protein_id="ABR65382.1"
FT                   /translation="MENLENYFDVVIIGAGPAGLFAAYELSKYNALKILVIDKGKDVLD
FT                   RYCAADKLKKCIKCEPCQILHGVGGAGGLSDGTLNLRPDIGGNLFEITNNENYAWQLIF
FT                   EVDKIFLDHGGPKKLSKGSSENIKSLQRCSAQNGVRFIPIIQRHIGSDHTKQLINNIKN
FT                   TLQNRGISFLLNTEVLEFKKNKVFVNNSGKEEQIETKYIIVAPGRGNAGWFLKISEKIG
FT                   LKANHGPIDVGVRVEVPAIIMESITEINHDPKFHIYTNTYDDFVRTFCTNPYGFVVEEN
FT                   YGDTIGVNGHSMVDKKSENTNFSFLTRIELTEPVENTTSYGKSIAELTTTLGGGKPILQ
FT                   RLGDLKRGRRSTWGRLEKSSFDPTLKQITPGDIAMALPHRIVTNIIEGLEKLDKVIPGV
FT                   SDDHTLLYAPEIKYYAMKTKVNSDLETSVSDIFAAGDGAGLSRDITNACATGILAARGI
FT                   LKKEGFKDIFKDESTNWQEKIETME"
FT   gene            327734..329164
FT                   /locus_tag="MmarC7_0313"
FT   CDS_pept        327734..329164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0313"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia DALR; tRNA synthetase
FT                   class I (M); Cysteinyl-tRNA synthetase class Ia; KEGG:
FT                   mmp:MMP1060 cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65383"
FT                   /db_xref="GOA:A6VG07"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG07"
FT                   /protein_id="ABR65383.1"
FT                   /translation="MLKVYNTLTRKEEEFKPLNENEVKMYVCGPTVYDHTHLGHGRTYV
FT                   SFDIIRRYLEHIGYTVNLVINFTDIDDKIIKRSQEKGKNPKELSETFVNVFLNDMATLK
FT                   VKPADIYPKVTEHIPEIIAFIEKLIEKGFAYKTENGVYFEVKKFENYGKLSNINLEDLI
FT                   SGARIEPSDEKKNPEDFALWKTAKPGEPKWESPFGEGRPGWHIECSAMSSKYLGEQFDI
FT                   HGGGRDLSFPHHENEIAQSVAYSGKDWVNYWLHTGFVMVNGEKMSKSLGNFITIEDISK
FT                   EYDPEILRFFFIQRHYRSPIDYTAESMSHVKNNLEKIYNVIENIRISLEKSEKSGIWNE
FT                   NEFLLYDILKNSKHNFYEAMNSDFNTVEALKSVFEVSNGVNKYLSLVKTPSEGLLLKAF
FT                   DFFKIVGEIFGLFENYFKESSESNDEGFVKFLIELRSDLRLQKNYEMSDKIRDGLKELG
FT                   YQIEDNPKEGTVFKKINI"
FT   gene            329202..329819
FT                   /locus_tag="MmarC7_0314"
FT   CDS_pept        329202..329819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0314"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: mmp:MMP1061 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65384"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG08"
FT                   /protein_id="ABR65384.1"
FT                   /translation="MVFLQEHFYKTLKSFSKVELVFKGSLFIGYGKPVKSEIEAKEFIN
FT                   EIKSIHSDATHNVSAYRIDTEYNFAMKYDDDGEPQGSAGKPIYKVIELKNLQNTVIVIT
FT                   RYFGGVKLGYGGLVNAYSDTATEVVNSSGILEVFEKVHVLAEFDYSEIQKVKQIIENFG
FT                   KIVDENYFDVVKFKIEVKKGLEDELIKKLVNLTKNKIKIGNL"
FT   gene            329853..331697
FT                   /locus_tag="MmarC7_0315"
FT   CDS_pept        329853..331697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65385"
FT                   /db_xref="GOA:A6VG09"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG09"
FT                   /protein_id="ABR65385.1"
FT                   /translation="MKKLITIFTILMSIIPAFAFDLENSTEFESYVSITAPAVSITDEG
FT                   YVGAAVDIDVKVSTGEGHAYMDTLPLTDIDMQGSARIASKVAFDTCGKDSDDYDVYYII
FT                   RSDVPTVGGPSAGAVLTVATIAAINNWTLNKNVMMTGMIGPDGTIGPVGGILEKIEVGA
FT                   EKNVDYFLIPYGQRHQIDENNESIDSIEYGKTLGINVVEVSNIYDAVYYFTNYEIETDY
FT                   EKNPMIDSKYNQIMGELSKITLENAKKSLEDVQNLDLSILNSSEKQEFEEGIQTASNLV
FT                   YLGNELHSSSNYYAGTSRSFNALVIFETLQSKYLYRNNESVKNYLSEVNESITEKKNYV
FT                   SDATLTKNNVEYVFSSKSRIYEASELMDEAFYQFDKGNLTSALEYAAYAKLRAETGIWW
FT                   LELSPEEENPEEIDEKDLKYLAREYLDNSEIVVVYTSTVLSEELVAYPLLQIEDSIDLY
FT                   NEKEYLLSMSKSIDAYVYSTTILDYTTDVDYLSDLAEKKINKAENCVLNTENNSEYIPV
FT                   SALSYFEYAENLDDKYSKILYFKYSIAYAQMNMDILKEFDSDAFKYEEKSSDYEISGNS
FT                   NNSDLFGQDYKIYFINITYLITGLLSGILIGVWYRKNN"
FT   sig_peptide     329853..329912
FT                   /locus_tag="MmarC7_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            331766..333310
FT                   /locus_tag="MmarC7_0316"
FT   CDS_pept        331766..333310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0316"
FT                   /product="isopropylmalate/citramalate/homocitrate synthase"
FT                   /note="TIGRFAM: isopropylmalate/citramalate/homocitrate
FT                   synthase; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain; KEGG: mmp:MMP1063
FT                   2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65386"
FT                   /db_xref="GOA:A6VG10"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG10"
FT                   /protein_id="ABR65386.1"
FT                   /translation="MESYLHSNEIIKNSLKSMKLPKKVRVFDTTLRDGEQTPGVSLTPD
FT                   QKLDIATKLSEIGVDAIEAGFPVSSEGEQESIKKITSMGLNAEICGLARAVKKDIDIAI
FT                   DCGVDSIHTFIATSPLHREYKLKMSKEKIIDIAIESIEYIKEHGIIVEFSAEDATRTEL
FT                   DYLKEVYKKAVEAGADRINVPDTVGVMVPHSMTYLISELKKDIKVPLSVHCHNDFGIAV
FT                   SNSVAAVEAGAEQVHCTVNGLGERAGNASLEETVMTLNMVYGIETNVDTKMLTKLSRIV
FT                   SNYTGIKTQPNKAIVGENSFAHESGIHAHGVLAHALTYEPIDPAIVGNKRRIVLGKHSG
FT                   AHAIKSKLSEIGVEIGDALSKEQFCEIVERVKAIGDKGKLVTDADVMAITEDITQRTIK
FT                   SERIVDLEQFAVMTGNNVLPTASVALKVRDKIYKTSELGVGPVDAALKAIQAAVGENIR
FT                   LNEYNISAISGGTDAIAEVTVRLENHEKEVIAKATGDDVVKASVEAVIDGINKLMS"
FT   gene            complement(333414..333977)
FT                   /locus_tag="MmarC7_0317"
FT   CDS_pept        complement(333414..333977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0317"
FT                   /product="putative adenylyl cyclase CyaB"
FT                   /note="TIGRFAM: putative adenylyl cyclase CyaB; PFAM:
FT                   adenylate cyclase; KEGG: mmp:MMP1064 RNA-binding region
FT                   RNP-1 (RNA recognition motif):adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65387"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG11"
FT                   /protein_id="ABR65387.1"
FT                   /translation="MIEVEIKVSLNDEDSKKILEKLNSMGFEKNETKEQIDTYFNGIDR
FT                   DFQITDEALRIRKSLNLDSNKGTVYVTYKGKKLDTISKTREEIEVEILEMDSMYKIFEK
FT                   LGFKPVDPVRKVREIYRKDDIEVSFDNVDFVGNYLEIEKVVDDDSKREQALEELLNLLK
FT                   SLNISTDKLEKRSYLELRRGNCGK"
FT   gene            complement(333974..334408)
FT                   /locus_tag="MmarC7_0318"
FT   CDS_pept        complement(333974..334408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0318"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix type 11 domain protein; KEGG: mmp:MMP1065
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65388"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG12"
FT                   /protein_id="ABR65388.1"
FT                   /translation="MKIDGLTEKILTLLEKYSTTREIAAELETHPKNIDRYIRVLRDLG
FT                   FIETKKGKTGGVFLTNEGRYVLKKKNINLITIKVQVVAEDKIGLLASISSKISEINGNI
FT                   LSTTLEKEGNKVRVWLVIENLEFNDLKDNLKEITDKVVLL"
FT   gene            334507..334968
FT                   /locus_tag="MmarC7_0319"
FT   CDS_pept        334507..334968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0319"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: mmp:MMP1066 molybdopterin cofactor biosynthesis
FT                   protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65389"
FT                   /db_xref="GOA:A6VG13"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023047"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG13"
FT                   /protein_id="ABR65389.1"
FT                   /translation="MLTHVDENGVKMVDVSKKKDVERICTAVGFIKLKKSTIEKITKQD
FT                   VIKGDVLTTAQVAGVMAVKNTSNIIPMCHPLPIESIKVNFEIFEDKIKAEARVKATYKT
FT                   GIEMESLTGVSVALLTIWDMVKAIEKDEFGQYPDTQIYGIEVTEKIKKE"
FT   gene            complement(334987..336471)
FT                   /locus_tag="MmarC7_0320"
FT   CDS_pept        complement(334987..336471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0320"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; KEGG: mmp:MMP1067 succinate dehydrogenase/fumarate
FT                   reductase iron-sulfur subunit // Methanosarcina type
FT                   heterodisulfide reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65390"
FT                   /db_xref="GOA:A6VG14"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG14"
FT                   /protein_id="ABR65390.1"
FT                   /translation="MKTFTITVKKTEGFKKFEVPVGLTVLDALEYINKTYGENIQFRSS
FT                   CRAGQCGSCAVMINKKSKLACKTKVEDNMIIEPLEGFDVISDLVVDREPYYKKIATLRN
FT                   YIQKKNDKITEDELDELKLYPDDLKDVKKIRGCIGCLSCVAMCPARKYSDYPGPTLMRQ
FT                   LARFAFDPKDELDREKEAFDENIYNCTTCGRCVEVCPKEIDIVHNAVEKLREKTFNKGY
FT                   NLDSHLEVRKNVLSQNRSVPKEKTSFLEEVADEYIVENEKMRVAFFTGCLVDFRLQEIG
FT                   KSAIRVLNAHGVSVIIPKNQVCCGSPFIRTGQTDISDNLKKQNLEIFNKLNVDSIVTLC
FT                   AGCGSTLKNDYKEKEFKVMDITEVLVKVGLIDYKPLDITVTYHDPCHLRRGQKVYLEPR
FT                   KILESIPKLKFVEMDIPDQCCGAGGGVRSGKPEVAEAIGKRKANMIYVTDADYLITVCP
FT                   FCEYHIRDSLKKYLEEHGLKKDIPVMNIVSLLDKVI"
FT   gene            complement(336611..337567)
FT                   /locus_tag="MmarC7_0321"
FT   CDS_pept        complement(336611..337567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0321"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: mmp:MMP1068
FT                   K+-dependent Na+/Ca+ exchanger
FT                   related-protein:sodium/calcium exchanger membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65391"
FT                   /db_xref="GOA:A6VG15"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG15"
FT                   /protein_id="ABR65391.1"
FT                   /translation="MLIESVFFLAVGLFMLSYGSDWFVLGASRVAKQFNISSFVIGATI
FT                   VAFGTSLPEIVTSAYAASTGSVDLAVGNALGSCIANIGLVLGLSLIISSVFIKNRSVLK
FT                   NGYLYIIYTIIFTILGYNGFSFFDGAILLILLVLYVIYTIKSGEMDEEEHEKSVTFGRA
FT                   IFYLVLGLAFVILGSSFFVDGAKGLATAFGISEKIIGFTIVAFGTSLPELAVSFAAARQ
FT                   KLGGIVIGNVIGSNIANMFGALAIAAMIHEIPAVKFELSVNILMVFLLLVLMSKEKIKS
FT                   MLNLKSKTEYLSEITKKDGLILIGIYVVFVLGLTGFF"
FT   gene            complement(337612..338535)
FT                   /locus_tag="MmarC7_0322"
FT   CDS_pept        complement(337612..338535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0322"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: mmp:MMP1069 basic
FT                   helix-loop-helix dimerization domain bHLH:peptidase
FT                   U7:signal peptide peptidase, SppA 36 kDa type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65392"
FT                   /db_xref="GOA:A6VG16"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG16"
FT                   /protein_id="ABR65392.1"
FT                   /translation="MKKIYYYSGAVFLVIILFLVGFILLLPGDGISSKNIALINIDGTI
FT                   TSQTSETGLFSEFEPSVNDYIEWIDDAEKDSNIKAIIIKINSPGGEVIASEKLSRKIKE
FT                   ASEEKVVVAYIETMGTSAAYQAASSTDYILAEKQALVGNIGVRMEILHYYGLMEKLGIN
FT                   VTTIKSGTYKDIMSPTRPMTEEEQKMIESIVDESYYEFVSWVAENRNMTINETLEVADG
FT                   KIYSGIQAEKVGLVDMTGTEGDAIDIASKMANITNPEVYVYGGSSSVGIFGMTFNDALC
FT                   SFGYGLGRGLSQSNMEESFKSYQIYY"
FT   gene            complement(338566..339183)
FT                   /locus_tag="MmarC7_0323"
FT   CDS_pept        complement(338566..339183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65393"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG17"
FT                   /protein_id="ABR65393.1"
FT                   /translation="MRYVAYKIHPQEFVENEIFEKSLILDGKRIHRVRLLGNVTNVDKS
FT                   NIVSFNLDGISVKDFENKSLDVEENDLLDIIGRIGEYNGERYVALEIYGKKNNEKDNWV
FT                   ELRNLEIEKTRKYVKDEETITYNRDDMSGELSVESEALEDLYGDLDIKDKVLDVIREND
FT                   GISYEDLIDNLGLEDVELDNVLSELKEDGEIYEPNPGSYRIL"
FT   gene            complement(339278..339694)
FT                   /locus_tag="MmarC7_0324"
FT   CDS_pept        complement(339278..339694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0324"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54; KEGG:
FT                   mmp:MMP1071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65394"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG18"
FT                   /protein_id="ABR65394.1"
FT                   /translation="MIIKIKTKVKPTEDENKVLTAVTNIFKDAEMEISENIYSGVSKDI
FT                   SRFKELLRSQAILDAARNVLERNIVGNATKFHINKQAAYSGILNFDKDVHGGIHIEFVS
FT                   EDGEDILKLIKDIAPRTRNGIIINEDEELENEKE"
FT   gene            complement(339709..340836)
FT                   /locus_tag="MmarC7_0325"
FT   CDS_pept        complement(339709..340836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0325"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mmp:MMP1072 aminotransferase (subgroup I) similar to
FT                   aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65395"
FT                   /db_xref="GOA:A6VG19"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG19"
FT                   /protein_id="ABR65395.1"
FT                   /translation="MIAERCLRTEQSEIRKIFNMATENSINLGIGEPDFDTPNHIVEAA
FT                   KMALDAGKTHYVPNAGIPELTSAISEKLKKDNNLDVSQKNIVTTCGASEALMLSLFTLV
FT                   NKGEEVLIPDPGFVSYKGLTELCEGKMVPIDLDDKFRIDLESVKNSVSEKTKCIVLNSP
FT                   SNPTGSVMTKEEIKGICEIADEKNICVISDEIYEKIIYGKKHYSAMEFTDNCILINGFS
FT                   KAYSMTGWRVGYLAVNENFDNKYQILENMMKIHQYGFACATSFAQFGAVEALTGNQNCV
FT                   SEMVLEFEKRRDLIYSGMKEIFNVQKPEGAFYIFPDVSEYGNGMDVATKLIQNGILCVP
FT                   GSAFGVNGENSVRFSYATKYEDIKRALEIMKNVLL"
FT   gene            341026..341280
FT                   /locus_tag="MmarC7_0326"
FT   CDS_pept        341026..341280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65396"
FT                   /db_xref="GOA:A6VG20"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG20"
FT                   /protein_id="ABR65396.1"
FT                   /translation="MFDDIVLIIASIGILLASFRLWVEKDREKMVYARLHITGVIDIAC
FT                   IVILLVFKQYLLALTYLVLVPFSAHAIANADFFDELKKQ"
FT   gene            341290..341532
FT                   /locus_tag="MmarC7_0327"
FT   CDS_pept        341290..341532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65397"
FT                   /db_xref="GOA:A6VG21"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG21"
FT                   /protein_id="ABR65397.1"
FT                   /translation="MSIYIDFLIMALVLMSYIGALIQKDLIKCVVLTGLGGLGLAYLFS
FT                   SLLAPDVALTEAILGGAVLPAFFAFTVRRTQRLDE"
FT   gene            complement(341599..342069)
FT                   /locus_tag="MmarC7_0328"
FT   CDS_pept        complement(341599..342069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0328"
FT                   /product="dUTP diphosphatase"
FT                   /note="KEGG: mmp:MMP1075 dUTP diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65398"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG22"
FT                   /protein_id="ABR65398.1"
FT                   /translation="MIIGPNITKDFLSDLKEGQLQQCGVDLKLDKIYKIEGNGAIDFSN
FT                   EKRVLPEHVLIFDSEKDEKIDLECGSYIVKIKEKMNIPENMAGFAYPRSTLLRMGVTLY
FT                   TAVHDPGYEGYASYLMHVMNPVTMYKYAKIAQIVFSEVKDGNGTYSGIYHKK"
FT   gene            complement(342071..343306)
FT                   /locus_tag="MmarC7_0329"
FT   CDS_pept        complement(342071..343306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0329"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: mmp:MMP1076
FT                   bacterial transferase hexapeptide repeat:ADP-glucose
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65399"
FT                   /db_xref="GOA:A6VG23"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG23"
FT                   /protein_id="ABR65399.1"
FT                   /translation="MDAIILCAGKGTRLYPITESRPKPMIPIAGKPILEHIIEKIENYV
FT                   EKIYLVVGFEKEKIIEYFKENPKIEYILQEKQLGTGHAVLTAKNFIKDDFLVLNGDIIF
FT                   EDSIDEILVYENAVALSKVGHPENFGVVELGYDNKIINLLEKPKKEELPSNLINAGIYK
FT                   LQNNVFDILENLVPSERGEIELTDALKKLIENGKLHGIELNGYWNDIGHPWDVLSANNR
FT                   FLNKIISKVSGKIENNVSITGNVIIEEGAVIKPNSVIEGPVIIKSGSIVGPLAYIRPNT
FT                   VLMENTFVGNSSEIKGSIILENTKIPHLSYVGDSIIGANCNFGCNTITANLRFDDKPVM
FT                   VNIKGKPVKSVRKLGAIIGDNVKTGIQVSFMPGVKIGSNSLIGANCLIDNDIEQNSFVY
FT                   KKDELVITKKRN"
FT   gene            complement(343316..344629)
FT                   /locus_tag="MmarC7_0330"
FT   CDS_pept        complement(343316..344629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0330"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: mmp:MMP1077
FT                   phosphoglucomutase/phosphomannomutase:calcium-bin DinG
FT                   EF-hand"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65400"
FT                   /db_xref="GOA:A6VG24"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR023666"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG24"
FT                   /protein_id="ABR65400.1"
FT                   /translation="MKNLDPLIAYKVGFAISKNFKKAVIGRDTRTTGNLIESAITAGLL
FT                   NGGCDVTTIGMVPTPVLGYSARDYDLGIMITASHNPPEYNGIKLFNKNGTAFDPKQEEK
FT                   LEKIIANDDFNEGTWDNIGCASEDKTAVKKYSEYILQNVDIKTNFNVVVDCANAAGCVV
FT                   SPNIFTEAGCKVISVNSHCDGRFVGRMPEPNETNLKETVDIIKGLNSNGRNYIGIAHDG
FT                   DADRMIAIDELGRVTDFDKLLAAFCKYVVQKTGADKIVTTVDASMAIDEYLDEFGAKVI
FT                   RTKIGDVAVAEELEKTGAIFGGEPSGTWIHRDIHLTPDGILSGLRVLEMMEFYGKKLCD
FT                   IIDEVPSYYNMREKIACPDNLKQKVMDYISKEGKKIFEKEPETLDGVRFSFEKGWMLIR
FT                   PSGTESYVRVRVEAKDEDFAEKLMENGISMVKTGISEN"
FT   gene            344751..345704
FT                   /locus_tag="MmarC7_0331"
FT   CDS_pept        344751..345704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65401"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG25"
FT                   /protein_id="ABR65401.1"
FT                   /translation="MLSDLILEIENENNNEEILNFLNILDSIYKNKEPVFDNATLKTLG
FT                   IEKIENDFASYGKNYPLFKMLYYFNEIPLFNSEKESILFIRNNNLNPSKTYFELDNFEK
FT                   ERLKELILNLGENKVADGYKPFVKDLLFGNTYYFSKYNIELKEYVSNLNSIYKIKEYDI
FT                   VKNCILKKELPPKNLILKHKQDLSKSIDLFNKKLNNTEFRKFSIDFEGKSFDCKYIYLK
FT                   QSLWDKIKGWFFGEINGIHYPALVNIAYNNPKIDYLKPFFILNDNEDEINVVARVPKLL
FT                   YLKYGLTLNHIKLNGKHTYFGKWNIRNFKKFLDVGL"
FT   gene            345701..347077
FT                   /locus_tag="MmarC7_0332"
FT   CDS_pept        345701..347077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0332"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase type II; Nucleotidyl
FT                   transferase; Cupin 2 conserved barrel domain protein; KEGG:
FT                   pfu:PF0589 mannose-6-phosphate
FT                   isomerase/mannose-1-phosphate guanylyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65402"
FT                   /db_xref="GOA:A6VG26"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG26"
FT                   /protein_id="ABR65402.1"
FT                   /translation="MKSIILAGGSGTRLWPLSREYFPKQFIKFKKLNKSLFQKTFERSL
FT                   NLADGNLEDICIVTNEKYKFLILGQIEELGLNFPEKNILIEPVAKNTLPAIYYGIKHFK
FT                   KSGEFNIAVFPSDHLIENEELLLETFLNSEELAKKYLLTFGITPNKPHTGYGYIKPGKK
FT                   LENGNLVEEFKEKPDLKTAEEYINKCYLWNSGMFLLNSDIFENELKIHAPEIYEAFETE
FT                   NVEKTFESVPNISIDYGIMEKSKNVAVVPINITWNDLGSFDAFYDEFETDENKNITPVE
FT                   NICINSSGNLVNTSDKKIVSLIGIDDAIIVDTRDSLLICKKGQSEKVKDIVNILKSKKD
FT                   ERAELHKKVYRSWGIYEILEDSEIYKIKKITVLPGKKLSYQLHHHRSEHWVIVKGMAKV
FT                   TVEGEEYFVRNGESTFVKSGLKHRLENPGKLPLEMIEIQIGEYFKEDDIIRFDDDWGRK
FT                   "
FT   gene            347058..347891
FT                   /locus_tag="MmarC7_0333"
FT   CDS_pept        347058..347891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0333"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mbu:Mbur_2229 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65403"
FT                   /db_xref="GOA:A6VG27"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG27"
FT                   /protein_id="ABR65403.1"
FT                   /translation="MTGEENNPTVSVIMPNYNNEKYLPEAIESILNQTYENFEFIIIDD
FT                   FSTDTSWNIIQNYAKKDNRIKAFRNEQNLKIVKTRNKGFELMSPNSKYIAIFDSDDISL
FT                   PERLEKQVMFLEKNLDYGLIGSHTLIIDESSAIIGSRKYETDFKKIIKNMVKKNQIAQP
FT                   SAMIGKSVLNEVGHYNEKYTRCQDYELWFRIAKVFKIGNLDEFLIKYRVSKTQGKTTNL
FT                   KETLKFTLDIQKKWLFDKKFFSIFGVIYYFLEHLMYFLPTNVVLKLFKVLNYEKA"
FT   gene            347878..348675
FT                   /locus_tag="MmarC7_0334"
FT   CDS_pept        347878..348675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_2884 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65404"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG28"
FT                   /protein_id="ABR65404.1"
FT                   /translation="MKKLKLCVLITTMNENIKRVKEELLPQLKNCEVVISHQITNGSIK
FT                   PYNEILGNNVKYVYMYDKGLSKNRNNALKHATGDICIICDDDVNFVDNFEEKIKSSYSS
FT                   ESIDIVTYKSVDFDGKERKNYPKTKFKHNLKSILSVSSIEISFKRDPVISKGLTFDENF
FT                   GFSKYIGCEENIFLKDCLDNGLNVIFVPEQIVIHPIESSGTFWTEHSVYSKGAAFKRMY
FT                   GTLGGLSLCFILSLLKYKSYGKNLSFFKFLRLILNGFFEYTKT"
FT   gene            complement(348677..349645)
FT                   /locus_tag="MmarC7_0335"
FT   CDS_pept        complement(348677..349645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0335"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mja:MJ1057 glycosyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65405"
FT                   /db_xref="GOA:A6VG29"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG29"
FT                   /protein_id="ABR65405.1"
FT                   /translation="MHPKISVIMSTYNEPVDYIKNSVDSILSQSFNDFEFIIILDNPNN
FT                   FEIWAELERYASKDDRIRLIKNEKNLGAAESRNNGINISKGNYIAIMDADDISLPYRLE
FT                   VQYEYMEKNPEIFLIGSGIIDMDGNGKAIVKHKMITSEARLKKILEKRNSINHPTIMFR
FT                   NNGKTYYREKFVNAQDYDLYLRLLSEKKRLKNIPEILVKYRINQNSISCSRTTKQKYYA
FT                   KKALEYYEQRLKTGSDNYSELNVNEIENLMLDCSSDTLKANIEVNLKLGNFKDAKKLMN
FT                   QYFNTEGYINVILIYYILACFGKKMFFGIYRLYWDFLNIIK"
FT   gene            complement(349707..350312)
FT                   /pseudo
FT                   /locus_tag="MmarC7_0336"
FT   gene            complement(350603..351151)
FT                   /locus_tag="MmarC7_0337"
FT   CDS_pept        complement(350603..351151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0337"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: dsy:DSY0446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65406"
FT                   /db_xref="GOA:A6VG30"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG30"
FT                   /protein_id="ABR65406.1"
FT                   /translation="MKERLYAILTLNPNFYIKPIPKQGNSIFSRILHHMLTSIISILLS
FT                   GEYPNTDAIKCRFGHHVGIVVSEAAEIGENTVIQQNTTIGRNLKTGNAPKIGNFCRVGS
FT                   GGNIIGHTKIADNVTVGAGCNIAESKIGANTKIGMGCTIVHTKIGKNCKILSGAVLNGQ
FT                   EIPDNSIVKPVISNIMGPY"
FT   gene            complement(351347..352204)
FT                   /locus_tag="MmarC7_0338"
FT   CDS_pept        complement(351347..352204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0338"
FT                   /product="glycosyl transferase family 11"
FT                   /note="PFAM: glycosyl transferase family 11; KEGG:
FT                   bfs:BF3688 putative alpha-1,2-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65407"
FT                   /db_xref="GOA:A6VG31"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG31"
FT                   /protein_id="ABR65407.1"
FT                   /translation="MKIIQLKGGLGNQMFQYALYKSLKKRGQEVLLDISWYLKNNAHNG
FT                   YELEWVFGLSPEYASIRQCFKLGDIPINLIYNVKRKVFPKKTHFFEKSNFNYDNNVFEV
FT                   TNGYFEGYWQNENYFKNFRSEILNDFSFKNIDKRNAEFSEYLKSINSVSVHVRRGDYVT
FT                   NQKALNVHGNICNLEYYNKAINLANNNLKNPKFVIFSDDITWCKSNLGIDDPVYVDWNT
FT                   GPYSYQDMYLMSNCKNNIIANSSFSWWGAWLNQNTEKKVFSPKKWVNDRNNVNIVPNGW
FT                   IKIK"
FT   gene            complement(352271..353194)
FT                   /locus_tag="MmarC7_0339"
FT   CDS_pept        complement(352271..353194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0339"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   mma:MM0658 GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65408"
FT                   /db_xref="GOA:A6VG32"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG32"
FT                   /protein_id="ABR65408.1"
FT                   /translation="MDKNSKITIFGGSGLVGSSIFRQLSKKGYSNVNYPSSKSVNLLDK
FT                   NQVEEYIKSEKPEYLFMVAGLVGGIYGNMKRNADFLYQNSIMILNVLESIKNCSKDTKI
FT                   LYTGSTCIYPKENPQPISENRLLNGLLEESNKGYALAKILGIVGCELYKKQYGINSICV
FT                   MPTNMYGPNDTYDLEDGHFIPSLIKKFVDAKNNNLKELTFWGTGIPRREALYVDDCADA
FT                   CIYLMDNYNSPDIINIGTGFDYSIKEYIEIMKKVLDFDVEINWDLSKPDGVFEKRTDIS
FT                   KLKEIMPEFNPRSFEDGVKEVLNDDF"
FT   gene            complement(353204..354256)
FT                   /locus_tag="MmarC7_0340"
FT   CDS_pept        complement(353204..354256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0340"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: mma:MM0659
FT                   GDP-mannose 4,6 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65409"
FT                   /db_xref="GOA:A6VG33"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG33"
FT                   /protein_id="ABR65409.1"
FT                   /translation="MKKALITGITGQDGSYLAEFLLEKGYEVHGLVRRSSTINTWRINH
FT                   LYGNPEILDKKLFLHYGDLTDITSLTSIIGKIKPNEIYNLAAQSHVKVSFEIPEVTANI
FT                   DALGTLRLLEAVRILGLEKSTKLYQASTSELYGKVLETPQSETTPFYPRSPYGVAKLYG
FT                   YWIIKNYREAYDMFACNGILFNHESERRGLTFVTRKITVGLSKIKLGLQDVLELGNLDA
FT                   KRDWGHARDYVEAMYLMLQQEIPEDYVIATGETHSVREFIELAGKHLGIDIYFEGTGAD
FT                   EVGIDRNTGKIVVKVNKKYFRPTEVDLLLGDPSKAKELKWEPKIKFEELVELMVKSDYE
FT                   LLKSGNFELY"
FT   gene            complement(354262..355764)
FT                   /locus_tag="MmarC7_0341"
FT   CDS_pept        complement(354262..355764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0341"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: mmp:MMP1089 polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65410"
FT                   /db_xref="GOA:A6VG34"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG34"
FT                   /protein_id="ABR65410.1"
FT                   /translation="MDYKERMIKGTSWNFLFLILAAPIGYFVRILYANSLTKVEVGLFY
FT                   AILDLIGMIAIFRSLGLNNAVIYFIPKFLVQNKKDLIKSTLISVLVIQILVAILVAFIM
FT                   YLVSPLIINNYINNQNQFGDFQLIFNLFITMIFGYYIFDGIKSILFNSIQGFQRQKLFS
FT                   TCNFLNILSILFLSLIFLYWGYGVYSPVLAYTFNSILMIGLYGIIFFKKIFPEFFNEKF
FT                   NLSKKLLKDIFSYSMPIMFGSAGFIVMGYLDSICLTYFTGLDAVADYRNVAMPTVLVLS
FT                   YFASAVCRVMLPMSTEMWEKGEKKNLSDGLKKILSYSFIISVPFAVVLAHFPTVLINLF
FT                   FNENYLTAAIPMSILSFGIIFLSMNNIIFNVFNGIGKPHISTKILYIGALFNLISNLLL
FT                   IPKFGTVGAAFTTTLSYVLIQVLQAHYLNKFLDYKFPVKKFALSVASAIISIIPLLIIK
FT                   EMVSNEYLLILLSCILYFIMYLLLVFLLNILNLNELKSFKLW"
FT   gene            complement(355792..356670)
FT                   /locus_tag="MmarC7_0342"
FT   CDS_pept        complement(355792..356670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0342"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: mmp:MMP1090 UDP-glucose 4-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65411"
FT                   /db_xref="GOA:A6VG35"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG35"
FT                   /protein_id="ABR65411.1"
FT                   /translation="MKILVTGGAGFIGSHIVDLLIENGHDVSVLDNLSTGNEKNLNSSA
FT                   KFIKGDILDKNLDLTGFECVIHEAAQINVRTSVENPVFDANINVLGTINILEKIKEYGV
FT                   KKIIFSSSGGAVYGEPEYLPVDEKHAVNPLSPYGLSKFCAEEYIKLYARLYGIEYCILR
FT                   YSNVYGSRQDPLGEAGVISIFIDKMKKGETPIIYGDGNQTRDFVNVKDVAKANLMALDW
FT                   KNDIVNIGYGNETSVNELFKIIASETGFNKDPIYEKEREGEVYRIYIDYSKAKTLGWIP
FT                   EFELENGIKEI"
FT   gene            complement(356704..357552)
FT                   /locus_tag="MmarC7_0343"
FT   CDS_pept        complement(356704..357552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0343"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   mmp:MMP1091 ADP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65412"
FT                   /db_xref="GOA:A6VG36"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG36"
FT                   /protein_id="ABR65412.1"
FT                   /translation="MVKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLAD
FT                   AGIENILIITGRGKYAIENHFDKNFELEERLKKDGKCEALKAIQEINDFAHIYYIRQGK
FT                   QKGLGDAVYCGREFVCDDYTIIMVGDTIYSGNVPKKLIEAHEKYGCSVIALERVPKEDV
FT                   YKYGVISGKELEKGIFEINDLVEKPNVEDAPSNLIITGAYLLSSKIFEHIENTEPGRGG
FT                   EIQLTDAMNALLKEEKIIGVEVDFKRYDIGDIKGWLEANVELGMENIDGFKEYIGDLCN
FT                   K"
FT   gene            complement(357625..358548)
FT                   /locus_tag="MmarC7_0344"
FT   CDS_pept        complement(357625..358548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0344"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: mmp:MMP1092
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65413"
FT                   /db_xref="GOA:A6VG37"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG37"
FT                   /protein_id="ABR65413.1"
FT                   /translation="MIFMEIMYIIVFLILIGYISRHFKILDEKDRMVLNKIVIYIAMPS
FT                   TIFLQLLTNVTPSDLPEFMKLPVIIFISTSVCALLAYFVGKRLKLDNKSLGGFVLVSSI
FT                   GNTGFLGYPVILGFYGESGLLRAIFCDMAAIFCSMLLGTYIGVKLSGAKKSILKEVFTF
FT                   PPLFTALFTLILVLLHVKLSIFPEFFIKSLEYMSNATIPLIMLSLGLSLSPKAAKFGIF
FT                   YGLLASIFRMVISPLIAFPISESILSNQLDKQVAIMQSAMPSAMMPLVYAVIYDLDVRL
FT                   VASACFVSTVVSLLVLPVIYTAMQTM"
FT   gene            complement(358545..358991)
FT                   /locus_tag="MmarC7_0345"
FT   CDS_pept        complement(358545..358991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0345"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: mmp:MMP1093
FT                   4'-phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65414"
FT                   /db_xref="GOA:A6VG38"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG38"
FT                   /protein_id="ABR65414.1"
FT                   /translation="MNKVVIGGTFDILHKGHENLLLHASKFGKLFIGITSDEFIKLYKK
FT                   HEVNPLNIRENNLKKFLDSNNLDYEIMVINDPYGNSISKNYDIIVVTPETKENAEIINK
FT                   IRLKNGLKPLNIEVYDFLMATDNIPISTTRIRNGEIDLYGNLKR"
FT   gene            complement(359055..361331)
FT                   /locus_tag="MmarC7_0346"
FT   CDS_pept        complement(359055..361331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0346"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /note="TIGRFAM: phosphoenolpyruvate synthase; PFAM:
FT                   PEP-utilizing protein; pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; PEP-utilising protein mobile region;
FT                   KEGG: mmp:MMP1094 phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65415"
FT                   /db_xref="GOA:A6VG39"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG39"
FT                   /protein_id="ABR65415.1"
FT                   /translation="MKLITWLDDLRNDDVDIAGGKGASLGEMWNAKLPVPPAFVITSEA
FT                   YRYFIKETKLQDEIERILSNIDVNNNEELNKASKEVRKAIENVKIPDDLKLSIIESYHK
FT                   MCEISGDDETFVAVRSSATAEDLPDASFAGQQETFLNMKGNEQVLQAVQECFSSLFTPR
FT                   AIFYREEKGFDHFEVALAAVVQKMVNADQAGVMFTVNPINHDYNQMVIEGAWGLGEGVV
FT                   SGTVSPDTYIVSKDTQEILSINVARKDTMFIKDTDGVTKEVKTPEDLLEKQVLSEELIK
FT                   KLENVGQTIENHYKRPMDIEWAIEKGEIYMLQARPITTLNEKKESKSSNEVEGKILLKG
FT                   IGASPGIEAGKIKIISEIEEIGRILDGDILVTKMTTPDMVPAMKKAAAIITDDGGLTCH
FT                   AAIISRELGTPCVVGTKEATKNLKDDECVTVDGEKGIVYEGKIGKKEEKATAQIVYAGA
FT                   PVITATEIKANVSMPEVAERAAATGADGVGLLRAEHMILGTGVHPGKILNEGGEGALTE
FT                   VFAEGIKKVADAFYPRPVTYRTLDAPTDEFVGLKGGEDEPHEHNPMMGWRGIRRGLDQP
FT                   EILKCELRAIKQLKDDGYRNINVMIPLVTNVDEIRKVKEIANEVGLKLRLDVEFGVMVE
FT                   TPAAALIIDDIINEGIDFVSLGTNDLTQYTIAIDRNNENVSKYYLENHPAVLKLIELVI
FT                   TSCKSAGVKTSICGQAGSRPQIVEKLVEWGITSISANIDAVETIRNVVARTEQKIILES
FT                   IRKQK"
FT   gene            361574..362419
FT                   /locus_tag="MmarC7_0347"
FT   CDS_pept        361574..362419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0347"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   mmp:MMP1095 phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65416"
FT                   /db_xref="GOA:A6VG40"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG40"
FT                   /protein_id="ABR65416.1"
FT                   /translation="MKKYISVLIGAVFISLIVGFSGCMDSTNGSNDVEEIQQVNLKISG
FT                   STTVLPIAEEAAKQFMMANKNYMIEVTGGGSGLGVKESGENLNDIGMASREIKSSELDT
FT                   YPELIAYGIAKDGVAIIVHPENPVSSLTQEQIIAIYSGKITNWNEVGGDDAPITVYTRD
FT                   EESGTREVFFEKALNKGNITKQAVVVASNGAMKSSVKADVNGIGYLSIGYLDSSVKGCE
FT                   YEGVIPTEANVVAGTYKVSRTLNVITNGEPSAEAKAFIDFLLSSEGQQIVVEEGYISVN
FT                   "
FT   gene            362492..363367
FT                   /locus_tag="MmarC7_0348"
FT   CDS_pept        362492..363367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0348"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mmp:MMP1096
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65417"
FT                   /db_xref="GOA:A6VG41"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG41"
FT                   /protein_id="ABR65417.1"
FT                   /translation="MHKKNIGESVLENLLKLNALLSSVIIFAMVLFLIFSSLPVFSVVS
FT                   PFDFVFGLDWSPNYDSYGIFPMIIGSFLVTVLALVFSIPLGVGCAIFLAELAPKKVQNI
FT                   LRPSIEILTAIPSVVYGFVGMVLLVPLIRDVFNTNPGYSWLAASIILGIMIVPTITVLS
FT                   EDAINSVPSQLKEGSLAMGATRWQTIKKVILPASLSGILSGVILGMGRAIGETMAVLMV
FT                   AGNWPLIPTSIFNPVRPLTSHIILNIKEAASGSPIYYAMFATGLVLFIMVLSLNLISQY
FT                   INKKYKIKWD"
FT   sig_peptide     362492..362620
FT                   /locus_tag="MmarC7_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.984 at
FT                   residue 43"
FT   gene            363377..364243
FT                   /locus_tag="MmarC7_0349"
FT   CDS_pept        363377..364243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0349"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mmp:MMP1097
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65418"
FT                   /db_xref="GOA:A6VG42"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG42"
FT                   /protein_id="ABR65418.1"
FT                   /translation="MNNSKKAKIEENIVFGIFYLFAFIVIGILFTIVGYVFINGIGAIN
FT                   MAFFFGDANPINVILGSERCFDGIWNSILGTLALVVLSILLSIPFGVLGAIYLHEYASD
FT                   NKITQAIRFSSDSLAGLPSIVFGIFGYALAIKTVGPSLLIGGLTLSFMVLPIIMRATEE
FT                   GLKAVAPGLREGSLALGATKWQTITKVVIPSALPQMITGIILAMGRSAEETAAIMFTAA
FT                   TTFSFGLGLFNRVETLSFSLYVLATEYSTTEELQLAYGIALVLIVIMFILFTIANVVKN
FT                   RFKLMQS"
FT   gene            364261..365016
FT                   /locus_tag="MmarC7_0350"
FT   CDS_pept        364261..365016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0350"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   mmp:MMP1098 phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65419"
FT                   /db_xref="GOA:A6VG43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG43"
FT                   /protein_id="ABR65419.1"
FT                   /translation="MKLKMESKDVNLWYGEKKALNDINLPIYENNITALIGPSGCGKST
FT                   FLRCLNRMNDLISGVTITGTITIDEKNIYDKDVDVVELRKRVGMVFQKPNPFPMSIYDN
FT                   IAYGPKIHGIKDKNELDEIVEWALKKSALWEDVKDDLKKSALKLSGGQQQRLCIARTIA
FT                   VKPDVILMDEPCSALDPISTLKIEDLMVELKNEYSIVIVTHNMQQASRVSDYTGFFMLG
FT                   DLVEFNKTDKLFVEPENKKTEDYISGRFG"
FT   gene            365047..365748
FT                   /locus_tag="MmarC7_0351"
FT   CDS_pept        365047..365748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0351"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG: mmp:MMP1099
FT                   phosphate ABC transporter, regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65420"
FT                   /db_xref="GOA:A6VG44"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG44"
FT                   /protein_id="ABR65420.1"
FT                   /translation="MVRTAFSYQMKEIEDMIYEMSEMCVTALKNSINAYLNNDVELAKI
FT                   VKAGDDSIDLKEMEIEEKCISFMARQQPVASDLREIITMIKIISKLEKVGDMASRIAKI
FT                   TINSEQNTLRSKNGSVLTIMGEILEKMLKNSILSFRNRDLSLAKETYLEDNKIDELYKV
FT                   LCRDMTINMIENPKIISEASDFIVVGTYLERVGNSCKSIGDRVAFMITGERLKEEEFEK
FT                   VLKKTTKKLEN"
FT   gene            complement(365745..366152)
FT                   /locus_tag="MmarC7_0352"
FT   CDS_pept        complement(365745..366152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0352"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mmp:MMP1100 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65421"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG45"
FT                   /protein_id="ABR65421.1"
FT                   /translation="MNSIENVDRKLIENLANLMSSEVRAKIYIYLRKYNKSTVDEIADG
FT                   TGIYPSTVRESILDMYNTGYVSREKMDKEGLGKKPYLYTAAAPSEIVRKISKSIQEKLN
FT                   DLIMVDKRLDAKELKIPFVPVKIVVDEKYKD"
FT   gene            complement(366370..367557)
FT                   /locus_tag="MmarC7_0353"
FT   CDS_pept        complement(366370..367557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0353"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   mmp:MMP1101 aminotransferase (subgroup II) similar to
FT                   acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65422"
FT                   /db_xref="GOA:A6VG46"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG46"
FT                   /protein_id="ABR65422.1"
FT                   /translation="MSTLEKEQIISDEKKYVINTYGRVPVVLVKGKGMSVFDTEGKEYL
FT                   DFLAGIGVNNVGHCHPKVVETIKNQAETLIHISNIYYNVPQIELAKKLVNLSGLDKAFF
FT                   CNSGAEANEAAIKLARKYGKTKGKQGEIITMEHSFHGRTLTTVTATPKAKYQEGFEPLP
FT                   QGFAYIPFNDIEALKAGISEKTAAIMIEPVQGEGGIHVADKDYLKAVRKLCDENNIVLI
FT                   FDEVQCGMGRTGTIFAYEQYGVLPDIVTLAKGLGGGVPIGAIVAKSKIASAFTPGSHGT
FT                   TFGGNPLACASSNAAIDVISGLLENTLEMGDYFKNKLKILDKKYEFIKEVRSLGLMIGI
FT                   ELTFNGSDIVSKMFEKGFLINCTSDTVLRFLPPLIVEKEHIDAIISALDEVFSEI"
FT   gene            367710..368285
FT                   /locus_tag="MmarC7_0354"
FT   CDS_pept        367710..368285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0354"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="SMART: phospholipase D/Transphosphatidylase; KEGG:
FT                   mmp:MMP1102 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65423"
FT                   /db_xref="GOA:A6VG47"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG47"
FT                   /protein_id="ABR65423.1"
FT                   /translation="MEFDLTNICGYLAIINTIVLVILFYIIIRLLKLVKSNFEYSRSLT
FT                   CPEDRIEVLNDEKYYYYVLNRIKYAKKEIDVIMFSIYLNPKISELIDELVNARKRGVMV
FT                   RVILEEEVGSNILAQSKLSSQHIMVKFHDSKKTHNKLIIVDDTVIVGSHNWTDKALFEN
FT                   KESGIAISNENVLKEEKEYFESLWRSVE"
FT   gene            368282..368926
FT                   /locus_tag="MmarC7_0355"
FT   CDS_pept        368282..368926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0355"
FT                   /product="TfuA domain protein core"
FT                   /note="PFAM: TfuA domain protein core; KEGG: mmp:MMP1103
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65424"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG48"
FT                   /protein_id="ABR65424.1"
FT                   /translation="MKIAIFSKLTIKEDEIKEKMKNFDVDIYPPIKRGDLTAQKIFDYD
FT                   VIGIIDGCFLQNTAVAHREILKVLQNNIKVFGAGSMGALRASELDSCGMIGVGSVYSLY
FT                   KHGIITDDDEVAVTFDDNLNQITFSMISFREMINNAIKDKIIDENDSKKLITSGKELYY
FT                   PLRTFENVIEKSGISDEKKEVLEKYLKNQQDIKRIDAFEMLEEIIKYIEKQ"
FT   gene            368976..369422
FT                   /locus_tag="MmarC7_0356"
FT   CDS_pept        368976..369422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0356"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: aspartate transcarbamylase regulatory
FT                   subunit; KEGG: mmp:MMP1104 aspartate carbamoyltransferase,
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65425"
FT                   /db_xref="GOA:A6VG49"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG49"
FT                   /protein_id="ABR65425.1"
FT                   /translation="MKMELKVKPIENGTVIDHISGSKALKVYKILNIEEKLPMTIALNV
FT                   PSKKGVMKDILKIEGLELTKEDVNKIALISPDATINIIKEGIVIKKFKVDLPKRIDGII
FT                   KCTNPNCITNKENIDGKFSIEQKNTLKIRCEYCEKFINSIIISK"
FT   gene            369475..370563
FT                   /locus_tag="MmarC7_0357"
FT   CDS_pept        369475..370563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0357"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein; KEGG: mmp:MMP1105 succinate-CoA ligase
FT                   (ADP-forming), beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65426"
FT                   /db_xref="GOA:A6VG50"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG50"
FT                   /protein_id="ABR65426.1"
FT                   /translation="MKLHEYEAKEIFKENGIPIPKNKLTCGKVDSIDYPVVIKAQVLVG
FT                   GRGKAGGILFSDNLDDANEKIESLIGNTVKGEVVEKVLLEEQIKISKEYYVGVVVNRNE
FT                   KNNVVIFSTEGGVDIEEVASKTPEKIIKLPLESGKEFLPYLAREMLKKAGIPSAEIPKV
FT                   ADVLCKVYKAFKDMDGILAEINPLVFTEDGKIIAADAVLNIDDDAYFRHNYDKFEEFEK
FT                   QEKSEFAYVELDGDIAVIGNGAGLTLASMDIVKEFGGEPACFLDVGGGSTRETVKKALL
FT                   KATSRKNVKGAFINILGGITRCDEVSLGIVDVLNENPNLKFAVRMMGTNEEEGRKILSE
FT                   NGVSFENSMDGAAKALTELINS"
FT   gene            370576..370890
FT                   /locus_tag="MmarC7_0358"
FT   CDS_pept        370576..370890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65427"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG51"
FT                   /protein_id="ABR65427.1"
FT                   /translation="MFKLRKKKPETVSRDKYEDIKKIYLESKKSYIALEAKYKHELYTN
FT                   SQLKSEISRKNVELEYLNHKLNELYEKYRDLSKSYEKLENRIKFLLSELEIKDKKDSEK
FT                   "
FT   gene            complement(370891..371160)
FT                   /locus_tag="MmarC7_0359"
FT   CDS_pept        complement(370891..371160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0359"
FT                   /product="Ribonucleoprotein complex SRP, Srp19 component"
FT                   /note="PFAM: Ribonucleoprotein complex SRP, Srp19
FT                   component; KEGG: mmp:MMP1107 signal recognition particle
FT                   protein SRP19"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65428"
FT                   /db_xref="GOA:A6VG52"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG52"
FT                   /protein_id="ABR65428.1"
FT                   /translation="MKEMIIWPAYIDIKRTKNEGRKVPKEFAVANPKLKDIADKIKKMG
FT                   LEHSIEIKKSYPMEPWEICGYIKVKLDKNTSKLQILKEISKNMK"
FT   gene            complement(371175..372125)
FT                   /locus_tag="MmarC7_0360"
FT   CDS_pept        complement(371175..372125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0360"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: mmp:MMP1108 magnesium, nickel and cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65429"
FT                   /db_xref="GOA:A6VG53"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG53"
FT                   /protein_id="ABR65429.1"
FT                   /translation="MLEILGYAKGSFEVLNLDEINSEHDLIWIDCYDPSDVELIELSKT
FT                   IDIEIDELSLGLDEQEVPRVEEEDKYYTIIFKAPLFEEDITTTSFGIYVKDNIILTIHA
FT                   DKIKSIGRLYNLVKTKKPKTLLDKGKGFFIYTILNQITISYSRILVNLEDQLDVLEDRI
FT                   VQEQNKNMTEEILQLRKMLVYFHKALISNKDVISVLKRKYLSITTQEDRWEFEDLYYDV
FT                   LQLIDMETTYRELLSSMMDMSLSIENIRMNQVMKILTMVTALFAVPMWITGIYGMNFKY
FT                   MPLSEHPYGFWIISAVSIVIIMIIIHTFVKEKWIK"
FT   gene            complement(372136..373245)
FT                   /locus_tag="MmarC7_0361"
FT   CDS_pept        complement(372136..373245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0361"
FT                   /product="Protein of unknown function DUF373"
FT                   /note="PFAM: Protein of unknown function DUF373; KEGG:
FT                   mmp:MMP1109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65430"
FT                   /db_xref="GOA:A6VG54"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG54"
FT                   /protein_id="ABR65430.1"
FT                   /translation="MVSIKDIGKDYNVPEDKKYLVIVVDMDDDVGRKANIRTPILSRED
FT                   NINAAVRLGLTDPGDSDVNSMLGGVQHYDHLKKEGKDVEIATISGDIDIESEVCAIKIK
FT                   EQIDFLIYLYEPNFIYLVSDGKEDEMVLKYLELKDIFVWKKRIVIKQNESLESTYYLMQ
FT                   EFIKKTMSQYIPLIFTSIGFAMILYAIFSDLGWRIIAGLIGIYILSEGVGLVESIKKTL
FT                   NESKKGLEVGKLSPFGNILGFLILLVGILYSYQASVDPELTVFFGKFLLNIANPLTLGF
FT                   VLLVLVHFIDDLIHTEKSILRLIKRLFFNVVLAFILRQMLIISSDYLIGYTVEFMGLVM
FT                   YILAYVSILIVLSVVLFHEPKSKEEMNNE"
FT   gene            complement(373295..374449)
FT                   /locus_tag="MmarC7_0362"
FT   CDS_pept        complement(373295..374449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0362"
FT                   /product="Protein of unknown function DUF70"
FT                   /note="PFAM: Protein of unknown function DUF70; KEGG:
FT                   mmp:MMP1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65431"
FT                   /db_xref="GOA:A6VG55"
FT                   /db_xref="InterPro:IPR002760"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG55"
FT                   /protein_id="ABR65431.1"
FT                   /translation="MLKNNFEKCKNYFAEKYGLGLDNPITIIFLGHALIFLFAIPYFDK
FT                   FGIDSLLKMILVVFGNLAIFSIPFFINFEKMLKLDKLNLKLVSGILFGLSMFFGIFILS
FT                   ANILNSIIFSGLIFLILHVFMKYYYSEKISKIMFSIGVISFFAMILIHGTVPITDYTVR
FT                   MAISNDPLRLISSGALIFASLFNFGYFLVSFAILAVTGYKANVLVLIVAYLLYNYKKNK
FT                   IGAKKIFLVGIFTILFLGIMAKSILSSSGQSWSLNFLEILSYRAYFDLMTLEKIILYPA
FT                   ALYGKIAFTPGGESLIGEIIHGYRHNITSTMFGPIYLDLGYYSLIFSLIFGIISKLIYK
FT                   KSDTKIYSIYGAVLLSMCEIGINYGFLVTMLTFLYVSENLQKKP"
FT   gene            complement(374436..375509)
FT                   /locus_tag="MmarC7_0363"
FT   CDS_pept        complement(374436..375509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0363"
FT                   /product="Protein of unknown function DUF70"
FT                   /note="PFAM: Protein of unknown function DUF70; KEGG:
FT                   mmp:MMP1111 periplasmic ModA molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65432"
FT                   /db_xref="GOA:A6VG56"
FT                   /db_xref="InterPro:IPR002760"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG56"
FT                   /protein_id="ABR65432.1"
FT                   /translation="MKKFLELNSQKIGPHHIFVGLSCLFVLLSNVSTISACIVLFSSVF
FT                   FYISFIAGKNIFKTLDFKPYELNYKLHEKIGLFLILFGIFFTIMDLLWVRGVPLFDPAS
FT                   RKFLSVIYTAFSHTLPLGWAILVSSSKLNNKKIFLYSGLFSALIMLLGYRTQVVVLLLS
FT                   TIFAMYYSGKIKNKLMIYSLIGLAMVVFGLSFLRHYVLNIGGNPLLSRIDLTMSIFDLI
FT                   VKNFNGNFQGVIHNAIFSSYGLIEGSKYGPRTLIANSIGVTGVTITPTIFGAVLMDFGM
FT                   LGLVPYFGIFGLLMGLSNEVSSKLKGLYLGFYSIMVSYLIVGIETGILDLDVVVMYTLG
FT                   VIMTVYGIFRGILNAKK"
FT   gene            complement(375514..376269)
FT                   /locus_tag="MmarC7_0364"
FT   CDS_pept        complement(375514..376269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65433"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG57"
FT                   /protein_id="ABR65433.1"
FT                   /translation="MKKIGILEFLVLISVLVTALAIGYNFLSPTSAEYTFDGEEMYKCA
FT                   WISENIMLKGFPLYADIDGKWTADGLEFSDRVQILAASGGTLTVAYENKEMTIGGKLAS
FT                   KEDIAASKIYLVPLGNTIIRYNLESINGTSFSEISDIIYTDIGDDLTVLEVDVDGSFAI
FT                   DSDTFSPTEQLEVINYFKYETALPKISFVDGGLILKGTFNLEDLKNLDSLLNPQKIVTS
FT                   DMEVNIIVEESSNEINTENYNNAKLITWM"
FT   sig_peptide     complement(376171..376269)
FT                   /locus_tag="MmarC7_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.275 at
FT                   residue 33"
FT   gene            complement(376332..377270)
FT                   /locus_tag="MmarC7_0365"
FT   CDS_pept        complement(376332..377270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0365"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: mmp:MMP1113 transketoloase, C
FT                   terminal half"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65434"
FT                   /db_xref="GOA:A6VG58"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG58"
FT                   /protein_id="ABR65434.1"
FT                   /translation="MKGTKKGMRDAYGETLAELGELNKNIVVLDADLSGSTKTSVFAKK
FT                   YPERFFNAGIAEQNMMGMAAGLSRTGKTVFASTFAMFATGRAWEQIRNSIAYPGLNVKI
FT                   CATHSGITVGEDGASHEMTEDIAIMRSIPKMIVISPSDYLETKSAIRWASNYEGPVYVR
FT                   MPRGNTEIIFENEEEAKFEFGKARILKEGTDITLIATGELVPEAINASKILLEKGISVE
FT                   VIAISTIKPIDKDAIKNSKDFIVSIEDHSIVAGLGGAISEVIAEDGLNKKLLRIGINDE
FT                   FGKSGKAGDLLKYYKLDSESIAETVLNAYKK"
FT   gene            complement(377331..377990)
FT                   /locus_tag="MmarC7_0366"
FT   CDS_pept        complement(377331..377990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0366"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   mmp:MMP1114 pentose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65435"
FT                   /db_xref="GOA:A6VG59"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG59"
FT                   /protein_id="ABR65435.1"
FT                   /translation="MVMIGASILSADYGHMEQEVKKAEEGNVDFFHVDIMDGHFVPNLS
FT                   MGLRVPHYLKSITDVPIDVHLMVENPDLFIPKLADAADIIAFHAESSKYLFRTVDMIKE
FT                   HGAKPIVALNPSTPINNVEYVLENLYGVLIMTVEPGFSGQSFINPMLKKIDNLKNKILA
FT                   EGYDTKIFVDGGINLETAPKAVEAGADALIAASAIYGKEDVKKAVDDLRNSANFKI"
FT   gene            complement(378006..378833)
FT                   /locus_tag="MmarC7_0367"
FT   CDS_pept        complement(378006..378833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0367"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   mmp:MMP1115 transketolase, N terminal half"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65436"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG60"
FT                   /protein_id="ABR65436.1"
FT                   /translation="MKNTKNLTFEELAVKSKSLRYNIVKMIGLAESGHPGGSLSAIDII
FT                   TALYYNIMGYDPKNPNLDSRDRFILSKGHACPALYATLADLGYFKEEELWNLRQLGALL
FT                   QGHPTIEIPGIEVNTGSLGQGFSSSVGVAIGCKLNKYENNVFVLLGDGECQEGQVWEAA
FT                   MAAAHYKLDNLIGFVDRNKLQIDGCTEDVMCLADLKAKFAGFGFDVFEIEGHNYEEIIK
FT                   TAELAKSMKNGKPKMIIANTIKGKGVSFMENNVGFHGKAPNKEELEKALTELQ"
FT   gene            379164..380216
FT                   /locus_tag="MmarC7_0368"
FT   CDS_pept        379164..380216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0368"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; peptidase M20;
FT                   peptidase M42 family protein; KEGG: mmp:MMP1116
FT                   endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65437"
FT                   /db_xref="GOA:A6VG61"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG61"
FT                   /protein_id="ABR65437.1"
FT                   /translation="MSTLDYLKILATEKGISGREDNVREYMKKELEKYCDSIETDKFGN
FT                   LIAKKGSTGPKIMIASHMDEIGLMVKFIDDKGFLKFTKIGGINDQMLLNQKVIVHSNEG
FT                   DIVGVLGSKPPHKMKENERNKLISAEHMFIDIGAKNKEDAEKMGVEIGTAISFKSEFDN
FT                   LGGNVVSCKSFDNRAGCAVVLKTMELIKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGIN
FT                   PDVAFALDVTICGDHPGIKLEDAPVELGKGPVATIVDASGRGIITHPTVLKMVRDVTKE
FT                   NEIPVQYEVGEGGTTDATAIHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVV
FT                   ACIKKVHEYF"
FT   gene            380297..380788
FT                   /locus_tag="MmarC7_0369"
FT   CDS_pept        380297..380788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0369"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mmp:MMP1117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65438"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG62"
FT                   /protein_id="ABR65438.1"
FT                   /translation="MKLDIKKDLKNIAWHCMMCGGCCDSPSVSKKDVANIAGFLKIPFD
FT                   EVVKKYLVNFDGMTGRLKTSKEKCIFLDENNKCKIYRVRPIICRLRPYSVQIKDKNLVL
FT                   TYDGWFLENCKGQFIGDLNPDEEYYKHAETVLKYLGEEKNTPEELFEKAKKRLKKSKKN
FT                   "
FT   gene            complement(380800..381096)
FT                   /locus_tag="MmarC7_0370"
FT   CDS_pept        complement(380800..381096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65439"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG63"
FT                   /protein_id="ABR65439.1"
FT                   /translation="MECPICGGEKCIRMSAVQIYKDLIELFFKYQDKESDVTFKKHPTV
FT                   GEIGECEKTGKKLWYCPYCDKPFAENYELEKVTVECPNCKKTLCIPVSNRTFC"
FT   gene            381233..382177
FT                   /locus_tag="MmarC7_0371"
FT   CDS_pept        381233..382177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65440"
FT                   /db_xref="GOA:A6VG64"
FT                   /db_xref="InterPro:IPR032713"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG64"
FT                   /protein_id="ABR65440.1"
FT                   /translation="MKSIILGILSSLFFASTFVLNRQMDLFGGDWVFSASLRYIFTLPI
FT                   LLILLYGRNNIKKVISEIKNNFKEWFIWSNVGFVLFYAPLTFAGDYGPSWLIAGTWQIT
FT                   IIAGILVTPLFYSMVENNGNLEKVKNKIPKKSLFISAIILFGIILMQYSRITSVSIESI
FT                   IFGFLPVIVAAFSYPLGNRKTMEISGGKLTTFQRILGMTLCSMPAWILLLIYGLLRSGI
FT                   PNNNQIIQSFIVALFSGIIATWLFFKATDLVRKDMKKLAAVESTQSGEIVFSVLGEIIL
FT                   LGGAFPDISAIFGLLVVISGMIIHSIHSVRINS"
FT   sig_peptide     381233..381298
FT                   /locus_tag="MmarC7_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.745 at
FT                   residue 22"
FT   gene            382304..384148
FT                   /locus_tag="MmarC7_0372"
FT   CDS_pept        382304..384148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0372"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mmp:MMP1120 ATP-binding
FT                   protein, ATPase-like:histidine kinase, HAMP
FT                   region:histidine kinase A, N-terminal:bacterial sensor
FT                   protein C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65441"
FT                   /db_xref="GOA:A6VG65"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG65"
FT                   /protein_id="ABR65441.1"
FT                   /translation="MRKSRIGMIGTKLLIYSIIIVLIPTIMLSYVSTDTISDLMISNQN
FT                   KDLDRNMGILTERMDSVLIEFDTMTSYTAQLPVVINAVKNKDEKTLQDFANGLEDQSWV
FT                   DLVVFTDAEGNVICASYGDTNAEISSYVKKLLGKNTLYAYDVLPNEEASKYSDYELDGY
FT                   DALAIFTVAPVHDGESLIGTVTYVDIMNKDDYWVDRVKEVTGDDASIYLKNVRISTTSQ
FT                   MDGVDGYGMPASEGIFETISKKQDYIGDISINGVLYLGEYSPIYNIDGEVIGMTAVGTP
FT                   QTPFMALLNSTIQKIFFIAATSLLIAVLVAIILNRKIIVPIKKLKNSAEIFGHGKYDER
FT                   VHIETGDEIEELAESFNSMAEEISRSDQKLKKDANDLKHSYDELKEVDDLKSELISIVS
FT                   HELRTPLTSILGYIQLLKDETAGKLNEKQKEFVSVISENSERLKRITDNMSDLVSVDDD
FT                   VLDGEFNKLNIKNAVEEIISSLQHFADSRNIILLEDVDDSYIKGDKSKIHQVLANLIEN
FT                   AVKFSKKQTKVTVTGFEDNGNIHLEITDQGPGIPKEHLDKIFDRFYQIDSSSKREIGGS
FT                   GLGLAVCKKIVESHGGSIWVESKIGKGTIVHVLFPLVK"
FT   gene            complement(384189..384752)
FT                   /locus_tag="MmarC7_0373"
FT   CDS_pept        complement(384189..384752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0373"
FT                   /product="metal dependent phophohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; KEGG:
FT                   mmp:MMP1121 metal-dependent phophohydrolase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65442"
FT                   /db_xref="GOA:A6VG66"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG66"
FT                   /protein_id="ABR65442.1"
FT                   /translation="MIPDGKKALDLLNFYVKEQSNLDHNLIVGYGMLGIAKYLEKDETE
FT                   QNCWFVTGVLHDIDIEEYGCDIEKHCILGEEILKKEGISKDLIEDIKSHNDVLNIERNS
FT                   EIRHALWAVDALSGIIRAYVLMRPDKDVKKAELKSIKKKLKDKSFAQNVSREQIESCEE
FT                   NLKITLDDFVNSVLKEVKENISFN"
FT   gene            complement(384795..385973)
FT                   /locus_tag="MmarC7_0374"
FT   CDS_pept        complement(384795..385973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0374"
FT                   /product="GTPase-like protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; TGS domain
FT                   protein; GTPase of unknown function-like; KEGG: mmp:MMP1122
FT                   GTP1/OBG family:ATP/GTP-binding site motif A (P-loop):TGS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65443"
FT                   /db_xref="GOA:A6VG67"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG67"
FT                   /protein_id="ABR65443.1"
FT                   /translation="MAILGLVGKPNVGKSTTFNAMTEKIADIGNYPFTTINPNIGTSFV
FT                   TKPCPCDTLDLKCTPNNSKCFAGMRYIPVEVIDVAGLVPDAHKGKGMGNKFLDDLRQAD
FT                   AFILVVDASGKTDLEGNPSENNNPVDDVKFLLNELDMWIYSILTKNWERLSRKAQQEKN
FT                   LLKALSEQLSGLNISENQVFAVIKEFDESPMKWSEDDLLKISTNLRKASKPMIISANKA
FT                   DHPDAEKNIELLKEEFKDFLVIPTSAEIELALKKAQKAGLIKYDGKSMEILDESSLNNA
FT                   QKNALNYMKSYLDKFGGTGIQDLINVAYFDLLNMIVVYPVEDEGKFCDKKGNVLPDAYL
FT                   VKKGATAKDLAFKIHTEIGQKFIYAVDAKKKLRISADQELNDGDIIKIVSAA"
FT   gene            complement(386001..387317)
FT                   /locus_tag="MmarC7_0375"
FT   CDS_pept        complement(386001..387317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0375"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1123 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65444"
FT                   /db_xref="GOA:A6VG68"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG68"
FT                   /protein_id="ABR65444.1"
FT                   /translation="MAIKNVSIVYPNKFGGGIACLAVHVLNSHLNKYHDISANAYFIEN
FT                   YSKIKNNDAILITLQYENDYFNVVKIVNELKVQNPNAIFIAGGPCAISNPLPLYEFFDA
FT                   FVIGEIEGTDTMYQLINGNFEIPGVFVPKSYNNEKIKRIYPKKLGIDNYPISQVTHESG
FT                   AYGKAYLLEIGRGCIRNCKFCMAKCIYAPPRYRKIEDLKYLVDEGLKNTDADKVSLIAP
FT                   SVSDYRYVLDLCQHISEKNMMISPSSLRADTITDELLEFLNLKTLTIAPEAGSEFLRKK
FT                   IDKGITEENILNAVDIAKNHGISTVKLYYMVGFPEETDEDIEEIINLTKKIKDNVRKVD
FT                   VSINPMIPKPHTPFESFEFDMGSKTKIKYIEKSLRKIKVSVDFEKFNSMVAQTVLARGG
FT                   VELSKVLNESKNTMELIKNVDLDNYIDKIEEKPWDFIEI"
FT   gene            387651..388598
FT                   /locus_tag="MmarC7_0376"
FT   CDS_pept        387651..388598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0376"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   mmp:MMP1124 AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65445"
FT                   /db_xref="GOA:A6VG69"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG69"
FT                   /protein_id="ABR65445.1"
FT                   /translation="MNELDIIKIISKNLSYSDGVEKGIGDDCAVFKFENQHLVVTTDMM
FT                   FKSTHFPDILTPFQIGMRLVTANVSDIAAMCAKPLGMVISMGFDSPDKKFIDELSKGID
FT                   YISKEYECPIAGGDTNKAPELTLSGTAFGITDNPIYRGGIIGEDICITGDVGKVACALK
FT                   ILEMKDNGILGNFEFKKTISEFPKIIEKLAEPRARVKEGLLLNKIITSCCDISDGLSKD
FT                   LNYTGNFEINSKKLLNSVSTDVVEFCEKFDMDLLNTVLNSGEEFELLFTTADFKRAGEK
FT                   LQDVNSVTKIGKVEESGKTVDGNSIKSEGYVHKW"
FT   gene            388592..389107
FT                   /locus_tag="MmarC7_0377"
FT   CDS_pept        388592..389107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65446"
FT                   /db_xref="GOA:A6VG70"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="InterPro:IPR026485"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG70"
FT                   /protein_id="ABR65446.1"
FT                   /translation="MVKWKTMNKKAKNLILDIIKFFIYSSIFYAILYQFKSFLIDIVTY
FT                   QSYLMLKIVLSDVTRLDNTISISNITFLVEEPCTGIMTIALILGFVATVSKNLKEYIFG
FT                   SVFCALLIYIGNIIRIIIIAVFTNNFGNGEYVHDNVSFIIIPLSIFVTILIWYKIREKL
FT                   FIDIKLDG"
FT   gene            389145..389942
FT                   /locus_tag="MmarC7_0378"
FT   CDS_pept        389145..389942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0378"
FT                   /product="putative RNA methylase, NOL1/NOP2/sun family"
FT                   /note="TIGRFAM: putative RNA methylase, NOL1/NOP2/sun
FT                   family; PFAM: Fmu (Sun) domain protein; KEGG: mmp:MMP1126
FT                   putative proliferating-cell nucleolar antigen"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65447"
FT                   /db_xref="GOA:A6VG71"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG71"
FT                   /protein_id="ABR65447.1"
FT                   /translation="MENLQFIRTNTLKISSEDLKKRLEEKGVVLEDTFLDYVFRVVKSP
FT                   FSMGSTPEYLLGYYFLQSISSIIPSITLNPSKDDDVLDMCAAPGGKTTHLAQLMENEGS
FT                   ILAVEINKNRLKSLRSNINRMGFKNTLMINTNAVNLDKKLRFDKILLDAPCTGNEIKDS
FT                   NRVKTKRDILFCAKRQVELFRTAIEVLKDGGELVYSTCSPEIEEDEDIVRYILKNNKNI
FT                   ELIELNVDDFLGINMIEGEVKGTLKVIPPNEPFFIAKFRKVKN"
FT   gene            389994..392135
FT                   /locus_tag="MmarC7_0379"
FT   CDS_pept        389994..392135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0379"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: mmp:MMP1127
FT                   RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65448"
FT                   /db_xref="GOA:A6VG72"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG72"
FT                   /protein_id="ABR65448.1"
FT                   /translation="MDIFQKLQKEFNLKIFQVENTVKLIDEGNTIPFISRYRKEATGSL
FT                   DDVVLRKFFDRLNYLRNLEDKKAQIIKLIDEQGKLTEELKQKIEKSELLTELEDIYRPF
FT                   RPKRKTRATIAESKGLKPLSELILKQILEKPIEELAKEYINPELEVNSIEDAISGAKDI
FT                   IAEEISDNADYRKFIRETTFSEGIISVKAKNVDEKSVYEMYYEYSEAVHKIPGHRILAI
FT                   NRGESEKVLQVKIDAPVEFIQDRIFKNIILENSKTSEILKETVIDSYKRLIAPSIEREI
FT                   RNSLTEKAENGAIEVFSKNLKQLLLQPPIKNKTVLGWDPAFRTGCKIAVVDETGKVLDK
FT                   TVVYPTEPHNKIAETKKQVKELIIKHDIDVVAIGNGTASRESEHIVSEILKEVVKDVYY
FT                   VIVNEAGASVYSASELGSDEFPEYDVGIRSAVSIARRLQDPLAELVKIDPKSIGVGQYQ
FT                   HDMNQKKLSESLTGVVESSVNSVGVDLNTASVSLLNYVSGINIGIAKNIVEYRLENGKF
FT                   ESRKELLKVNKLGKKAFEQCAGFLRIPEGKNLFDNTGVHPESYKITENLLNELNISIKD
FT                   IKEKKVDKISEKVDIEKLAEKLNCGVPTLEDIIKELEKPGRDPREDLPKPVLRSDVLEL
FT                   EDLKEGMILKGTVRNIVDFGAFIDIGVHHDGLAHISEISDRFIKHPLDVISVGDIVDVM
FT                   VMDIDFDKKRVSLSIKRAK"
FT   gene            complement(392179..392778)
FT                   /locus_tag="MmarC7_0380"
FT   CDS_pept        complement(392179..392778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0380"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mmp:MMP1128 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65449"
FT                   /db_xref="GOA:A6VG73"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG73"
FT                   /protein_id="ABR65449.1"
FT                   /translation="MDFKNVIFIILTSIVLLTSFAGCTENSTNSDETGKIVYATIQTNY
FT                   GNMTFELYPDKAPITVENFKTYAESGFYEGTIFHRVISDFMVQGGGFTVNGTKKETLDP
FT                   IKNEADNGLSNKRGTIAMARTSVVDSATSQFFINTVDNSFLDYQDDSNYGYAVFGKMID
FT                   GFDVLDEIESVETANNGQYQNWPVEDVIIEKVIIEE"
FT   sig_peptide     complement(392704..392778)
FT                   /locus_tag="MmarC7_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.507 at
FT                   residue 25"
FT   gene            complement(392820..393308)
FT                   /locus_tag="MmarC7_0381"
FT   CDS_pept        complement(392820..393308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0381"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mmp:MMP1129 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65450"
FT                   /db_xref="GOA:A6VG74"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG74"
FT                   /protein_id="ABR65450.1"
FT                   /translation="MIATIQTTLGTMKIELFEEKAPITVENFKKYAETGFFEGTIFHRV
FT                   IKGFMIQGGGFTKDGIQKETFAPIKNEAKNGLSNKRGTIAMARTNVVDSATSQFFINTV
FT                   DNMFLNYQNDSNYGYAVFGEMTEGFEVLDKIAAVKTGNRGYFADWPVEDVIIEKVTIE"
FT   gene            complement(393417..393815)
FT                   /locus_tag="MmarC7_0382"
FT   CDS_pept        complement(393417..393815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0382"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   mmp:MMP1130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65451"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG75"
FT                   /protein_id="ABR65451.1"
FT                   /translation="MFFEYSVKTDGRESLVDISDNILDAVQNSKVQSGIAIVFTPHTTS
FT                   AITINENADPSVKKDIIKFLHEKIPENYGFSHNEGNSDAHLKSSFFGPSLTLIINNGKV
FT                   ILGTWQGVYFCEFDGPRSRKFYVKIMKD"
FT   gene            complement(393880..395139)
FT                   /locus_tag="MmarC7_0383"
FT   CDS_pept        complement(393880..395139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0383"
FT                   /product="peptide chain release factor eRF/aRF, subunit 1"
FT                   /note="TIGRFAM: peptide chain release factor eRF/aRF,
FT                   subunit 1; PFAM: eRF1 domain 1; eRF1 domain 2 protein; eRF1
FT                   domain 3 protein; KEGG: mmp:MMP1131 peptide chain release
FT                   factor aRF, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65452"
FT                   /db_xref="GOA:A6VG76"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG76"
FT                   /protein_id="ABR65452.1"
FT                   /translation="MSGNSSTDMYLFKKSLRELKGKKGKGTELISVYVPAGRRLSDISQ
FT                   YLRQELSQSSNIKSKTTMKNVQSAIEVILQRLKLLKEPLEMGVIIFAGMIPRGGPGTEK
FT                   MEVYVLEPPEPVKTFVYRCDSLFYTDPLEDFIQDTEVYGVILVDRNEATIGTVKGKTIT
FT                   VLKKLTSGVPGKFKAGGQSARRLERLIDDAAHQFMVRIGEYATESFMPILEEKKLKGLL
FT                   LGGPGNTKNEFAEKDYLHHELKKKIIDTFDLCYTEEFGIRELLEKASDLLRDLDLMKEK
FT                   NLIQRFFKELIKDDGGLSAYGEAQVMKYLGMGAIDTLIVTEDIGITRVTVKCNNCDYTQ
FT                   EVNVKTNEMFKFEDQLKTKACPTCGGAMYIDEEKDIIEYLSELCNVHNTDIIVVSTDTE
FT                   EGSQISRAFKGMAAILRYKL"
FT   gene            395329..395859
FT                   /locus_tag="MmarC7_0384"
FT   CDS_pept        395329..395859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0384"
FT                   /product="tRNA intron endonuclease"
FT                   /EC_number="3.1.27.9"
FT                   /note="TIGRFAM: tRNA intron endonuclease; PFAM: tRNA intron
FT                   endonuclease, catalytic-like; tRNA intron endonuclease
FT                   domain protein; KEGG: mmp:MMP1132 tRNA splicing
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65453"
FT                   /db_xref="GOA:A6VG77"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016442"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG77"
FT                   /protein_id="ABR65453.1"
FT                   /translation="MAKPKKTIPAKLSDERIVIYDKDGISRLNEKRYGELHENFLSLSF
FT                   VEGLYLVSKNWISLRDKTNKLLSFEELFDVAQNIDRKLCIRYLAYKDLRNRGYTVRTGL
FT                   KYGSDFRLYERSNIDEIHSRYLVKVFSEEIPCEISEITGFVRVAHSVRKELIIAIVDAD
FT                   GSVVYYNMGYLKL"
FT   gene            395878..396921
FT                   /locus_tag="MmarC7_0385"
FT   CDS_pept        395878..396921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0385"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   mmp:MMP1133 L-sulfolactate
FT                   dehydrogenase/(S)-hydroxyglutaric acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65454"
FT                   /db_xref="GOA:A6VG78"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG78"
FT                   /protein_id="ABR65454.1"
FT                   /translation="MAHIITPEGENKLLADILMAYGVKKEHAEITAEIYTEADLKGFTS
FT                   HGIGRFPQTIIGLETENIKINPNIKIERESPATATMNGDLALGYVTAAMAMDLAVEKAK
FT                   NVGIGAVATYNSNHFGITGHYSERASKKGMIGIAITNTEPAMAPYGGKDKILGTNPIAI
FT                   ALEGKKHKYSLDMATASVARGKIFEAKRLGKTLPENAAVDINGNITTDPDQALEGSILP
FT                   FGGIKGYGIAMAVEILSAIGGAELGTNVKGTARADEKCTKGDFFIAINPEFFGEKSEFL
FT                   DKTDFLVDEIKNSNLSEGSSEILIPGDVEARTSESKKNGFEIDEILFKKLKNICDKKGI
FT                   IIEKYLK"
FT   gene            397044..398267
FT                   /locus_tag="MmarC7_0386"
FT   CDS_pept        397044..398267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0386"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: mmp:MMP1134 type A
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65455"
FT                   /db_xref="GOA:A6VG79"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG79"
FT                   /protein_id="ABR65455.1"
FT                   /translation="MKADAVKISEGVYWVGTYDWDIRSYHGYTLKGTTYNAYLVFGDEK
FT                   VALIDNVYPGTSAQMWGRIKNAFEKEGKPLNIDVVVQNHVEKDHSGALVEITKKFPNAP
FT                   IYCTEVAVEGLKKHYTGLKDAPFKVIKSLESIDLGGKTLTFLEAPLLHWPDSMFTFYAE
FT                   EGILFSNDAFGQHLCITKRFDNEIPENILMDANQKFYANLITPLSKLVLKKFKQVSSLG
FT                   LLEKIKTIAPSHGQIWTDPMKVISSYQNFATGQCKDKATIVYDTMHYSTQKMAHAFAEG
FT                   LMSEGIEVVIYNLHVDERSEIVKDMLDSKAVLFGIPTINDQPYPSIGDLMYYLRGLRFD
FT                   RTGFKKLALTFGSMGGRGGAIEKIANELRNSGFDVVNEYELYYVPNEDELEKCYSLGNE
FT                   LGKRIKSI"
FT   gene            398622..399041
FT                   /locus_tag="MmarC7_0387"
FT   CDS_pept        398622..399041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0387"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: mmp:MMP1136 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65456"
FT                   /db_xref="GOA:A6VG80"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG80"
FT                   /protein_id="ABR65456.1"
FT                   /translation="MELVNEHKIGISKGTALEKEVGGNVKGECMEVGMYLAMARQAQRE
FT                   GLPEIAEVLKSIAFEEAEHASKFVEMNGVIKATLKENLEMMFEGETMANNEKKAAADLA
FT                   EKEGLEHIHDFFEESSRDEARHAKMLKGILDRYFK"
FT   gene            complement(399182..399604)
FT                   /locus_tag="MmarC7_0388"
FT   CDS_pept        complement(399182..399604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0388"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   mmp:MMP1137 Lrp-like transcriptional regulatory proteins,
FT                   AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65457"
FT                   /db_xref="GOA:A6VG81"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG81"
FT                   /protein_id="ABR65457.1"
FT                   /translation="MDEKDMKILDFLILDGRKPFTEIAKELKTSESSVRKRVKKMEEEG
FT                   VIKGYSVMVDTPKMGYNVVAQTGFDTNPEDFLAVAQELCKFEEVKKVFTSTGDHMIMTE
FT                   IWAKDGKELSEIIFNKIGKIKGIKKVCPAIILEQLK"
FT   gene            399814..400614
FT                   /locus_tag="MmarC7_0389"
FT   CDS_pept        399814..400614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0389"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="PFAM: hydroxyethylthiazole kinase; KEGG: mmp:MMP1138
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65458"
FT                   /db_xref="GOA:A6VG82"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG82"
FT                   /protein_id="ABR65458.1"
FT                   /translation="MDFVAKNLTKLRETNPLVQNITNYVVMNSTANSLLALGASPVMAH
FT                   AMDELEEMVSIASSLVVNIGTLDEYWIPSMEKAAKIATDLKKPIILDPVGAGATKLRTK
FT                   TALKILDFADISVLRGNFGEIAAVLGEHGKTRGVDSVAYDSNEAIELSKNAAKEFNTVS
FT                   AVTGPIDYVSNGKELYAISNGHPMLSKVTGTGCASTSIIGAFSAVDEPLKAAVSGLTVY
FT                   GISAEMAFAEAPYPGTFQAKVYDWLYRIDEKLVLEKAKVNKFEI"
FT   sig_peptide     399814..399954
FT                   /locus_tag="MmarC7_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.506 at
FT                   residue 47"
FT   gene            400604..401227
FT                   /locus_tag="MmarC7_0390"
FT   CDS_pept        400604..401227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0390"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase; KEGG: mmp:MMP1139
FT                   thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65459"
FT                   /db_xref="GOA:A6VG83"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG83"
FT                   /protein_id="ABR65459.1"
FT                   /translation="MKFKDKLKFYVITDNNYSNEVVSVEEALKGGASSIQLRMKNSTTR
FT                   EMIEVGNELRKLTLEYDALFFVNDRLDVAQVVNADGIHVGIDDMPVSKIKEIAPNLIIG
FT                   ASAYNMEEMKTAESEGADYLGVGAVYSTNTKLDARNLGIDGLKSISKLSKLPIVAIGGI
FT                   NHSNVQNVLECGVSGVAVVSAIVGAENILKSAENMNELIKKYIK"
FT   gene            401404..401649
FT                   /locus_tag="MmarC7_0391"
FT   CDS_pept        401404..401649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0391"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1140 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65460"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG84"
FT                   /protein_id="ABR65460.1"
FT                   /translation="MTVEIIVDKEKCTGCGKCYNKCPKGPRIYKQDQDGKYYAFDVSDC
FT                   HNCKICVAACPVGAIQVNLKKRIIEKQINKLKEKFH"
FT   gene            401853..404477
FT                   /locus_tag="MmarC7_0392"
FT   CDS_pept        401853..404477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0392"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases; KEGG: mmp:MMP1141 Lhr-like RNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65461"
FT                   /db_xref="GOA:A6VG85"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG85"
FT                   /protein_id="ABR65461.1"
FT                   /translation="MKNDGEILDLFEPAVKKWWVNKFEAYKSINNGYFTPPQRLAIPKI
FT                   HFGRNTLICSPTGSGKTLSSFIAIINELFRIEKEEGLQNSIYCLYISPLKSLANDIHVN
FT                   LDEPLSEVKEILKEEGSEITGIRHAIRHGDTSNYEKSKMLKNTPHILNTTPETLAIILN
FT                   SPKFKEKLKTVRWVIIDEIHALADNKRGVHLSISLERLRELTNQEFLRIGCSATVEPLE
FT                   MVAEYLGGYYDDGYNRPVEIVDTRFVRGYDLKLLCPVEDLINRTPKEISEKLYEKLDRL
FT                   IQTHENTLIFTNTRGGAERVLYNLRKRYPGKYDETNSGCHHGSLSKEKRHELEEKLKTG
FT                   SLKFATTSSSLELGIDMPYIDLVVQIGSPKSVKTMLQRIGRAGHGIGKVAKGRIIALDR
FT                   DELLECAVMLKKAMDGFIDKVHIPKGPLDVLIQHIYGIAINGYIELERVKNIIRRSYNY
FT                   HEITDEEFDILLNYLTASYAGMDEKRIYSKIWYDPDTKMIGKTGKTARAIYYMNIGTIP
FT                   DDFSCDVYLRGTTVWVGKLDEQYLDRLEKGDVFTLGGEHLKFQYRRGSKVYVDKTSERP
FT                   NIPSWYSERLPLSYDLGRNILLFKKEAVSKYNAGRLLDLLSEYPLDSNATKSLYGLFNQ
FT                   QILYKGNDSVSTLNKMVVEGHIFDKKMHYYFHSNYGRKFNDGFSRAVAYALSKQYKLGV
FT                   LVSISDNGFSLEFAKNQRIDIESVVKSLTPENIKDILKQALDGTNLLKRMFRINATRSL
FT                   MILRNYIGHKKSAKKQQVSADLLINYAKSLDRFAPLEETLREIIEDSLELDNIREVLGE
FT                   IRSGKLKINIIDVPIPTPMSFGIATLNASDSVLAENKNQLLKDFHQMVIKMIEYEKGIS
FT                   LED"
FT   gene            404480..405190
FT                   /locus_tag="MmarC7_0393"
FT   CDS_pept        404480..405190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0393"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mmp:MMP1142
FT                   metallo-phosphoesterase:serine/threonine-specific protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65462"
FT                   /db_xref="InterPro:IPR004376"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG86"
FT                   /protein_id="ABR65462.1"
FT                   /translation="MNINGHEIQFKDNAVFLEETKTLIIADVHVGMEEFIRRTGVLFPL
FT                   NEKKELLKRIKNLIIEFKPEKLVFLGDFLHHFQKVPYKVYETVRELNSLLKNHEIIVIR
FT                   GNHDIMLEYILKENTNFKILDYLFEDKILMVHGDKKFDVDFKFNLLIMGHEHPVLEINK
FT                   QRFPSYLEIVQNDFEILVAPAFSNIASGVKINELESNFMSPYLKKVKKEEIFPIVIGEE
FT                   VLKFPDLSILEKFL"
FT   gene            complement(405242..405991)
FT                   /locus_tag="MmarC7_0394"
FT   CDS_pept        complement(405242..405991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0394"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   mmp:MMP1144 undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65463"
FT                   /db_xref="GOA:A6VG87"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG87"
FT                   /protein_id="ABR65463.1"
FT                   /translation="MEELILGIVQGLTEFLPISSSGHLAIFTAIFNSTPDVGYFAFLHL
FT                   ATFLAVLIFVKSEVFEIINGISKKDKEYINLASKLVLSTIPAVFVGLFFGDFIESVFSS
FT                   TYLIGIFLSITGILMLLSDKLNKNLKTIKSIPYFDALIVGVFQAFSVLPGISRSGTTLF
FT                   AALFLGMKKEDAVKYSFLMSLPVTFGAGILELHNVAFSTEQIFGFVISFLTGLLGLYLV
FT                   KRMVIGGKLKIFGYYCFLASFFVLTFL"
FT   gene            406143..406931
FT                   /locus_tag="MmarC7_0395"
FT   CDS_pept        406143..406931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0395"
FT                   /product="cell division ATPase MinD"
FT                   /note="TIGRFAM: cell division ATPase MinD; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; KEGG: mmp:MMP1145 septum
FT                   formation inhibitor-activating ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65464"
FT                   /db_xref="GOA:A6VG88"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG88"
FT                   /protein_id="ABR65464.1"
FT                   /translation="MIITVASGKGGVGKTTTSANLAVALSKLGKKTIVIDGDISMANLG
FT                   LIFDFEKNRPSIHEVLAEECSVRDAIYKHKTGAFVLPASLSIAGYKKSDLDLFPDVINE
FT                   IADEYDYVIIDAPAGLNKDMAIHLAIADKILLVVTPELFSIADAMKIKESSEMAGTNVM
FT                   GIVLNRTGKDFGEMGPDEIEMILEEKIVGLIPEDGNIRNATLKKMDVIQYSPRSPASKA
FT                   YTELALKVTGSYVDMDKIEEMYNESFFEKLKRSVFSKFKK"
FT   gene            complement(406982..408361)
FT                   /locus_tag="MmarC7_0396"
FT   CDS_pept        complement(406982..408361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0396"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: mmp:MMP1146
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65465"
FT                   /db_xref="GOA:A6VG89"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG89"
FT                   /protein_id="ABR65465.1"
FT                   /translation="MCGIFGIYSHEKSNIVKKVYYGLYALQHRGQEGAGIAVGNGKEIG
FT                   HYKGLGLVPEVFSNKELQNLYGHIGVGHVRYSTTGGNIIDNCQPFVVNSTFGKIAIAHN
FT                   GDIVNSKELKHELEKKGHIFVSTTDSEVIAQLLVRELLKNDDIISAITNVTQKLNGAYS
FT                   LLIIYDDTLIALRDPNGFKPLCIGKDDGAYYFSSESCALDIVDVEFERDVAPGEMVVVN
FT                   KNGINTYKLPNAKEKASTCMFEYVYFARPDSVIDGISVYAVRRNIGKILARETPEEVDI
FT                   VSPVPDSGIIFSQGYTEEAEIPYYEALIKNRYIGRTFILPTQEERDLAVRLKLNPVKHL
FT                   LKDKKVMLIDDSIVRGTTSGKIMKMVKKAGAKEVHLRIGSPRIVSPCFYGIDMATTKEL
FT                   IANSKTNEEIAEMIGADSVAYLSVEGLVEAIGRDDLCLACLNGEYPTDVSCKFECGSCK
FT                   K"
FT   gene            complement(408497..408691)
FT                   /locus_tag="MmarC7_0397"
FT   CDS_pept        complement(408497..408691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0397"
FT                   /product="Ribosomal protein L37e"
FT                   /note="PFAM: Ribosomal protein L37e; KEGG: mmp:MMP1147
FT                   ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65466"
FT                   /db_xref="GOA:A6VG90"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VG90"
FT                   /protein_id="ABR65466.1"
FT                   /translation="MTKGTPSQGKHNKGSNHIVCRRCGRRSFHVRKKVCAACGFGKSSK
FT                   IKRFAWQWKKVTGKGNRVK"
FT   gene            complement(408769..408987)
FT                   /locus_tag="MmarC7_0398"
FT   CDS_pept        complement(408769..408987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0398"
FT                   /product="Like-Sm ribonucleoprotein core"
FT                   /note="PFAM: Like-Sm ribonucleoprotein core; SMART: Like-Sm
FT                   ribonucleoprotein, eukaryotic and archaea-type, core; KEGG:
FT                   mmp:MMP1148 small nuclear ribonucleoprotein (Sm protein)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65467"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG91"
FT                   /protein_id="ABR65467.1"
FT                   /translation="MMDTQRPLDALGKSINTNVTVFLKDGKVVKGRLKAYDLHMNVALE
FT                   NAKIENDEEKEFPMLVVRGDNVLYVSL"
FT   gene            409119..410393
FT                   /locus_tag="MmarC7_0399"
FT   CDS_pept        409119..410393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0399"
FT                   /product="homoaconitate hydratase family protein"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein; KEGG: mmp:MMP1149 3-isopropylmalate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65468"
FT                   /db_xref="GOA:A6VG92"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG92"
FT                   /protein_id="ABR65468.1"
FT                   /translation="MAMTLAEKILAKASGNTQVSPGDIVMAKVETAMVHDITGPLSVNT
FT                   LKKEGISKVWDNEKIVIPFDHQIPADSINAAENHILMRNFVKEQNIKHFYDIREGVCHQ
FT                   VLPEKGHVVPGTVVVGADSHTCTYGAFGAFATGIGSTDMAAVFATGELWFKVPETLYFN
FT                   ISGELKPEVMSKDVILSIIGMVGADGATYKAAQFAGNTVDNMTIASRMSMSNMAIEMGG
FT                   KAGLIAPDDKTINYVKNAMETNNTAKPFEFILGDKNAEFEEKFEIEVDNLEPVMACPHN
FT                   VDNVKTVREVAGTPIDQVFIGSCTNGRIEDLRAALKVIEKHGGISKDIRVVVTPASRSV
FT                   MLEAIDEGLIKKFYQYGCVVTNPSCSACMGALYGLLGPGEVGIATSNRNFRGREGSLES
FT                   DVYLASPITAAACAVKGEIVDPRDL"
FT   gene            complement(410457..410819)
FT                   /locus_tag="MmarC7_0400"
FT   CDS_pept        complement(410457..410819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0400"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65469"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG93"
FT                   /protein_id="ABR65469.1"
FT                   /translation="MIVREVMNENFLKVSPSDIVGEVVQSLYKNKKTYAPVIEDEEIVG
FT                   WVTALDLLTGCKHVKTEEAMLFLDEIKTINPDEELSDELISEMIENEVFAYPVVENDKI
FT                   VGTLSSFDILKKLTVK"
FT   gene            complement(410865..411992)
FT                   /locus_tag="MmarC7_0401"
FT   CDS_pept        complement(410865..411992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0401"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: mmp:MMP1153 energy conserving hydrogenase B large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65470"
FT                   /db_xref="GOA:A6VG94"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG94"
FT                   /protein_id="ABR65470.1"
FT                   /translation="MYEGEIAIGPVHSTMLEPHRLRLFIEDEIVKDAELTIGVNHRGVE
FT                   RLMEGLPVEKACILCEKICGICSHIHLWSAARLAEIGCNIEIPERANHIRIIVEELERL
FT                   HSHTLLFGHAFEILGHETMSMRCFMLREPIMQVFFEISGSRVHYSCPIIGGIRPRCNIS
FT                   DTQIPHILEKVSKYEEGLNKFIERMLNDPMIISRVKDVGVMDRKTAAKFHAVGPTARGS
FT                   NVKSDMRKWGWVPEYDPYDFDEILFDSGDVFARLAVRFYECLESVKIIKQAVNALKDTA
FT                   DKRIYNPNYELHEFKPINCYTEAQRGEQYYSYGLDGEGLVRQAKIRTPTATNLGAMEDI
FT                   VKGYHVSDAELIIASCDPCFTCTDRLMVLKEPFKK"
FT   gene            412222..412800
FT                   /locus_tag="MmarC7_0402"
FT   CDS_pept        412222..412800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0402"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1154 heterosulfide reductase, subunit
FT                   C1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65471"
FT                   /db_xref="GOA:A6VG95"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017680"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG95"
FT                   /protein_id="ABR65471.1"
FT                   /translation="MVLKSTEFNADFPKQIIEAGEWIFGKNASSFQKCYQCGTCTGACP
FT                   SGRITPLRTRKLIRSALAGIDSILSGDDLWMCTTCYECYEKCPREVKITDIIKIIRNIA
FT                   AEKGYIAEPHRKTSLLVFKTGHAVPVNDEIKKARLAIGLTEIPPTTHKYPEALEIVRDI
FT                   MDDLNFCKKVGICRETMDLEPLNVQKSGE"
FT   gene            412813..413715
FT                   /locus_tag="MmarC7_0403"
FT   CDS_pept        412813..413715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0403"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: mmp:MMP1155
FT                   heterosulfide reductase, subunit B1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65472"
FT                   /db_xref="GOA:A6VG96"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017678"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG96"
FT                   /protein_id="ABR65472.1"
FT                   /translation="MSETDFEYMFFLGCIAPNRYPGIESATYKALDKLGMKLHPFEQAS
FT                   CCPAPGVFGSFDLMTWLTIAARNIVMAEQADLDILTICNGCYGSLFEANHILHDNESAR
FT                   NKVNEVLSKHGLEFTGKSKVRHLTEVLYFDYGPEKIAERVERPLDLNIAVHYGCHYLKP
FT                   TDVKHIESSEVPRSLDGLVEAIGAKSIYYKDKNMCCGAGGGVRARNPEVALEMAETKVK
FT                   NILEAGGDCVTEVCPFCHLQFDRGQIEMKETFGREYQLPVIHYAQLLGMAMGMTPKEVA
FT                   LDLHFISADPVTEKLGLNK"
FT   gene            413757..414071
FT                   /locus_tag="MmarC7_0404"
FT   CDS_pept        413757..414071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0404"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mmp:MMP1156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65473"
FT                   /db_xref="GOA:A6VG97"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG97"
FT                   /protein_id="ABR65473.1"
FT                   /translation="MKEGVFFGEGMKFVKEGYPDIYDAVVGLNKAAFTGKTLDYKTQKL
FT                   IAIGIVAATGDENAAEKQMRSGMVELKITKEEIIDALRVVLLTSGMPAFTKAMKVVSKL
FT                   "
FT   gene            414085..414441
FT                   /locus_tag="MmarC7_0405"
FT   CDS_pept        414085..414441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0405"
FT                   /product="Desulfoferrodoxin ferrous iron-binding region"
FT                   /note="PFAM: Desulfoferrodoxin ferrous iron-binding region;
FT                   KEGG: mmp:MMP1157 desulfoferrodoxin, ferrous iron-binding
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65474"
FT                   /db_xref="GOA:A6VG98"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG98"
FT                   /protein_id="ABR65474.1"
FT                   /translation="MGCASAQTLKEGTDFEKKHVPMIECKSTVKPDEIYEVKIHTAGVE
FT                   HPMEDGHFIQFIELNVEECPLLRVQLTQHSKPDVVVNIKAPNEEHKGHTFKLVAYMFCN
FT                   LHGLWKYEKEVKIE"
FT   gene            414462..414728
FT                   /locus_tag="MmarC7_0406"
FT   CDS_pept        414462..414728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0406"
FT                   /product="MTH865-like family protein"
FT                   /note="PFAM: MTH865-like family protein; KEGG: mmp:MMP1158
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65475"
FT                   /db_xref="InterPro:IPR024093"
FT                   /db_xref="InterPro:IPR036825"
FT                   /db_xref="UniProtKB/TrEMBL:A6VG99"
FT                   /protein_id="ABR65475.1"
FT                   /translation="MITTNHPLGEALKDIETFKLKLADYFKDKDVFPIKNKVELGSALP
FT                   CGISMPCGDLEAGELVKFLTDNDFPIKNAEDLAIKLSKSCSIQ"
FT   gene            414752..415279
FT                   /locus_tag="MmarC7_0407"
FT   CDS_pept        414752..415279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0407"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: mmp:MMP1159
FT                   ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65476"
FT                   /db_xref="GOA:A6VGA0"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA0"
FT                   /protein_id="ABR65476.1"
FT                   /translation="MDSKLRYEIEEQINKELYSAYLYLAMSNYAESEGFKGISNWFIVQ
FT                   AQEEIDHAMKFYKYIHEMGDTLQLNAIDKPEPKWNSITDVFENGLTHEKYVTSRIHKLM
FT                   DIAHEVKDYAAISMLQWFVNEQIEEESSFRDILDGLKLTGGDINYLMMLDKELGQRVKT
FT                   APESETTKAKTA"
FT   gene            415288..415476
FT                   /locus_tag="MmarC7_0408"
FT   CDS_pept        415288..415476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65477"
FT                   /db_xref="GOA:A6VGA1"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA1"
FT                   /protein_id="ABR65477.1"
FT                   /translation="MVWWKCSNCGYIFEGEAEKVPEKCPNCGEICTFYDVSCYTPECGF
FT                   EGYDPKIAGKRNEESRL"
FT   gene            415510..415860
FT                   /locus_tag="MmarC7_0409"
FT   CDS_pept        415510..415860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65478"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA2"
FT                   /protein_id="ABR65478.1"
FT                   /translation="MKACFLIFTYDKGGKPYVPIIFHALLFAKEMKEKGDDVKIVFEGE
FT                   AVKWFNEILKPDHPLKTHVEALKDNFVACEACSHMFDVFTSIKGKIAIENELHGHVSLR
FT                   KYLDNGYTVVEF"
FT   gene            415888..417051
FT                   /locus_tag="MmarC7_0410"
FT   CDS_pept        415888..417051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0410"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: mmp:MMP1162
FT                   flavodoxin:beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65479"
FT                   /db_xref="GOA:A6VGA3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA3"
FT                   /protein_id="ABR65479.1"
FT                   /translation="MAVVLKDNVYWVGAIDWNIREFHGYETKNGSSYNSYIIMDEKVVL
FT                   IDTVKKYMFDEFYNRIKKVVDPEKIDYIVVNHVEMDHSGSLEKIIEISKATIITNAKAK
FT                   EHLELHYDTKDWEYLLVDTGDSLNIGSRNLTFVKTPMLHWPDNMVTYCPEDKILFSNDA
FT                   FGQHIASSERFDFEIDYAIESAKEYFANILLPYRTLIPNAVKTVDTLELDLICPSHGII
FT                   WKEDISKIKEKYLEFASNNISEKAVIVYDTMYKSTEKIGLSIAEGLMDSNIEVKIFKIS
FT                   ETPISKIITEILDAKYVLVGSPTLNINLYPEVARFLKYMEGLKPNKKIAAAFGSYGWAE
FT                   SATKHIKNTFDILSFDTVEDECLTCRFVPDEEHLEKCHEFGKKLAKM"
FT   gene            417070..417384
FT                   /locus_tag="MmarC7_0411"
FT   CDS_pept        417070..417384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0411"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   mmp:MMP1163 CutA1 divalent ion tolerance protein related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65480"
FT                   /db_xref="GOA:A6VGA4"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA4"
FT                   /protein_id="ABR65480.1"
FT                   /translation="MGKPTLVYTTFPNLENAKSIVGYLLEKKMIACANLREHEAHYIED
FT                   GDIAIKTEVGAFLKTAENKWDVLKDMINEIHPLETPVILKINIDDSNEEFENWICDTIK
FT                   "
FT   gene            417504..417719
FT                   /locus_tag="MmarC7_0412"
FT   CDS_pept        417504..417719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0412"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: mmp:MMP1164 heavy-metal transport ATPase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65481"
FT                   /db_xref="GOA:A6VGA5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA5"
FT                   /protein_id="ABR65481.1"
FT                   /translation="MKELKLKISGMSCQMCVKTIKNLLSELEGIINIVINLQDGIGIIT
FT                   YDEKIVTEKEILKNEAFELYLAEKIS"
FT   gene            417739..419910
FT                   /locus_tag="MmarC7_0413"
FT   CDS_pept        417739..419910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0413"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: mmp:MMP1165 haloacid
FT                   dehalogenase/epoxide hydrolase:ATPase, E1-E2 type:heavy
FT                   metal transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65482"
FT                   /db_xref="GOA:A6VGA6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA6"
FT                   /protein_id="ABR65482.1"
FT                   /translation="MEVKLKISGMTCAVCVKTIEKSVSKMDGVDKIVVNLLDESAVINF
FT                   NPDIVSIEDIWIKIERFGYEVLGIAEEVEELPKKEEELKEKLGKIIFGTVFSIALFSIM
FT                   YLKIPYKPYLAFLISIPPLIYIALPIFKAGFNSLKIKSLNMDVMYSLGMGVAYISALLV
FT                   TLGILPMNFMFYDTTIMLATLLTLGRYLEERAKGRTSEAIKKLMGLQVKTAKVIKNNEE
FT                   FEIPIEDVIVGDIILIRPGEKITVDGTVFEGVSYVDESMITGEPIPIAKKKGDSVIGGT
FT                   INKNGILKITAEKIGKDTILSQIILLVKNAQLSKPDIQNLADKAVSYFIPTVFTIALIS
FT                   SVFWFFNGGILLAVTTFISVMVIACPCALGLATPTAITVGVGRGAELGILIKDSKVFDV
FT                   AGNLKCMIFDKTGTITKGKPDVDEIISDYSKEELLLIAGSLEKNSEHPLALAIVKKANE
FT                   LNISLSEPEKFESITGMGVSGILKDQKVFIGNRRLMEENNLSINEHYIVEISRLEENAK
FT                   TVIIVAIENKIMGIIAISDKIKENAKITVQNLREMGIESYMITGDNEKTAKVIGKEVGI
FT                   LENHVYSNVLPEKKAEIVKWIKENAGGYVEFIGDGINDAPALSTADVGIAVGSGTDIAI
FT                   ESGEVVLMNDDLSYVTGFVKLSKRVLKQIKLNLFWAFAYNSILIPVAAGALYSYNIKFE
FT                   PELAAFAMTLSSLTIIGLSLLLKRYDPWK"
FT   gene            420073..420666
FT                   /locus_tag="MmarC7_0414"
FT   CDS_pept        420073..420666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0414"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mmp:MMP1166 related to iron-sulfur flavoprotein of
FT                   Methanosarcina thermophila"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65483"
FT                   /db_xref="GOA:A6VGA7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA7"
FT                   /protein_id="ABR65483.1"
FT                   /translation="MKILGISGSPRKEGTHFAVNYALDYLEEKGFETKYISVFQKKIEF
FT                   CIHCDYCVRTGEGCVHKDSMQEIYDGLKWADAIILGSPCYNGTVSGQLKTIMDRCRAIF
FT                   AEDIDVVRNKYGMGLSVGGDRNGGQEIVLKTIHDFYILNGVIPISGGSFGSNLGATFWS
FT                   QDIGRKGVEEDSEGIRTLKRTLKKFYNCLSEKGD"
FT   gene            420669..421223
FT                   /locus_tag="MmarC7_0415"
FT   CDS_pept        420669..421223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0415"
FT                   /product="Archaeoflavoprotein AfpA"
FT                   /note="TIGRFAM: Archaeoflavoprotein AfpA; PFAM:
FT                   flavoprotein; KEGG: mmq:MmarC5_0420 flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65484"
FT                   /db_xref="GOA:A6VGA8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR014072"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA8"
FT                   /protein_id="ABR65484.1"
FT                   /translation="MVKVAWGITGCGDKIEEIVEMLIELKNEHADLDVDIYYSQSAEMV
FT                   LNWYKLMGKLKDTFYNIRKEVNSNAPFLPGMLQTGKYDLFLVAPVTANSVAKIAHGIAD
FT                   TLITNSVAQGAKAMVPTYIYPPDNKKEEIETILPGGKTLKLYIRDTDVENVNILRNMQG
FT                   ITVLENVDEIREALLKHIKGD"
FT   gene            421224..421970
FT                   /locus_tag="MmarC7_0416"
FT   CDS_pept        421224..421970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0416"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1168 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65485"
FT                   /db_xref="GOA:A6VGA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGA9"
FT                   /protein_id="ABR65485.1"
FT                   /translation="MLQIEDLSVKVGEKEILKDIHLFIDKGETHVLFGPNGAGKSTLLN
FT                   TILGNPKYEVIRGNIYFKGKDITDMPMHERAQLGIGISYQSPPAISGVRLETMINAISK
FT                   KSDEEMEEMAKKLNIRHFYQRDLNVGFSGGEVKRSELLQIFAQNPDLVMFDEPDSGVDV
FT                   ENVEILGGIINHLLDKDKKPSERNKSGLIITHLGYILNFMEVDKAHVLLDGVIACSGTP
FT                   DEILNEIIKNGYQRCVSCCQKKSCNK"
FT   gene            421940..423166
FT                   /locus_tag="MmarC7_0417"
FT   CDS_pept        421940..423166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0417"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: mmq:MmarC5_0418 SufBD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65486"
FT                   /db_xref="GOA:A6VGB0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB0"
FT                   /protein_id="ABR65486.1"
FT                   /translation="MLSEKKLQQVRGMAQKYKDVPAPFGEDIDLSMYPTPKENLLKVDS
FT                   LNDLSDDHKKALATVGVDIEEKNTIGSYVQVNSDAIYAKMYSDIIIMPITEALEKYELD
FT                   DYYWSAVEMSDKYGARVANELTEGYFIRAPKGVKKTIPLQTCLLIGSEEVSQNVHNIII
FT                   VEDGAELNLITGCTTSPHVKSGLHLGISEIYIGKNAKLTFTMIHNWGESVHVRPRTAIK
FT                   MDDDSIFINNYVTMMPVKSIQSYPTAYCEGKNAKATFQTIVYGKGDSKLDMGSRVILSG
FT                   ENSAADMISRVIVVDNAEVISRGHLVGAESHVKGHLECRGLILSNDGHILAVPELEAER
FT                   TDLELSHEAAVGKIAEDQIQYMMSRGLSEDEASSLIIKGFLSVDISGLPDELAKSVKEM
FT                   MDMTLENAM"
FT   gene            423311..424003
FT                   /locus_tag="MmarC7_0418"
FT   CDS_pept        423311..424003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0418"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mmq:MmarC5_0417 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65487"
FT                   /db_xref="GOA:A6VGB1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB1"
FT                   /protein_id="ABR65487.1"
FT                   /translation="MEKNDIFIVIPAYNEEKMIKNTLINLKGHGYENIIVVDDGSKDQT
FT                   SKIAVSEDIIVCKHIINRGLGGALKTGLKCAIKYNPKAIVTFDADGQHDPNDIIKVSEP
FT                   IIEDSFDVVVGSRLIDEKELKNMPFIKKIGNWGLNFITCLMGGQMVTDSQGGLRAFSYD
FT                   AAEIVSKQLKSNRYEVSSEFIVLFKKNNLKFKEVPIKTIYTEYSMARGTNVITGFKILF
FT                   KLLIQKLI"
FT   gene            424015..424629
FT                   /locus_tag="MmarC7_0419"
FT   CDS_pept        424015..424629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0419"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: mmq:MmarC5_0416
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65488"
FT                   /db_xref="GOA:A6VGB2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB2"
FT                   /protein_id="ABR65488.1"
FT                   /translation="MFKIRNIITISDYVTVINIIFGMLAILLHDFRFVYISIVFDALDG
FT                   IVARKTNTVSDFGAELDSICDVVSFGVAPAYLIYYYFDSTAVLFASIVFLIGGALRLAR
FT                   FGILDVKHFIGLPIPAAALFLCVLSQVFLKYNFRSEYLVSILAIVAGLLMISDINYPKY
FT                   PKKPFLVLFGISIILSMFGIIGPLALCALVYVLYGISKMKM"
FT   gene            complement(424699..425298)
FT                   /locus_tag="MmarC7_0420"
FT   CDS_pept        complement(424699..425298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0420"
FT                   /product="conserved protein"
FT                   /note="KEGG: mth:MTH574 conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65489"
FT                   /db_xref="GOA:A6VGB3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB3"
FT                   /protein_id="ABR65489.1"
FT                   /translation="MIFKSFLRAKFIPLPVGFISTISKDGIRNIAPYSCLMPVLRPLDL
FT                   VCLASAKKRDTLTNIKDTGEFVINMPGIDFSEKVMPTAKFSRPEVDEFVDAELEEKPSS
FT                   VVKAPGIAGSYAWMECELHKLYEEEDYVLIVGKVVNLDVDDKYLKEDGSLDVEKANPLM
FT                   NVGNAAGLNYCTVSETGKFDPISAMFPNGKDPAAKN"
FT   gene            425492..426145
FT                   /locus_tag="MmarC7_0421"
FT   CDS_pept        425492..426145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0421"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mmp:MMP1174 alkyl hydroperoxide reductase/ thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65490"
FT                   /db_xref="GOA:A6VGB4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB4"
FT                   /protein_id="ABR65490.1"
FT                   /translation="MAVIGEKFPEVEVITTHGKLKLPEHFIESGKWFVLFSHPGDFTPV
FT                   CTTEFVAFQKRYDQFRELNTELIGLSIDQVFGHIKWVEWIKEKLDVDIEFPIIADDRGA
FT                   LAELLGMISPYKGNNTVRAVFVVDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTADKG
FT                   YATPANWPNNDFLNEKVIVPPAKDMDGRKKRLDAIESGELQGYDWWFCYTDLKE"
FT   gene            426288..427373
FT                   /locus_tag="MmarC7_0422"
FT   CDS_pept        426288..427373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmq:MmarC5_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65491"
FT                   /db_xref="GOA:A6VGB5"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB5"
FT                   /protein_id="ABR65491.1"
FT                   /translation="MTTEKYQNSFPLPDESPEKIDKIMSDAYFGAQKFYLLKTALELKI
FT                   FDYLSDPKTSEELSSILDLDPVLTELMLKSLYELGIISIASKNGETHYINTNGSDNYLK
FT                   TDSKYSKAPSISASFNSMDRWVKLSEIMGSSKSEIMENVFFPEIIKRMANDAKCWELQK
FT                   TVEYVSKFSEFKSAKKLLDIAGGHGLYGISLGMLNENLDAFVFDLPEVTVETKKFIEKY
FT                   NAKNVDTVQGNFFTDEFGENYDVVFSSYNPGGKNPKVAEKVYRALNLGGIFVTKQAFPK
FT                   LSSQSTSDNLNNMEWNFSSFNATGKGLVRYTFDTDLTFEEYVSYLEELGFEILETKPVY
FT                   ELIEFSEEMFPNNIIVAKKIK"
FT   gene            427513..428595
FT                   /locus_tag="MmarC7_0423"
FT   CDS_pept        427513..428595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65492"
FT                   /db_xref="GOA:A6VGB6"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB6"
FT                   /protein_id="ABR65492.1"
FT                   /translation="MTTKNYQNSFPLPDESPEKIDKIMSETYFGAQKFYLLTTALELKI
FT                   FDYLTEAKTSEELSSILDLDPVLTELMLKSLYELGIISVASKNGKTHYINTTASDTYLK
FT                   MDSTYSKSISISASFKSIGMWVNLSEMMKSSKQNVVENVFFPELIKIMANDCKVWELQK
FT                   TVEYIYKFPEFKTAKKLLDIAGGHGLYAISLGMLNENLDGFVFDIPPVTFETKKFIEKY
FT                   NAKNVNTIPGNLFTDNIGENYDVVFNSYNPGGKNPKVAEKIYNSLNMGGLYIIKQIYQK
FT                   ETHDVEDTLNNMEWNFNSFNGNGKGTLRYTFEQDLDFEGYLSHLETLGFEILETKSVSE
FT                   ISDFDEELTPSIITVAKKIK"
FT   gene            428742..429863
FT                   /locus_tag="MmarC7_0424"
FT   CDS_pept        428742..429863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0424"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mmq:MmarC5_0411 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65493"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB7"
FT                   /protein_id="ABR65493.1"
FT                   /translation="MQKTGILAIILSLMMAIGFSGCVDNTADSSNEVAKTVEIVDMVGR
FT                   TVEVPADIQRIVCSGPGCLRLVTYLQAQDKVVGVESIEQADTSGIPYQLANVEFFQSLP
FT                   MTGAGGGKEIGVGPYPEQVISAAPEVIFITYMEADRANDLQTQYGIPVVVLTYGDVNSF
FT                   HDENFVACLNLLGTLFQKEERAQEVIDFFADAENDLLTRTENIADENKPSVYIGGLCNK
FT                   GSHGIDSTSSNYAPFAALNANNIASVLGVEKSVFISKEQLLEWNPDIIFIDTGSYELIK
FT                   EDYDKNSEYYESLGAFENGNVYTQFPYNYYTTNYGTALADAYYIGKTVYPEQFADINVE
FT                   EKADEIYEFLVGEAVYDKMAEGYCGFEKLDFSN"
FT   sig_peptide     428742..428813
FT                   /locus_tag="MmarC7_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.322 at
FT                   residue 24"
FT   gene            430038..431135
FT                   /locus_tag="MmarC7_0425"
FT   CDS_pept        430038..431135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0425"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mmp:MMP1181
FT                   iron transport system binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65494"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB8"
FT                   /protein_id="ABR65494.1"
FT                   /translation="MISLMIALSFSGCVDNTAESSGEVAKTVEIVDMVGRTVEVPADIQ
FT                   RIVCSGPGCLRLVTYLQAQDKLVGIESTEQNNISGRPYQLANVEFFQSLPMTGLGGGKE
FT                   IGVGPYPEQVICAAPEVIFITYMDADRANDLQEQYGIPVVILNYGEVNSFHDEDFVGCL
FT                   NLLGTLFQKEERTQDVIDFFADAENDLLTRTENIADEDKPSVYIGGLCAKGAHGIDSTS
FT                   SNYAPFAALNANNVASSLGIEKQLFISKEQLLEWNPDIIFIDTGSYSLIKEDYDKSSEY
FT                   YESLGAFENGKVYTQFPYNSYTTNYGTALADAYYIGKTVYPEQFSDINIEEKADEIYEF
FT                   LVGEAVYDKMTESYCGFENLDFSSQ"
FT   gene            431285..432412
FT                   /locus_tag="MmarC7_0426"
FT   CDS_pept        431285..432412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0426"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mmp:MMP1178
FT                   iron transport Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65495"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGB9"
FT                   /protein_id="ABR65495.1"
FT                   /translation="MNKKIGTLIIAFLMILTVAICGCTDSSSSATETNENTNTITVVDA
FT                   AGRTVEVPKNPEKIIALRGASREVVYLRAQDKIIGIEFREGSLKGDGIYPSAFQIPHIA
FT                   AYPELINLTVVTAGSTINFEEITKIQPDIIFMGTSGALYADDTQKKTGIPVVIVHVNAV
FT                   GTEAEHEKYYETLRLMGEILGKEERAEELISIIEEYETDLANRVADIPDEERPTVYIAG
FT                   RPYCGAHGLDGTDAQWIPFRLINANNIASGLSNISEGLTINKEQLLEWDPEYIFASEAS
FT                   MRFINNDLSDSAYQGLSAIKNGNVYGVLPYCWYSYNKDSGIADAYFIGKTIYPEQFSDI
FT                   DPEAKADEIYEKFLGKPVYSAMETQFGGYIELTNN"
FT   sig_peptide     431285..431377
FT                   /locus_tag="MmarC7_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.485 at
FT                   residue 31"
FT   gene            432523..433644
FT                   /locus_tag="MmarC7_0427"
FT   CDS_pept        432523..433644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0427"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mmp:MMP1178
FT                   iron transport Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65496"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC0"
FT                   /protein_id="ABR65496.1"
FT                   /translation="MNKKIISVILALMMSLVVAFSGCIGSSESSASEVADTIEIVDLLG
FT                   RTVEVPADVQKIVCSGPGCLRLICYLDATEYLVGIEGFENTNLIGRPYRLAHDEFSELA
FT                   VIGNGGPQDINVGPDPEKVLNVMPDVIFITYMDADKADELQEKTGIPVVVLSYGALGNF
FT                   KNDAIFDSLTLSGEILGKEERAEEVISFMTGIQDDLDERTAEIPDEEKPTIYVGAIGNK
FT                   GVHGIDSTEGAYPPFEALNTENVAKVASTEHLFLSKEQILEWDPEFIFIDEGGLSLVYE
FT                   DYEKNPEYYESLDAFKNGNVYGILPFNYYTTNLDTAMADSYYIGSILYPEAFSDVNPEA
FT                   KADEIYEFLVGEAVYYKMAENFEGFKKLDLLNQ"
FT   sig_peptide     432523..432618
FT                   /locus_tag="MmarC7_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.769 at
FT                   residue 32"
FT   gene            433780..434907
FT                   /locus_tag="MmarC7_0428"
FT   CDS_pept        433780..434907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0428"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: mmp:MMP1178
FT                   iron transport Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65497"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC1"
FT                   /protein_id="ABR65497.1"
FT                   /translation="MYKKIGTLIIASLMILTVATCGCTESTSSTTVTNEEITTITVVDA
FT                   AGRTVEVPQNPEKIIALSCALREVVYLQSQDKVVGIEFREAAKKTDGTFPSGLELPYLA
FT                   AYPELMNLTVVNAGNTVNVEEIAKLQPDVIFVGTSGAGSAEDIQAKTGIPVVIVYVATV
FT                   GTEAQNEKYYETLELMGKVLGKEDRAEELISIIKEYEADLANRVADIPDEERPTVYVAG
FT                   RPYMGVHGLDGTDPHWPSFELLNANNVASEVSDVSEGISINKEQLIEWDPEYIFASESS
FT                   MSLINDDLNDPAYQGLSAVQNGNIYGVLPYCWYSFNKETGIANAYFVGKTIYPEQFEDI
FT                   NIEEKADEIYEKFLGKPVYSVLETQFPGYTKLTNN"
FT   sig_peptide     433780..433848
FT                   /locus_tag="MmarC7_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.283 at
FT                   residue 23"
FT   gene            435014..436060
FT                   /locus_tag="MmarC7_0429"
FT   CDS_pept        435014..436060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0429"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mmp:MMP1182 iron(III) dicitrate transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65498"
FT                   /db_xref="GOA:A6VGC2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC2"
FT                   /protein_id="ABR65498.1"
FT                   /translation="MESSVNDYKKYTLKKLIFGFVLIIALIIISIYALCTGDFHLSINQ
FT                   IINALLGSGDAASNLVIWNIRLPRIFAAILCGIGLSVSGAVMQCVLRNPLASPFTMGIS
FT                   HGAMFGACVAIITLGIGGAESTGHIAINNPYSITVFAFFGSLLGVCAVLLLARLKGLSP
FT                   EAMILAGVAISSLFTAATTLIQYFADDMQLAAMVYWSFGDLGRPLWPEVKIMAFVAVVS
FT                   LIYFIHKRWDYNALESGEETAKSLGVNTDKIRLSGMLVASLVTSVCVAFLGIIGFVGLI
FT                   CPHIVRITVGGDYRYLIPLCSIFGAVLVLLADTFARTIMSPIILPVGILTSFLGAPMFL
FT                   YLLMKMYK"
FT   gene            436078..436839
FT                   /locus_tag="MmarC7_0430"
FT   CDS_pept        436078..436839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0430"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1183 iron ABC transporter ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65499"
FT                   /db_xref="GOA:A6VGC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC3"
FT                   /protein_id="ABR65499.1"
FT                   /translation="MIVSVDGVEFKYKSTEILKDVKFEVKKGEVVSILGINGAGKSTLI
FT                   KCINKILPPKKGTITIENLDVNKMDRLDLAKKVGYVPQRSNGNYMTVFDALLLGRKPHI
FT                   KWEISKKDIEITENVLKLLDLDKYALRNTNELSGGELQKVIIGRALVQEPKLILLDEPT
FT                   NNLDLKNQLEVMRILKDVSISQNITSIIVMHDINLALRYSDKFLMLKDGKIFAEGGKEI
FT                   INSQNLMEVYGVNTHIHDLNGQLTVVPGEGY"
FT   gene            complement(436840..437367)
FT                   /locus_tag="MmarC7_0431"
FT   CDS_pept        complement(436840..437367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0431"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmp:MMP1184 N-acetyltransferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65500"
FT                   /db_xref="GOA:A6VGC4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC4"
FT                   /protein_id="ABR65500.1"
FT                   /translation="MEKVVIRNARKNDINEIMNIEYDSFDEGISESRNAFLNRILTFSD
FT                   GFLVLEVNSKVSGYISSEIWEYLENIDEKMFDLDHDIKKVHNSNGSELYVSSIGVLKEH
FT                   RKKGYGNLLFTELIKRITKKYKISSMILTVSEKWNDAIKLYEKNGFKEISRIKEFFEDD
FT                   ECSDGILMRKYI"
FT   gene            437485..438024
FT                   /locus_tag="MmarC7_0432"
FT   CDS_pept        437485..438024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0432"
FT                   /product="hydrogenase maturation protease HycI"
FT                   /note="TIGRFAM: hydrogenase maturation protease;
FT                   hydrogenase maturation protease HycI; PFAM: peptidase M52
FT                   hydrogen uptake protein; KEGG: mmp:MMP1185 hydrogen uptake
FT                   protein:hydrogenase maturation protease HycI"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65501"
FT                   /db_xref="GOA:A6VGC5"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004420"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC5"
FT                   /protein_id="ABR65501.1"
FT                   /translation="METVQSTIKSFIKNSNKIAILGIGNYLKSDDGFGVYVVESLLKNY
FT                   SKTYESLSLEKEVNSVNNKLILMNCGVVPENFTDVIKKENPDKIIMIDAALMHQEPGSL
FT                   RIVESDEISETGFSTHSLPLSIIIKYINTHIDTEILIVGIEPTDLEFGVPLSGLIKEKA
FT                   DEFSKLLIEEINSFLL"
FT   gene            438037..440115
FT                   /locus_tag="MmarC7_0433"
FT   CDS_pept        438037..440115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0433"
FT                   /product="peptidase S16, Lon-like protease"
FT                   /note="TIGRFAM: peptidase S16, Lon-like protease; PFAM:
FT                   peptidase S16 lon domain protein; KEGG: mmp:MMP1186
FT                   eukaryotic thiol (cysteine) protease, active
FT                   site:ATP/GTP-binding site motif A (P-loop):sigma-54 factor
FT                   interaction domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65502"
FT                   /db_xref="GOA:A6VGC6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR004663"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC6"
FT                   /protein_id="ABR65502.1"
FT                   /translation="MFSVQFNTTDELPEPSPNLINQVIGQDDAVKIVLSAVKNKRHALL
FT                   LGDPGVGKSMMVKAFGQLLEHSSDFKPYSLIARPNMKNSEKPIIDLIEGHLIEETMQIE
FT                   SPKLMRQPPSIFTLLLGIIVSSLVLSYILNGLSDPSSKFAVIAAISVIGSLLVFLILFL
FT                   NIFGATKASMPNTVSPADIKPVVLYECKKRPLVRASAYNTTKLLGDIKHCPLGGKPPIG
FT                   TPPHKRVILGAIHEAHKGILYVDEIKTMPVDVQDYILTALQDKQLAISGRNPNSSGASV
FT                   ETNPIPCDLTLIMSGNMDDASNLRAPLLDRIDYKVVLKNKMDNNQENRDKLLQFIVQEI
FT                   KNNNLRPMTYEACCEIVKMAQLLSGSKNKLTLRLRQVSNIIKMANDIATGKELSESIEE
FT                   MSEESAPEVNVKSVEKPVEKKNTQKIMKVVGKFKPKKTEDTTPKKTVSKAPVLEKKDET
FT                   VIDLEHINEIVSTGIYSMTKQVAIDYLKNFKRYKNIVSNDVPKIGVIHGLAVLGADGLG
FT                   DVTKIITKIVKSKHPRTNLLNISGDLAKHSITLASALSKKLVSDGTLSIAKAKEELKKE
FT                   DLDLAEHDIYIQFSQSYSKIDGDSATAAACLSIISALLNIPLKQDFCITGSLDLNGEIL
FT                   AIGGVNEKINAAKEYGFKRVIIPKSNFDDVIDPERIEVIAVTRLEEIIPLAFELNNL"
FT   gene            440145..440687
FT                   /locus_tag="MmarC7_0434"
FT   CDS_pept        440145..440687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0434"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: mmp:MMP1187 class II aldolase/adducin, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65503"
FT                   /db_xref="GOA:A6VGC7"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGC7"
FT                   /protein_id="ABR65503.1"
FT                   /translation="MDLINFIKICHLLYDRKYVVGSGGNVSIRDGNHIYITPTGSILGF
FT                   LNEEDVCIVDLNGNIIKGKPTSELNMHLKIYQNKDCVNAIVHTHSMYCTAFSALDKKLE
FT                   LFTPEAEIVVKKIAYVDYSPCGSLELAENVSSCVEDSIILKNHGIVTVGKDITEAYVKT
FT                   EVLEEIAQLNYIINNLK"
FT   gene            complement(440748..441023)
FT                   /locus_tag="MmarC7_0435"
FT   CDS_pept        complement(440748..441023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0435"
FT                   /product="Protein of unknown function UPF0147"
FT                   /note="PFAM: Protein of unknown function UPF0147; KEGG:
FT                   mmp:MMP1188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65504"
FT                   /db_xref="InterPro:IPR005354"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGC8"
FT                   /protein_id="ABR65504.1"
FT                   /translation="MFSAKKLSPTDKLRNISSMLEEIVEDTTVPRNIRAAADNAKNALH
FT                   NEEQELIVRSATAIQYLDDISEDPNMPIHTRTQIWGIVSELETIKN"
FT   gene            complement(441169..441888)
FT                   /locus_tag="MmarC7_0436"
FT   CDS_pept        complement(441169..441888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0436"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase; KEGG: mmp:MMP1189 ribose 5-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65505"
FT                   /db_xref="GOA:A6VGC9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGC9"
FT                   /protein_id="ABR65505.1"
FT                   /translation="MARTKKANDEVPTDSDSLKLKVAKQAAKLVKDEMVVGLGSGSTAN
FT                   LFIQELGKRIVEEELYIYGVPTSFDSRMVASTAGIPLISLDQCGEIDLAIDGADEVCKS
FT                   TLALIKGGGGCHTMEKIVDYYAKEFIVLADEGKLVDSLGDKTPVPLEVIPFAYSTVLNK
FT                   LLKLNTAPAIRSGSGKMGPVITDSGNMIIDVFMSIEDAEETEIMLNNIPGVLENGVFSK
FT                   CDKVLVGTSKKVEILKK"
FT   gene            complement(441956..442408)
FT                   /locus_tag="MmarC7_0437"
FT   CDS_pept        complement(441956..442408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0437"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   mmp:MMP1190 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65506"
FT                   /db_xref="GOA:A6VGD0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD0"
FT                   /protein_id="ABR65506.1"
FT                   /translation="MITKGDTIKVDYTGRFEEGEVFDTSVEAVAKEEGIFEEGRPYMPL
FT                   EFTVGEGQLIQGFEEAVLGLKVGEEVTVIIPPEKGYGFRDESLIERVPIEAFDEADFEP
FT                   EEGMVIVAGDEPAVILEVTDEDVALDFNHELAGETLKFTIKIVEKL"
FT   gene            442599..443570
FT                   /locus_tag="MmarC7_0438"
FT   CDS_pept        442599..443570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0438"
FT                   /product="Methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="PFAM: Methenyltetrahydromethanopterin
FT                   cyclohydrolase; KEGG: mmp:MMP1191
FT                   N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65507"
FT                   /db_xref="GOA:A6VGD1"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGD1"
FT                   /protein_id="ABR65507.1"
FT                   /translation="MLSVNLASLPIVEDMINRKEELNLEVITLENGATVLDCGVNVMGS
FT                   FEAGKLFTKICLGGLAHVGISISGSLDNKLVLPCVKIKTSHPAIATLGSQKAGWSVSVG
FT                   KYFAMGSGPARALAMMPKATYEEIDYRDEADIAILCLESSQLPDENVADHVAEKCGVDV
FT                   SKVYLLVAPTASMVGAVQISGRVVENGTYKMLEALHFDVRKVKFAAGIAPVAPVIGDDL
FT                   KMMGATNDMVLYGGRTYYYVKSDEGDDIEKLCKSLPSCSAETYGKPFLEVFKEANYDFY
FT                   KIDKGMFAPAVVTINDLRTGKLMSYGETNVEVLKKSLKFSQL"
FT   gene            443667..444782
FT                   /locus_tag="MmarC7_0439"
FT   CDS_pept        443667..444782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0439"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1192 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65508"
FT                   /db_xref="GOA:A6VGD2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD2"
FT                   /protein_id="ABR65508.1"
FT                   /translation="MDLSNLNEKDMALGCKYCIKGEKLVLYITGLCEESCYYCPLSEKR
FT                   KKKDVIFANEKQINSIEEAVEEAHLCGSKGVGITGGNPLLKIERTVEYLKALKEEFGND
FT                   FHAHLYTTPKFVSEENLTLLNEAGLDEIRLHSTRLFNDFEHFDKLDFLNKLKLCKGYIK
FT                   DVGVEIPGIPNFEKEILDLAFDIDKIGVKFLNINELEYSETNYQALTDRGFSEKDDTTS
FT                   RISGSFETAKYVIDNFKGKLLIHFCPSSLKDSVQMKNRLINRARNVAKPYEEITEEGLL
FT                   LKGIINFKNLTDVSEVIEILKENDVEFELLEDRLFLNPEILEDLIDQLKENNFDFKFSA
FT                   YISEYYPTSDKFEVERIPLVIKKPNLKLKKK"
FT   gene            445409..449947
FT                   /locus_tag="MmarC7_0440"
FT   CDS_pept        445409..449947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65509"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD3"
FT                   /protein_id="ABR65509.1"
FT                   /translation="MNKKSGQALFLVLVMVLSNMGGVMGIVDTTIGTCPCNGESGSGTI
FT                   IIDCNCTDDRCFNISFTSPECASTWCDEVPITGTIVPCVDDELGCADYIKVYYKQLDTD
FT                   CECCECYCECGNPEADDGEGWSVVGVDDTLNGSCPAVWGLDWPICCETDGCYVLRAVLY
FT                   DGCDMQVGCPSEPVFICFDKGVAVSLALPESLSCGGTIAGCLNESCDCVDYILITANYT
FT                   GEGSCLRCPQEDCMPTMTYIVDREDFEEAMCCDYIFDVLFNNLYCGGCYEITATPYADC
FT                   TDDCTYNGVQIGEEYVGYLEIIREDVCFEIECPAPVTPECGMTLCGPITFSGILNDPCN
FT                   AAQCIEFYAVKTGNFTLCDGACCAPTCNACDGEEIVTLEVETEELGENICPNCGAEMEP
FT                   IVCGACGGIVTGYTCPNCGYPSNEDTGTGVSECICGQPEDHDNYICKCALYDMEYLGCT
FT                   YATMPNWTFTTSEFCDFDSGCYEVYAVVVDKCDCYYEYRYDTVEFAYCNERNLTIELED
FT                   CVCEGCWMGNNYYKVYDIQSGTVTAFGNITVPTCWINYPEYVALEYDFGHKVYVNDFRC
FT                   PTSYIEWDDEWKDASCTEGSITWTYNGACLTSGTWETDWCTPEDIQDEEGRYVRIRGVA
FT                   VGGCGEFESEPIGTSIYNDFEINIFDPCEGNTIYNGKVIRGFVWIDTDCCGGWCWPGCN
FT                   NWPDADEVCLPDHVDLYWREYGTENWLPMDSAFLSWENSEQYIDFTDYGIDPLYPNLPD
FT                   LCWYDNYAYWDVTWTSCMVNCIDNGHYEIKAVVEPCENDECGTFERAEYVMDIYVDDTS
FT                   GVTISKPIDGQTVCDNFWVYGTAVGAGVSNVDFYVSEDNASWMLYKEDIDVNVEDGRWK
FT                   APLNTCCFEDGPLYLKAVVTGPCDQSESNVMVNVNNAIEIDLTCPDCCVYYVTGDKAPI
FT                   RGTLTGCSVDERVESVKVYSTSLGLIGEVPAEDFRYIGDGTWEWGLCFNPCVLNGASTQ
FT                   IYAEAEYSCGNTYTTITTGYECMQHDPDLVILEITGPGAESTVAGTVTIEGTVECACLD
FT                   YLEFEYREICEPTGLPLGDWTSFPDVSTIYLPTTCDCDGMIWTIDLNTCGMDGLYEIQV
FT                   SAYGWPCEGAIASDTSMIDVDNNIGITLDTPAINSGVKNGTIEVGGTVENCPVIDIIEL
FT                   WYIDEGISTMISDEITCSDGLWSYMWDTTTLEDGCYCLVAYAFDEDCDNMASTKTRAVC
FT                   INNSGLPPYYENETPEIERECVSIVTACYLPCTTLYITFNDTVSINDSYDPASPLDGFD
FT                   ISGGSFGTGAWMEEDSSNDHRLIVHLGTGHTIASGTSGISIKENQTAILGPHGFPIVDC
FT                   SALLKGISVPESSGTSESSGTIELENLKMFSVPGKVDTEQMIIDAGITEGSFVKYTNGR
FT                   WEQVTEFKPLEGYVYIGNFEGDMPIYIEDLLPTDTPPEIQLASGWNLVGVNTYGGSFDT
FT                   VACDDFIGSAPISKLLEFSSSGWIKLTGSSPLVPTNAYWAYADSSCDFSGQ"
FT   sig_peptide     445409..445486
FT                   /locus_tag="MmarC7_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.736 at
FT                   residue 26"
FT   gene            450006..452051
FT                   /locus_tag="MmarC7_0441"
FT   CDS_pept        450006..452051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0441"
FT                   /product="surface protein"
FT                   /note="KEGG: mmp:MMP1194 collagen triple helix
FT                   repeat:surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65510"
FT                   /db_xref="GOA:A6VGD4"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD4"
FT                   /protein_id="ABR65510.1"
FT                   /translation="MKKVYTLLLVFALVSGLNMAYADSAPSLPHTFYGDVSINGLPATG
FT                   TLQVLVNGVESGQVQVDDGEFGKGLFDLKLVVTGTSGDEITFSFESETYAINPSYNIYL
FT                   VDSAQYVSEIDFVSGGYTQVLLEFTGTGDSGDTGDTGDTGDTGDTGDTGDTGDTGDTGD
FT                   TGDTGDTGDTGDTGDTGDTGSMPLNPELFYGIATIGETSASGTLNVYVDGVLQDSIAVE
FT                   NGLFGGSGPLSEKLVATGYVGNANEVTFELSSGSEIYSSFSAIIGENTYTDELPYVDGV
FT                   QNIAIEFSEGTGISGDTGDSGDTGDTGDSGDTGSMPLNPELFYGIATIGETSASGTLNV
FT                   YVDGVLQDSIAVENGLFGNSCPLSEKLVATGYVGNANEVTFELSSGSEIYSSFSAIIGE
FT                   NTYTDELPYVEGESYYMEISFSESASTGDSSNSTSSETDGSSMPLNPELFYGLVYLDET
FT                   LPSGTLNVYVDGVLQDSIAVENAIFGASGPLEDKLIATGYDGNSNVVTFSLVYGEETYS
FT                   EFTAELSNTTYENELPYDEGIHYVILTFSESEDTETGTSGGGGSSGSSSGSSSSSFVSS
FT                   SDSSETTVTSSTTKNSNPGTLTKTDSLAGAVESSEDVEQNALESSSDGSSAGETDSNES
FT                   GVVLQQESPLGGINLYLAMAAILLILIALAAAWYQSKEKPEVLPQQ"
FT   sig_peptide     450006..450074
FT                   /locus_tag="MmarC7_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 23"
FT   gene            452127..452435
FT                   /locus_tag="MmarC7_0442"
FT   CDS_pept        452127..452435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0442"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: mmp:MMP1195 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65511"
FT                   /db_xref="InterPro:IPR020378"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD5"
FT                   /protein_id="ABR65511.1"
FT                   /translation="MKFLWIFSDYKKYKEIYKKLMKSEIMAKFQLNSSDKEYIKDKGIN
FT                   NIENHAYDFIKLKIKPKSIKNDGKQTPMKGYPVFTAQHATATCCRDCIEKWHKFPKK"
FT   gene            452589..453137
FT                   /locus_tag="MmarC7_0443"
FT   CDS_pept        452589..453137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65512"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD6"
FT                   /protein_id="ABR65512.1"
FT                   /translation="MNKIVLILSLVLISSFCLCTDKTDSGSEDLSEFSSTIVLQFGETT
FT                   VNVPLRAPINDSMTTTLINTNDSEIKSDYTSGNYKIMYFEYDFNLSNEEGGIVLTDLVS
FT                   KVSFFTTAYPYVIADQTLFNNTEDIAKVKNSNQTLVIQIERSNSSATIEKYNNTYVIEG
FT                   NSLNELDKAESRFVIAMLS"
FT   sig_peptide     452589..452651
FT                   /locus_tag="MmarC7_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.830 at
FT                   residue 21"
FT   gene            453317..454078
FT                   /locus_tag="MmarC7_0444"
FT   CDS_pept        453317..454078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0444"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmp:MMP1197 transport
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65513"
FT                   /db_xref="GOA:A6VGD7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD7"
FT                   /protein_id="ABR65513.1"
FT                   /translation="MKLLKNLTLPVLGILAWELLAIYLNNPVILPKVESVISILLNPGV
FT                   GILGTGNLIENTIVSIERVLIGFLIAGAFAIPIGILMGYYSLINDLLDMTVELFRPIPP
FT                   LAWVPLALAWFGIGESSMHFIIFIGAFFPILINTISGVKSVPVIMVEAAKTLGGSTKDI
FT                   LKSVIVPASSPDILTGLRIGAGIAWMCVVAAEMLPGSDAGLGYLIMYAYSLSKMNVVVA
FT                   SMIIIGIIGIILDKGLRYIETKYFCWKKMMK"
FT   gene            454113..454877
FT                   /locus_tag="MmarC7_0445"
FT   CDS_pept        454113..454877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0445"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmp:MMP1198 nitrate/sulfonate/bicarbonate ABC
FT                   transporter ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65514"
FT                   /db_xref="GOA:A6VGD8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD8"
FT                   /protein_id="ABR65514.1"
FT                   /translation="MSVLELKNLIKKFGNGKKDLVAVDNVDLSVQHNEFVSIVGPSGCG
FT                   KSTILRMIAGLETPTSGGIYLDEKEVLGPDADRGMVFQQYTLLPWKTVLQNVTFGLEIK
FT                   KIPKDERIETAKKFIKMVGLEEFCDSYPYELSGGMQQRVAIARTLANNPKIVLMDEPFG
FT                   ALDTQTRAVLQDHLLKIWETEKKTVVFVTHSVDEAVYLSDRVVVMTARPGKIKSIIDID
FT                   LDRPRKRTSVEFLEYKKKIIDDLKSEVLKTYI"
FT   gene            454978..455832
FT                   /locus_tag="MmarC7_0446"
FT   CDS_pept        454978..455832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0446"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: PhoU family protein; KEGG: mmp:MMP1199
FT                   phosphate transport system regulatory protein-related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65515"
FT                   /db_xref="GOA:A6VGD9"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGD9"
FT                   /protein_id="ABR65515.1"
FT                   /translation="MLRGKDATLAAIINIILDEEPETQDDIADRLNVSRRYVAKLLKPL
FT                   VDGGAILHPYVVNLEKLKEFEDYIETDRYFKEIYETFDRMGTNVIQNIDKVFDSLKTHD
FT                   LDIANSIILEDYALNRMEDEVNLVIKLKASKYMDMNSLMQISNIAANIERCGDYLSNIA
FT                   EEVVNGLFVDPAIKKEIFEIRDIISKMFDHAMNMVKNKTIDTEIYELEGKLHKKLDIMM
FT                   EKLSENPDENLKDINQFIQFGMFLKDVERFGDRSLKIFELGREFHYNIPKNVKTPEYVR
FT                   NLK"
FT   gene            455981..457291
FT                   /locus_tag="MmarC7_0447"
FT   CDS_pept        455981..457291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0447"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: mmp:MMP1200
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65516"
FT                   /db_xref="GOA:A6VGE0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGE0"
FT                   /protein_id="ABR65516.1"
FT                   /translation="MEFLGNEMLTVEGKNLKIDGYDASELAKTYGTPLYVMSETQTVKN
FT                   FTRYVDSFKEYSEKTGKEFIISFAYKANTNLAVTKLLSKLGCGADIVSAGELYIAKLSN
FT                   VPSEKIVFNGNCKLKEEIKMGIEAEIRAFNVDSISELVLINETAKEMGKIANVAFRVNP
FT                   NVDAKTHPKISTGMKKNKFGLDIESGIALETIKMAEKMENVKIVGIHCHIGSQLTYISP
FT                   FVEEARKIMDFVVSLKNEGIEIKDVNLGGGLGIPYDKNTKIPVQKDLSKAVLDVIYEYE
FT                   GKIELPNLILEPGRSLVATAGVLLGTVEHVKETPVAKWIMIDAGMNDMMRPAIYEAYHE
FT                   IVPCTIRDEKEVVSVAGGLCESSDVFGKDRELSKMEVKDTVAILDVGAYGISMANNYNS
FT                   RGKPAMILTNEKEVSLIRVRETLADLISKDIVPNHLL"
FT   gene            complement(457351..457902)
FT                   /locus_tag="MmarC7_0448"
FT   CDS_pept        complement(457351..457902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0448"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   mmp:MMP1201 Staphylococcus nuclease
FT                   (SNase-like):thermonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65517"
FT                   /db_xref="GOA:A6VGE1"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGE1"
FT                   /protein_id="ABR65517.1"
FT                   /translation="MKKIIFLAPILLLIFSGCISDDNIDSGDFIDSHEHFSGTVTRVVD
FT                   GDTVHVDSNGVDYNIRLLGVDTPETYQKNSVSEYYIDYETPITDTEYLDYWGHLATNYT
FT                   RNTLENKSVYVVFDKNSDKQDKYGRYLAYIYLENENFNENLIEYGFARVYVSDFELKAG
FT                   FLETEKTAKSEKTGLWNYNN"
FT   sig_peptide     complement(457840..457902)
FT                   /locus_tag="MmarC7_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.982 at
FT                   residue 21"
FT   gene            complement(457910..458293)
FT                   /locus_tag="MmarC7_0449"
FT   CDS_pept        complement(457910..458293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0449"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   mmp:MMP1202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65518"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGE2"
FT                   /protein_id="ABR65518.1"
FT                   /translation="MNRKEYKIFEIGMFKKEGENSYLEIYDEFLGGMDGLTKNSKILVF
FT                   LWFDGSDNETKRKTLKVHPRGNINNPIRGVFSTRSPMRPNPIALYTVKIEEISGNKLYI
FT                   EEIDAFSETPIIDIKRYSKELDL"
FT   gene            complement(458298..459398)
FT                   /locus_tag="MmarC7_0450"
FT   CDS_pept        complement(458298..459398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0450"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   mmp:MMP1203 cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65519"
FT                   /db_xref="GOA:A6VGE3"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGE3"
FT                   /protein_id="ABR65519.1"
FT                   /translation="MGKIDFRLEKTFGYTTGACAAAGAYSALYFLKNNERLNFVEIVNL
FT                   KEDSLIIPIKNIEKQGDTAISTVEKFSGEDIDITNGMDIEIEVTLNLDNNSSESSNVDI
FT                   IGGIGVGIITKSGLQVTLGKPAINPKPREMIETNLKSLLTDNECVTVKISVPNGDEIAK
FT                   KTLNPKLGIIGGISILGTTGIVRPMSNDAYKESLAPQIDVALANNFENLIFVPGNIGTK
FT                   HAKILLHAEEDQIIEVSNFWDYMLNKAKEKGVKDITVFGHAGKIVKLAGGIFDTHSKVA
FT                   DARNEILCAYTSLVTQDVEILQKILQSNTTEDIVEILTEKGILKEVFDNVSKRVVERLS
FT                   SRWDGINFSCIIINMKGNMLGKYDQG"
FT   gene            complement(459439..460458)
FT                   /locus_tag="MmarC7_0451"
FT   CDS_pept        complement(459439..460458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0451"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: mmp:MMP1204
FT                   metallopeptidase family M24:Xaa-Pro dipeptidase/Xaa-Pro
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65520"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGE4"
FT                   /protein_id="ABR65520.1"
FT                   /translation="MDKFGEFLEYLKENDIKKAVITKKETINYFLEKYPPNFSMLIFDI
FT                   KKDTVTLQVSKLDFEMAKGYKIKNLGIELYENFESTFKGCDGIEDSLPIRFLKFVKDYK
FT                   LVSKKIEEMRETKTKAELENIKKAAKISDGAIEHATTYALENDNLTENQIAAEIEYFMK
FT                   KNGSIRPSFDTIAISDKKTRLPHGMPSEDVVKNILLMDIGALYEGYCSDITRTVILNEN
FT                   IKNYSEIYNIVHSAKKEAEKNLKAGISVKELDLIAREHMGEFKDYFIHSLGHGVGVEIH
FT                   ENPAISSKIKEDVILKEGMVVTIEPGIYTDDFGVRIEDLYLVKKNGFEKLSNAKILEY"
FT   gene            complement(460524..461813)
FT                   /locus_tag="MmarC7_0452"
FT   CDS_pept        complement(460524..461813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0452"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   mmp:MMP1205 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65521"
FT                   /db_xref="GOA:A6VGE5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGE5"
FT                   /protein_id="ABR65521.1"
FT                   /translation="MLVVKKTPKIKGILSAPPSKSYTHRAVICASLANGVSNLKNPLNG
FT                   ADCLSSAHACEMFGAEIDLNDEKWVVRGSEFKTPDNIVDIGNSGTTLRILTGISSQISD
FT                   GYTVLTGDDSIRKRPMQPLLDALKQLGLNCFSTKNNGTAPIVVKSGKISNNVVEIRGDM
FT                   SSQFITSLMMTLPFSENDSEIILTTPIKSEPYLNITIDVLDKFGVKIDKIEEKNKVGYK
FT                   IKGNQKYLPCDYTIEGDYSSASYLVAAGVLLNSDIVIKNVFKDSKQGDREIIEIVKKMG
FT                   ANVEINEDNVQIMGPYKLKGIEIDVTDIPDLVPTIAVLGCFAEGKTVVYNGEHVRLKEC
FT                   DRLAACTTELSKMGAEIEEKKDGLIITGVHKLNGAKLKTYHDHRLVMAFTIAGMMADGE
FT                   TVIEGEDSVKISFPDFVDKMKSIGSNIEVI"
FT   gene            461982..463322
FT                   /locus_tag="MmarC7_0453"
FT   CDS_pept        461982..463322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0453"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: mmp:MMP1206 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65522"
FT                   /db_xref="GOA:A6VGE6"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGE6"
FT                   /protein_id="ABR65522.1"
FT                   /translation="MNSVEQAMEYIKTNNVKFIRFQFVDIHGEPKNIAYPVKAGAAGEE
FT                   ELYDVLSKGLYFDGSSIEGFVSIESSDMMLKPDLKTLSVLPWRPTEKSVARVICDVYTT
FT                   TGKPFEGDPRGCLKRILAKFDEELGGEFFVGPEPEFFILKQDACGSWVPADDAGYFDLE
FT                   PVDAGCDIRRKIVFALENLGFHVEASHHEVAEGQHEVDFKFADAVKTADSVVTFKTTIK
FT                   TLAAQEGLKATFMPKPFFGINGSGMHCHQSIWLGGEPSFYDETAKHQLSSTCMNYVAGI
FT                   LEHAKSIVAVTNPTVNSYKRLVPGYEAPVNIAWANANRSAIIRVPAPRGKGTRIEFRAP
FT                   DPACNPYLAFTVMLAAGLDGVRRNLEAPEPVEKNIFAMNEAQKKAEGIESVPANLKAAL
FT                   DELENNSVLKDALGKHIFENFIEIKNAEWDSFRTAVTDWETKQYLKI"
FT   gene            463533..463907
FT                   /locus_tag="MmarC7_0454"
FT   CDS_pept        463533..463907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0454"
FT                   /product="Ribosomal protein S6e"
FT                   /note="PFAM: Ribosomal protein S6e; KEGG: mmp:MMP1207
FT                   ribosomal protein S6e"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65523"
FT                   /db_xref="GOA:A6VGE7"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGE7"
FT                   /protein_id="ABR65523.1"
FT                   /translation="MAFKVVVSDTKTGKSYQFETESTALIGKKIGDEISGSVVELEGYK
FT                   LKITGGSDKCGFAMRHDIHGAMKMRVLLKEGPGYNVKEKGLRRRKSLRGNTISKDVTLI
FT                   NTKVVEYGSAPLGGEPESTE"
FT   gene            464068..465300
FT                   /locus_tag="MmarC7_0455"
FT   CDS_pept        464068..465300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0455"
FT                   /product="protein synthesis factor GTP-binding"
FT                   /note="PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; Initiation factor
FT                   eIF2 gamma, C terminal; KEGG: mmp:MMP1208 translation
FT                   initiation factor aIF-2, subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65524"
FT                   /db_xref="GOA:A6VGE8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGE8"
FT                   /protein_id="ABR65524.1"
FT                   /translation="MAASNQSEVNIGMVGHVDHGKTSLTRKLTGVWTDTHSEELKRGIS
FT                   IRLGYADCEIKKCETCDEPECYTVDKKCDACGGKVSTLRKISFVDAPGHETLMATMLSG
FT                   ASLMDGAILVIAASEECPQPQTKEHLMALDALGVEHILIVQNKIDLVSEEAAIENYNQI
FT                   KEFTKGTVAENAPIIPVSAHHGANLDVLLKAIQEFIPTPERDETLTPKLYVARSFDVNK
FT                   PGSEIKDLKGGVIGGSIIQGALKVGDDLEIRPGIKVTEGNKTHWVPIVTKIISLGVGGK
FT                   KLKSAAPGGLIGVGTELDPNLTKSDALSGSLAGLPGTLPETLEKMVIKPQLLERVVGSQ
FT                   DELIIEPLKTNEVLMLNVGTSTTVGVTVSARADKAEIKLKLPVCADKGDRVAISRKIGS
FT                   RWRLIGYGIIL"
FT   gene            465338..466402
FT                   /locus_tag="MmarC7_0456"
FT   CDS_pept        465338..466402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65525"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGE9"
FT                   /protein_id="ABR65525.1"
FT                   /translation="MDYSKLLSKKENICSKIKNIDFNFDYKNYWTNSDFNSHSDTIFAG
FT                   GDGSFNKIDYVNYCLYISGTVSYIQKTDGKIEESISAWDSNIILPYKYVQSRLSLYMLN
FT                   MELKIALWNLKNKNINYYLYDGSLYSLLVQTNNKFSINGENLENIIFKYYELYGDEIKN
FT                   KIFEEIDSNNINSSVELSNNLNFSEEEKIILEQLEYLILLSELLKYREKIVGVAKTSKM
FT                   NIYFKDALIPDLAIFSKCKNSGYSKPLDLVDEKINKNFYKNVEYFKKFGIDLKKLNYQF
FT                   AKLDKNSGTLCITSFEDLDETFFSNLQKISVSNYPYILKKSHEKVKIEKKEIEKFVKLL
FT                   GIYEKSDRDSNLEY"
FT   gene            466533..467222
FT                   /locus_tag="MmarC7_0457"
FT   CDS_pept        466533..467222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0457"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mmp:MMP1210 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65526"
FT                   /db_xref="GOA:A6VGF0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGF0"
FT                   /protein_id="ABR65526.1"
FT                   /translation="MEKIAIHIMGEIVLSEDIGKAMKKWREMFGIPQIETARYLDVSPS
FT                   VISDYEVGRRKNPGVNIVKKYVYALLEIDKERGGHTIKALSKVLNPTSMKAILQIKEYQ
FT                   NPVGVRELLSTIEGKVICGENSLNNQLFGHTVVDSVKAILEMNGQDFLNLYGWTTERAL
FT                   IFTEVSAGRSPMVAIRVSNIKPRVVIFNGVSELDKLAVKLAELEGICLIVTELSTDELL
FT                   KRLKEIK"
FT   gene            467284..468333
FT                   /locus_tag="MmarC7_0458"
FT   CDS_pept        467284..468333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0458"
FT                   /product="putative hydroxymethylglutaryl-CoA synthase"
FT                   /note="TIGRFAM: putative hydroxymethylglutaryl-CoA
FT                   synthase; PFAM: Hydroxymethylglutaryl-coenzyme A synthase
FT                   domain; 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
FT                   domain protein; KEGG: mmp:MMP1211
FT                   3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65527"
FT                   /db_xref="GOA:A6VGF1"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGF1"
FT                   /protein_id="ABR65527.1"
FT                   /translation="MKEVGIVGYGSDLPKYRIKAEDIAGAWGKDAQAIKRGLVVNEKSV
FT                   PGPDEDTATISVQAARRALSRAGINPKDIGAVYVGSESHPYAVKPTSGIVAEACGVSPD
FT                   FTAADLEFACKAGTAGIQMCMGLVGSDMMEYAMAVGADTAQGAPGDALEYTAAAGGAAY
FT                   IIGAKKEELIAKFNGTYSYTTDTPDFWRREHEHYPKHGGRFTGEPAYFKHVLNGAKGMM
FT                   AKMDTTAKDYDYCVFHQPNGKFYISAAKQLGFTEEQYKYGLLTPYLGNTYSGAVPLGLS
FT                   NILDHAKADDRIFVVSYGSGAGSDAFDITVTDRISEVVDKAITTEKLLESKKYVDYAVY
FT                   LKYRGKIRM"
FT   gene            468352..469530
FT                   /locus_tag="MmarC7_0459"
FT   CDS_pept        468352..469530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0459"
FT                   /product="Thiolase"
FT                   /note="PFAM: Thiolase; KEGG: mmp:MMP1212 acetyl-CoA
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65528"
FT                   /db_xref="GOA:A6VGF2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGF2"
FT                   /protein_id="ABR65528.1"
FT                   /translation="MKDVAIIGYGQTKFGELWEESFRSLIVEAGTKAIIDANVDGDDID
FT                   AMYVGTMSGGLFVGQEHTASLIADYAGLNPIPCTRVEAACASGSLALRSAVLSIASGAH
FT                   DVVLVGGVEKMTDVSDATSAIATASDQEWEAFVGATFPSLYAMMAKRYMQQYGLTIEQL
FT                   SSWSAIAHENAVHNRYAQFRSKVTIDQIMRASPVADPLTLLHCSPVSDGASALIICDAE
FT                   KATQYAPKDEIIYIKASTQASDTIALHDRKDMTTLNAAKVASNKAYEIAGINASHVDVA
FT                   EVHDCFAINGLVLTEDLGFCKKGEAGKVVEAGKTRIDDESFVTVNPSGGLKAAGHALGA
FT                   TGIRQVGELYWQLKQDKECKDRQTAIKNGYAIAANVGGTGGTVCTHILSNKR"
FT   gene            469568..469960
FT                   /locus_tag="MmarC7_0460"
FT   CDS_pept        469568..469960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0460"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mmp:MMP1213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65529"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGF3"
FT                   /protein_id="ABR65529.1"
FT                   /translation="MVVRTWRSMQERYNLIGSKCKTCGTVYFPARSVCPECRRKGELED
FT                   FKFEGKGKVYTYSVVYAAPKDFEKQSPYVIGIVELEEGTKVTAQIDCELEEVKIGMPVE
FT                   TVFRKIREDGCDGVISYGYKFVPTEQ"
FT   gene            complement(469975..470652)
FT                   /locus_tag="MmarC7_0461"
FT   CDS_pept        complement(469975..470652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65530"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGF4"
FT                   /protein_id="ABR65530.1"
FT                   /translation="MIDEKIRSELEYYIRYELRGVYKSRMGGDIYEIEFENTSYSKYFK
FT                   KLLEKEGIKTKETDDISKIEIFRDQYIGEIVGLLKKERMKELIESMNFHNSVIEFISRN
FT                   FNPIITSGRESGIIRFKMMDDGEKFAYNELKELGFNISLENGSIIVDISDTVKEMFKRV
FT                   STVFDLKRITPYYAFSVNEEEAIEKCKKLDELSVPYKYSDVHREIYIDFDSLKHVISKF
FT                   KNN"
FT   gene            complement(470753..472231)
FT                   /locus_tag="MmarC7_0462"
FT   CDS_pept        complement(470753..472231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0462"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: mmp:MMP1215 cobyrinic
FT                   acid a,c-diamide synthase:cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65531"
FT                   /db_xref="GOA:A6VGF5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGF5"
FT                   /protein_id="ABR65531.1"
FT                   /translation="MAKFIMVVGTSSNSGKTVLVSGICRMLSNKGYKVAPFKSQNMSLN
FT                   SRVSIEDGEIAVAQYTQAMAARAEPSVHFNPILLKPKGNFISQVIVHGTPYEDRDYNEY
FT                   RSNKDDMLEKIKESIDYLDTNYDYVVIEGAGSCCEINLLKDDIANLRIAEISGADAILV
FT                   SDIDRGGVFAAIYGTVQLLPENWRKLLKGFVINKFRGNIDVLKDGFEKIEELTNIPVIG
FT                   TIPYDETLILPEEDSQALEGKRVFGNLKSPIEVNIVKFSKIANFTDVDPLSSDCLMRYL
FT                   DFNDDITGDILILPGTRCSTVEMDLMKKHGMDKKIMEFIERGGIILGICGGYQTLGKML
FT                   IDENFSEGDVGTISGLGLFDMETTFGNKKAIKNSTGKISIFDQNFDVAGYELHEGYSVS
FT                   NETPLISLSRGFGNCGNSYDGSFKVVGNSYIFGTYFHGILENFEFRNYLVNIVNNRKNL
FT                   SKIENDNYAEIFNKNMDKLSKLIEESLDLSKIIK"
FT   gene            complement(472361..473476)
FT                   /locus_tag="MmarC7_0463"
FT   CDS_pept        complement(472361..473476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0463"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class V; aminotransferase class I
FT                   and II; KEGG: mmp:MMP1216 histidinol-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65532"
FT                   /db_xref="GOA:A6VGF6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGF6"
FT                   /protein_id="ABR65532.1"
FT                   /translation="MSIDDKVRAIVKEFKAYVPGKSKEEIARNYGIDPEKIIKLGSNEN
FT                   PWGCSPKIAEKLMDEVSKLHQYPQPINPELMDEISKFTKMPVENIIVGGDGADEVIDNI
FT                   MRILIDEGDEVIIPIPTFTQYAISAKIHGANIKWAKFDEENEFKLDIESVLNNITEKTK
FT                   AIFLCTPNNPTGNVIPTEDIKKIVESTDALVMIDHAYIEYSNEDYDLTDWALKYDNVLV
FT                   LRTFSKVFGLAGQRVGYGVTSKKIVDYMMRIKPIFSLTRASQASAITALQDKEFFEKCL
FT                   NEGIESREEIYNGLKKFKQLEVYPTEANYMLVKVKNGMNSSEFCEVLLKKGVIVRDCYS
FT                   FEGLEPYYFRVSIGTFDENERFLKIMSEVVE"
FT   gene            complement(473502..474161)
FT                   /locus_tag="MmarC7_0464"
FT   CDS_pept        complement(473502..474161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65533"
FT                   /db_xref="InterPro:IPR016736"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGF7"
FT                   /protein_id="ABR65533.1"
FT                   /translation="MSETQHSKELIKRAVETISKTKTVSTTQNLSQNNDKKTFSDAKAG
FT                   KIDTLEFKKAVHSLFEADEDLYKYAPNHDLDEEKAKEFSKLLFEAQKHINNVLSGFGFD
FT                   FETISLDGQALYIVSNKKVLKSLKDINPDLNIISTEGVLEIEDMKVVNPKIPEKALLGI
FT                   EKKCKITKEQISKVISNISPSKVVVLVKDGDVADELIYIRAKELYNAEKLNADEIL"
FT   gene            complement(474178..475425)
FT                   /locus_tag="MmarC7_0465"
FT   CDS_pept        complement(474178..475425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0465"
FT                   /product="LOR/SDH bifunctional protein conserved domain
FT                   protein"
FT                   /note="PFAM: LOR/SDH bifunctional protein conserved domain
FT                   protein; KEGG: mmp:MMP1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65534"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGF8"
FT                   /protein_id="ABR65534.1"
FT                   /translation="MFMREIELKGHIIDSFILAKVFDRTLELGGDYKVLEFDIGKKKTD
FT                   VSYAKLLISGTSEQHLDQILEELQNVGANIPEIENANLKPALKDSVLPDGFYSTTNHPT
FT                   HVKVNDEWIEVANPKMDAVIVVYPEEKRAETKVMRKVKKGDFVVIGHNGIRVMPPEKSR
FT                   EAGQLFEFMNSEVSSEKPKEAIIKRIAKEMYEIREEYKKTGTGGIAIVGGPAIIHTGGG
FT                   PALAKMVELGYIQAILAGNALATHDIESALFGTSLGVDIKTAKPVTGGHKHHIYAINTI
FT                   IDAGCIKNAVESGTLKEGIMYQCIKNEIPYVLAGSIRDDGPLPDVITDAMVAQDEMRTM
FT                   VMDKKMVIMLSTLLHSVATGNLMPSYIKTVCVDIQPSTVTKLMDRGTSQAIGVVTDVGV
FT                   FLVLLLKELERLELQE"
FT   gene            complement(475514..477523)
FT                   /locus_tag="MmarC7_0466"
FT   CDS_pept        complement(475514..477523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0466"
FT                   /product="helicase c2"
FT                   /note="SMART: DEXDc2; helicase c2; DEAD-like helicases;
FT                   KEGG: mmp:MMP1219 putative DinG ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65535"
FT                   /db_xref="GOA:A6VGF9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGF9"
FT                   /protein_id="ABR65535.1"
FT                   /translation="MDFYEFKEYSKEKFPYHGMRSQQEVLMGKIYECVTNKKNLVVEAP
FT                   TGVGKTLSYLIPALYFAERGKRVMILTETIDQQERIVEDLNSLKHNLKVSFMMGKGNFF
FT                   CKSKGEKANTLYCQLNKGCIYRPNKKPVCVCGTKKEKIEFDGNIKFYCPLCMCDYQKAK
FT                   IECFDANIIVMNNTIYYYLKDEIDKKKQTDIVICDEAHKLEGSIRNAATIVINPKYALR
FT                   RLRFMAYHYSNSRLRVHMDRVSEEEDEIFWTIVQDYVVKNAAGKDCKNSLVFDGFKITS
FT                   FGLKEDVAILGTLLEGYNDIVKIKEKIEDLNENEELDKKDLKFKIDNKGLIPLELQFIA
FT                   DRRISDVPLVEFLENLGNLRNITGNFVVYKNNGSILCEPVLVSNYLNKLYGDASVVHCS
FT                   ATLGDLNIHAIKTGMGKSETLLLDSPFSKDRRNIISLSDGEDMKFNSTDFQSNNKKRNK
FT                   ANENLFKMVKAAKGNTLILFKSFGDLKTAHEYFLDAGYRGNIYCYESGMDGKAAKKLKE
FT                   DFQKYGGLLLATGRFAEGVDIPGDALTCVIIDSLPFPVPTPLLKREQTLLEERLKSRKV
FT                   KDAHWSAFLMTSFHIMARTVIQMIGRLIRTETDYGVVIIQDKRFNEWVGSEMLKRKYLK
FT                   DKFLPMSVDTAEEYIPKFMKKMKEDNLKNSSFFK"
FT   gene            complement(477650..479212)
FT                   /locus_tag="MmarC7_0467"
FT   CDS_pept        complement(477650..479212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0467"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="TIGRFAM: alpha-glucan phosphorylase; KEGG:
FT                   mmp:MMP1220 glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65536"
FT                   /db_xref="GOA:A6VGG0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG0"
FT                   /protein_id="ABR65536.1"
FT                   /translation="MKNTAYFSMEFAIDQSLKTYAGGLGFLAGSHFRAAKRLNVPLVGV
FT                   SMLWSYGYYDQVRDREGRMKVENIRKYYDFLTDIDLKVPVVINGTNIWVKAYKLEENTF
FT                   NTCPIYFLTTDIPENDHLSRTISYGLYDGNNLTHIAQEIVLGIGGYKVIRECENVKLFH
FT                   INEAHSLPIAFKMLEDYGIDYVKEHLLFTTHTPIPAGNETQDINLLKSMGFFGSIDTKT
FT                   AEKYGGNPFNLTVAALRMCKRSNAVSELHRETSEKMWAWVTNREPIINITNAQDKYYWQ
FT                   DTQIKEAAEKKDIKMLRERKLELKKQLFEEVADQTGSLFDPNILTVVWARRFADYKRPS
FT                   FLLRDEKRFKNLLKTGKIQILWAGKPHPADANAQITFNWIVSKTRELKNVSVLTGYELK
FT                   LSKLLKQGSDVWLNTPRRPNEASGTSGMTASMNASIHMSTMDGWHVEWAKAYPEDSFTI
FT                   GDGVNLDENYEANEMYKYLEEAIKIYDTDKWWEKAANAVNHVVEYFDAERMIIEYDKKL
FT                   YSD"
FT   gene            complement(479309..479854)
FT                   /locus_tag="MmarC7_0468"
FT   CDS_pept        complement(479309..479854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0468"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: conserved
FT                   hypothetical protein 95; KEGG: mmp:MMP1221 SAM (and some
FT                   other nucleotide) binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65537"
FT                   /db_xref="GOA:A6VGG1"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR023475"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGG1"
FT                   /protein_id="ABR65537.1"
FT                   /translation="MIQDSEFFRMEGVPITKEEIRAVSIGKLNLNPEDIVLDIGCGSGG
FT                   MSVEISKRSKFVYAIDNSEDAKNTTVTNLKKFKIENCEVFLGDAKDLISEFDFNKVFIG
FT                   GTQNIEQILEILKEKKIEKVVANTIVLENSVKIISKFEELRYNVDFVNVSVSYGKKINS
FT                   GHIMLSKNPITIITATLK"
FT   gene            480003..480971
FT                   /locus_tag="MmarC7_0469"
FT   CDS_pept        480003..480971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0469"
FT                   /product="DNA repair and recombination protein RadA"
FT                   /note="TIGRFAM: DNA repair and recombination protein RadA;
FT                   PFAM: Rad51-like; SMART: Helix-hairpin-helix DNA-binding
FT                   class 1; AAA ATPase; KEGG: mmp:MMP1222 DNA repair and
FT                   recombination protein radA"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65538"
FT                   /db_xref="GOA:A6VGG2"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGG2"
FT                   /protein_id="ABR65538.1"
FT                   /translation="MADVLTELPGVGPSTAEKLIEAGYLDFMKIATATIGELTDIEGIS
FT                   EKAAAKMIMAARDLCDLGFKSGVELLRQRQSVWRLSTGSKELDTVLAGGLESQSVTEFA
FT                   GMYGSGKTQIMHQSCVNLQIAGKIYADLEGVVEEELEHPKAVYIDTEGTFRPERVVQMA
FT                   EGLGIDGQLVLDNTFVARAYNSDMQMLFAEKIEDLIKGGNNIKLVIIDSLTSTFRNEFT
FT                   GRGKLAERQQKLGRHMATLNKLADLYNCIVLVTNQVAAKPDAFFGVAEQAIGGHVVGHA
FT                   ATFRFFLRKSKGDKRVAKLYDSPHLPDSEAVFRITEKGIMD"
FT   gene            complement(481052..482530)
FT                   /locus_tag="MmarC7_0470"
FT   CDS_pept        complement(481052..482530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65539"
FT                   /db_xref="InterPro:IPR008303"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG3"
FT                   /protein_id="ABR65539.1"
FT                   /translation="MGFLDSIKGIFSKSPKIHYAKSQSIDVMDLNPKRVGPNQNILPYY
FT                   TVASVELGNTTTKAIITATEMGSGKTYVVSKEVRMTRDVRTPKKGEEVFGRTIWDVELT
FT                   KEAVSEMVRDVLKGAMDKAHLNVDDLHFVVRSTGVTAGFASPEEVGVMIVSLAEGCRMA
FT                   GIPNGKMTPIMTKKQLPEILQDYTLIEKLIFDGAVTGVVPPTGKEVVANEMEGELVTAG
FT                   LKIGSKWTGVDYRNPCISIDFGTTLAGRITNNGEPYAKVIGNLCGLAGAVSDAVVRGTD
FT                   LVSKRGGAVLDIHAEKGSPNKELAEKYAKEIHEHVIIKEVPKGMERFGTVPVNPESAEK
FT                   AGTFLIGCDVGENGSDIPELEKIGAKILKESNLPTMMYTLDIVSAKITQRLIKIAHEEG
FT                   IISGATAIGITGRAGITGQKPKLIIEMLSELGIWDNVSENIIFVEDGLALGASVMARCM
FT                   NCLGTPNVPIGGKRNGPCILAQRIKRQKEMGMIK"
FT   gene            482842..483606
FT                   /locus_tag="MmarC7_0471"
FT   CDS_pept        482842..483606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0471"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG: mmp:MMP1224
FT                   ABC-type amino acid transport/signal transduction systems
FT                   periplasmic component-related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65540"
FT                   /db_xref="GOA:A6VGG4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG4"
FT                   /protein_id="ABR65540.1"
FT                   /translation="MKIPEIPVIIASILIITSFSGCISSYGMDSDTVTPGVLTIGITPS
FT                   LPPLEYYENGELKGYDIDLMKEIAYKMGLKPEFKIYSYEGAQKALLNGEIDCIPSTAIS
FT                   PERKEKMDFSRAYVQTYMVIAVFESSSYREIKDLNGKNVAVIKNTYTEDWANFYLGSTT
FT                   ANIKPYESVDSLMSDVESGNLDAVVTDQIHMDYYAHKNNLDARMISEKITIIYWAIAVK
FT                   KGNNGLQDQINDALFELEEDEALYELRNKWYD"
FT   sig_peptide     482842..482925
FT                   /locus_tag="MmarC7_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.733 at
FT                   residue 28"
FT   gene            complement(483635..484792)
FT                   /locus_tag="MmarC7_0472"
FT   CDS_pept        complement(483635..484792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0472"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; KEGG: mmp:MMP1226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65541"
FT                   /db_xref="GOA:A6VGG5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG5"
FT                   /protein_id="ABR65541.1"
FT                   /translation="MDFEKYDVVIVGGGPSGFITGENIKNRKVLVLEEHQEIGVPLQCA
FT                   GLLSKNCIKELGNPKGSVNKVRGAHIYSKNSSITVGNEEIRAEVFERKVMDKDIAVRAS
FT                   KNVDVLLKSYGKIKNSNLPSDRDNNRHKLQIMHMDEIFEVSPEIIIGADGIRSTIGRSL
FT                   NMLDKKREIISGVQIEFVNAKIDDDFVYVIYDKRYSEKFFTWLIPLGNDRVRVGMCDST
FT                   NSYKKLLDFIENNQIAKEILKNATPVEFICGAIPIGYSKTVKNNVMLVGDSAGQVKPLS
FT                   GGGLYYGAKCGKICADTINHYFEGNYNVEFLKNYEKNWKREISSEIDKNIKIRKILNML
FT                   NNDKMDRIFDFINKNNLVEFINEKGDMDNPSTVVRPILDRVIFGK"
FT   gene            484905..485531
FT                   /locus_tag="MmarC7_0473"
FT   CDS_pept        484905..485531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0473"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   mmp:MMP1227 uroporphyrin-III C/tetrapyrrole
FT                   (corrin/porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65542"
FT                   /db_xref="GOA:A6VGG6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG6"
FT                   /protein_id="ABR65542.1"
FT                   /translation="MIYIVGIGPGNRNYVTEKAFDTIKTSDFVLGSKRSLDIFEINGKK
FT                   IELTVNLKNELCEFLTNYKKSNSKKKVSILSTGDPCFSGLLKTIFSFDFIEKEDFEVIP
FT                   GISSIQIAAAKAKISWEDYNILTLHGKEENLKKLLNYVKNGEKVIFLPNNLKKDLKFLI
FT                   ENGISGEKELTVLENLSYDNEKIITDKISNLLENDYSYLLVCIIN"
FT   gene            485545..486177
FT                   /locus_tag="MmarC7_0474"
FT   CDS_pept        485545..486177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65543"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG7"
FT                   /protein_id="ABR65543.1"
FT                   /translation="MKKIVALFVVLTLFSGCIGNDYSSVEIVENSPYPEFIYVNNDMLK
FT                   IIVNNISEKQISDHFFVILDGAYINKNNYSKLAVRTPLWRFGGLFVNENTKSGNGLIFL
FT                   NSNFVGTPDLKYNIPLNYNDIIIYDENYGIFIEIGKEYSSAEIIAENFPENKYFMEYTN
FT                   DIASKNIINRTIIEKEDILIGIYVLEGGIPITNLNNGVFNMHIKSKS"
FT   sig_peptide     485545..485604
FT                   /locus_tag="MmarC7_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.778 at
FT                   residue 20"
FT   gene            486273..486575
FT                   /locus_tag="MmarC7_0475"
FT   CDS_pept        486273..486575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0475"
FT                   /product="FUN14 family protein"
FT                   /note="PFAM: FUN14 family protein; KEGG: mmp:MMP1229
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65544"
FT                   /db_xref="GOA:A6VGG8"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG8"
FT                   /protein_id="ABR65544.1"
FT                   /translation="MDLMQFVPDLGTGFITGFVVGWGIKMAIKVVIALMGLYVFSLIYL
FT                   SNLGVISINTEALFGLVGNVEGAVMSYGSLAVGLIHSVSLGGGFAAGAAVGLKQG"
FT   gene            486612..487667
FT                   /locus_tag="MmarC7_0476"
FT   CDS_pept        486612..487667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0476"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: mmp:MMP1230 DNA polymerase, beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65545"
FT                   /db_xref="GOA:A6VGG9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGG9"
FT                   /protein_id="ABR65545.1"
FT                   /translation="MDTRIRDFIKTDEGYFAVNTYYHPENALISFLRYINIEKIGNHIL
FT                   KDYDLDESDIRILDSQRFIKVADSAKAYAILKEYYPEYLFYDTINDVLLHAIPKTNIKE
FT                   ILSPQKRLQDVLNEQNTEAEIKCAKLADILHDYGLDYKNMGVSGSTVLKLNNENSDIDF
FT                   VIYGMKNHKNAREILSETFEDGVLSPLSEDFWKKAYAKRIKDGTLTYDEFVWHETRKLN
FT                   RGVVDGVMFDLLATRDWNEITEKYGEKKYKNLGFIQIKAKVKDDSFVFDNPAVYKVENV
FT                   EILNNENNADVSASEIEEIVSFTHTYAGSAYNGEEIIVRGKLEEVSGKETYKRVVVGTT
FT                   REAFNEYVKLS"
FT   gene            487695..488144
FT                   /locus_tag="MmarC7_0477"
FT   CDS_pept        487695..488144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0477"
FT                   /product="putative HAD family hydrolase"
FT                   /note="KEGG: mmp:MMP1231 putative HAD family hydrolase, a
FT                   fragment"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65546"
FT                   /db_xref="GOA:A6VGH0"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGH0"
FT                   /protein_id="ABR65546.1"
FT                   /translation="MIDIPNYGKITSKTVVFDLNGTLAVDGIVNSEIKELLKKLGKTYK
FT                   IVVLTADTYGTLEKEFNGLPIAIDKIKNEIEKVNAAEKYSPYIGIGNGNNDCLMLEKSE
FT                   LGILIIGEEGASTNALLKSDIVINNIKDAIKLLLNEKRIVATLRK"
FT   gene            complement(488167..489057)
FT                   /locus_tag="MmarC7_0478"
FT   CDS_pept        complement(488167..489057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0478"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: ExsB family protein; PP-loop domain protein;
FT                   KEGG: mmp:MMP1232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65547"
FT                   /db_xref="GOA:A6VGH1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR012122"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGH1"
FT                   /protein_id="ABR65547.1"
FT                   /translation="MDNNLEFRPWTQNKRNLMHLNQLKDDILNNFEELNLKDEKIVVML
FT                   SGGKDSAVALAIAKDLGLNVHLCVHFVHKWSWDISTNEAKKLADRFNVPIIFPDITEEL
FT                   AKKTQGAKGKSICRICKTIMKARMIDIAKEENAKIIMTGETALEKIAGPVFQYMRENNS
FT                   KLNRKDEFELYKKMELTKVPKRYKIHFFRPLIRVGHFDVFNLQKHYKIDIKRVSEAGNK
FT                   IGYWREGCCLQYCSPTCELTTELFDDLYDLNKKATEIARKNGFRASITLPTKEITVIPE
FT                   EEKYLKKIEEILKKV"
FT   gene            complement(489114..489815)
FT                   /locus_tag="MmarC7_0479"
FT   CDS_pept        complement(489114..489815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0479"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: mmp:MMP1233 TonB-dependent receptor protein:formate
FT                   dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65548"
FT                   /db_xref="GOA:A6VGH2"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGH2"
FT                   /protein_id="ABR65548.1"
FT                   /translation="MSKMVTKVKTYSWSAENGLLEKEDTIVTEDFYELYLDGKLIETMV
FT                   VSPENIEELGLGYTISEGYIAPENFSKIKIENKKIFVETTDSKNQLTKNKDVNLNLSTI
FT                   KKIMETMPTLSDTWKITGGVHWAALFDFSGNKIIYFEDIGRHNAVDKVVGYAVLNNIDL
FT                   NNCVLASSGRQPTAMVKKAVNSKIPVIITKSPSTDKGVILAKENDVLLIGFARIDRFTV
FT                   YNGVENIDFKS"
FT   gene            489892..490611
FT                   /locus_tag="MmarC7_0480"
FT   CDS_pept        489892..490611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0480"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: mmp:MMP1234 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65549"
FT                   /db_xref="GOA:A6VGH3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGH3"
FT                   /protein_id="ABR65549.1"
FT                   /translation="MSFERYKRQILMDDFGENGQKKLLDSTVTVVGVGGLGTVVSQYLA
FT                   AAGVGTLKLIDYQEVELSNLNRQILHFEKDVGIQKVNSAKEKLESLNSDINIEIYPEKL
FT                   KKDHIENSDVIIDCLDNFKARYLLNSFSNKYKIPLVHGAIEDLRGQVTTIIPDETPCIE
FT                   CIFKLKDDEENKSFPVIGVTPGVIGSIQASEAIKLITGIGAPLKNKLLSINMRTNDYFT
FT                   FNIKKNPECKICGGLND"
FT   gene            490604..491029
FT                   /locus_tag="MmarC7_0481"
FT   CDS_pept        490604..491029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0481"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   mmp:MMP1235 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65550"
FT                   /db_xref="GOA:A6VGH4"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGH4"
FT                   /protein_id="ABR65550.1"
FT                   /translation="MIRVSEEDFNVDIETKALFKDHPEIGGLVNFVGVVRNVGYDKGVE
FT                   KEAEFIEFECYEQMASKNLEELKNRAIEKFNIIDATVIHRIGTLKVGDNIVLIVVGAKH
FT                   RKEAFLACEYLIDSLKEEVPIWKKEFSKDGSYWVEQH"
FT   gene            491058..491801
FT                   /locus_tag="MmarC7_0482"
FT   CDS_pept        491058..491801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0482"
FT                   /product="protein of unknown function DUF375"
FT                   /note="PFAM: protein of unknown function DUF375; KEGG:
FT                   mmp:MMP1236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65551"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="InterPro:IPR037456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGH5"
FT                   /protein_id="ABR65551.1"
FT                   /translation="MKFFQEKISIKETNILLKVDNPKFFKIAKNTIINERFNLENYILR
FT                   NPIFLTSYSPVEVLDNAPKIVKLMAEAGFNADVGPMAAVAGTFSQLIVENLIENDCKNA
FT                   ISENGGDICLKCEMDTTVGLYAGNSSLSGSLGFKLKKEKIKNGYGICTSSGTVGHSVSL
FT                   GNADSVTVFSKSASIADAAATSIGNFAVGNNVDAINKCLEKAENIPKIDGVFVCMGEHA
FT                   GKIGKIPQFIKTDKKEGLGNVFEMF"
FT   gene            491835..492038
FT                   /locus_tag="MmarC7_0483"
FT   CDS_pept        491835..492038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65552"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGH6"
FT                   /protein_id="ABR65552.1"
FT                   /translation="MNSKAIKGIFLISAIIFCIILTGCNEYTDPSNETVQAAVLNEEYE
FT                   EENEEKYGNSNDEIYDGSEEDR"
FT   gene            492113..493096
FT                   /locus_tag="MmarC7_0484"
FT   CDS_pept        492113..493096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0484"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: mmp:MMP1238 TonB-dependent receptor
FT                   protein:biotin synthase; TIGRFAM: biotin synthase; PFAM:
FT                   Radical SAM domain protein; biotin and thiamin synthesis
FT                   associated; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65553"
FT                   /db_xref="GOA:A6VGH7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGH7"
FT                   /protein_id="ABR65553.1"
FT                   /translation="MKEIELNSDSLEIYEKSASEKLNKKDLVDLWNLDLKNLLDISYSL
FT                   KKLFNKEKIDLCSIMNAKSGVCSENCIFCSQSKHNSSKIDTYELKSKEEILKNAKSVEK
FT                   YSNRFSIVVSGKSVTDLEFENIIESIEEIQNKTKLKVCVSLGLLNKDKLKALKEKNVRI
FT                   HNNLETSENYFKNICTSHDYIDKIKVILEAKKMGLEMCSGGIFGMGESVADRVDLLLDL
FT                   KKLDVDSVALNLLNPICGTRIYDKINSGEFIEINHTDALKSICIARIALPKKVIRLCGG
FT                   REHVLKDMQKYSLYVLDGLMIGNYLTTNGQNIQSDLKMIDEMGFKQ"
FT   gene            493093..493869
FT                   /locus_tag="MmarC7_0485"
FT   CDS_pept        493093..493869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0485"
FT                   /product="ExsB family protein"
FT                   /note="PFAM: ExsB family protein; PP-loop domain protein;
FT                   KEGG: mmp:MMP1239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65554"
FT                   /db_xref="GOA:A6VGH8"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGH8"
FT                   /protein_id="ABR65554.1"
FT                   /translation="MINMEKGLLEKYTSLKEFLNNKKVIVAYSGGVDSTLVSKIASDNT
FT                   KTLAVTIDNGFFSENIIKKAENRAKKYNIPQKTIKIDYLDEITSKDLKNRCYNCKKRIA
FT                   EELRKIKNEFNYDIIVDGTIYNDTFEDRPGIKAFHEENIISPLSDLKFSKSDIFELSNY
FT                   LKIDIPKKDTCMATRILSPPISEENMNKSNLAEEFIKSNFHIESYLRVRYLENIAIIEI
FT                   TKEESAKIIDNDSIERIDTELKKIGFEKVVLDLKFK"
FT   gene            493897..495039
FT                   /locus_tag="MmarC7_0486"
FT   CDS_pept        493897..495039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0486"
FT                   /product="Sep-tRNA"
FT                   /note="TIGRFAM: Sep-tRNA; PFAM: aminotransferase class V;
FT                   Soluble liver antigen/liver pancreas antigen; KEGG:
FT                   mmp:MMP1240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65555"
FT                   /db_xref="GOA:A6VGH9"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR013375"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGH9"
FT                   /protein_id="ABR65555.1"
FT                   /translation="MDINTDKYKNITRNLEREMINLNPIQRGGIIPTEAKKIIYEYWDG
FT                   YSVCDYCSGRLDQIETPPINEFLEDMSKFLGMDITRPTHGARESKYAVMNSICKEGDYV
FT                   VLDGNAHYTSYVALERAKLNYEKTEIEEYPTFRVIPESYAEKIDLLEDSKKNIGLILLT
FT                   HVDGNYGNVADVEKVGKIAKSKGYPFLLNCAYSAGRMPIDGKKLNVDFIAASGHKSMAA
FT                   SGPCGLLSINKKYEDEVLETSKVNVVKELQMLGCTSRGIPILSLMASFEHLIERVKKWD
FT                   LEVEKTRKVVNELEPLGFNQIGEKPRNHDIIRFETPILDKIAEKDKRRGFFFYEELKKR
FT                   GIGGIRRGVTKEFKMSVYGLTNVQVDYVINSMKSIINELR"
FT   gene            495044..495403
FT                   /locus_tag="MmarC7_0487"
FT   CDS_pept        495044..495403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65556"
FT                   /db_xref="GOA:A6VGI0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI0"
FT                   /protein_id="ABR65556.1"
FT                   /translation="MSSKYILPVIMLLILAVAAYFSFGPDTPEKYVYLGVTFNQGGVGY
FT                   QGYTVEGQNIIFEYSREGESFSQALNLKIAQTDEQYKNIEHVYVKIDTNGDIQYYEAEI
FT                   FDETEGMVKYYVKEE"
FT   sig_peptide     495044..495112
FT                   /locus_tag="MmarC7_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.535 at
FT                   residue 23"
FT   gene            complement(495415..496332)
FT                   /locus_tag="MmarC7_0488"
FT   CDS_pept        complement(495415..496332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0488"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: mmp:MMP1242
FT                   quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65557"
FT                   /db_xref="GOA:A6VGI1"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI1"
FT                   /protein_id="ABR65557.1"
FT                   /translation="MDIIERINKLKNEKNAVILAHNYQPEEIQKISDIIGDSLELCIAA
FT                   RDTDADIIVFCGVDFMAETAKVLNSGKKVLIPEIIETDCPMAHQLPPEVILDAKKKHPY
FT                   AKVIIYVNTLASAKALADATCTSANADLVVNSFEEDEILFGPDNNLGYFVSRRSDKKII
FT                   PMPKGGHCYVHKMFTLDDAKAVKENYPNAELLIHPESNPELQEIADHVMSTGGMVKHVL
FT                   NSKCDEFIIGTECDMISRLKIDLKKAGKSKKLIPLRKDALCTSMKNITLEKIEKCLMDE
FT                   NYEVKLDEKIIEDARKAIERMLSI"
FT   gene            complement(496391..497002)
FT                   /locus_tag="MmarC7_0489"
FT   CDS_pept        complement(496391..497002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0489"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   mmp:MMP1243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65558"
FT                   /db_xref="GOA:A6VGI2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI2"
FT                   /protein_id="ABR65558.1"
FT                   /translation="MDIKALEDNLKPKGTVSIIGCGRLGIRIAMDLLEVHRGGFEKLQI
FT                   FDAARIDQNDVVHRKHGAKLGEYKVNFLKEFFPERIEAFFEDITEENIEKITGNVVLIV
FT                   FAGGDTLPIRKKIVEYCKNTGKVAIGTNGVFGFNPIIKIGDAVSEKGPVEFLKMETKGH
FT                   LVIGTGKFIKDMEPITPYTLDEMAKRIVIESLKIKKELIN"
FT   gene            497207..497653
FT                   /locus_tag="MmarC7_0490"
FT   CDS_pept        497207..497653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0490"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1244 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65559"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI3"
FT                   /protein_id="ABR65559.1"
FT                   /translation="MPEHILSGIKAVVAINMRKEGKLQREIAEFLEMDRSIISHYLHGR
FT                   YPSDKVMRVSEEIINLPREYGIPLITSLGDNKQITKKLIERIYKIKISIDMEKCIACGK
FT                   CLECEYGAISVYSEDIGISIDREKCILCCKCVSECPVGALKIVR"
FT   gene            497676..498734
FT                   /locus_tag="MmarC7_0491"
FT   CDS_pept        497676..498734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0491"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1245 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65560"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI4"
FT                   /protein_id="ABR65560.1"
FT                   /translation="MKNFKKDDNDGVIEISRSGVEKRVLKWDDCTCVGCGICSEICPTS
FT                   AIEMGPLGAIFKGELDAPKLDISEKCVLCGMCACACPFDAVKLSINDKPITEMSQYPKI
FT                   KRGIELNQSKCVLCEQCELVCPQCAIDVERELPERKSLVLGEITIKKDACVLCGICAEY
FT                   CPADAIELIPNEMNALSLNPIADIKVDLDACVYCKVCEKACPHNAIEAICYKCPLASRI
FT                   KEPELYKEIKGQTNIDKDLCVSCGWCANICPADAITVEKPFEGELIIDEPACNACGACI
FT                   SVCPCNALVFPQPEKQGDKVPNVVVNQDVCILCGACTHSCPVDALTVKRTKINMTEANA
FT                   PAWKKAFSKLMK"
FT   gene            498757..498999
FT                   /locus_tag="MmarC7_0492"
FT   CDS_pept        498757..498999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0492"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1246 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65561"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI5"
FT                   /protein_id="ABR65561.1"
FT                   /translation="MYKLEVYPDKCHGCGNCVVACPVNAQDPDVYGGKGPSSDEKLIMR
FT                   IENGVVSVVNGDLCGGCGACIEACPVDAIKLVIVK"
FT   gene            499041..499427
FT                   /locus_tag="MmarC7_0493"
FT   CDS_pept        499041..499427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0493"
FT                   /product="molydopterin dinucleotide-binding region"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   KEGG: mmp:MMP1247 tungsten containing formylmethanofuran
FT                   dehydrogenase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65562"
FT                   /db_xref="GOA:A6VGI6"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR012040"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI6"
FT                   /protein_id="ABR65562.1"
FT                   /translation="MKFMLNTGRTIWQGEAIEAGKNLEMYRKAAGVCYMNPEDMDALGV
FT                   KDGDAIKVTSEYGDVAVNAITTDQPAPIGMIFIPMGPWANRVVLPDTESTAMPSFKGPL
FT                   EVNVEKTDEEVLLMSDLMRKAYIE"
FT   gene            499448..501151
FT                   /locus_tag="MmarC7_0494"
FT   CDS_pept        499448..501151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0494"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mmp:MMP1248 tungsten
FT                   containing formylmethanofuran dehydrogenase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65563"
FT                   /db_xref="GOA:A6VGI7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI7"
FT                   /protein_id="ABR65563.1"
FT                   /translation="MEYIIRNGTVYDPKNKVNGEKMDICVKDGKIVESVSKNALEIDAN
FT                   KKVVMAGGVDSHSHIAGAKVNTGRTLRPEDSKKDLFSKEGLRQGSGFSIPSTFKTGYQY
FT                   SGMGYTTVIEAAMPPLVARHTHEEFMDLPQIDKAAMPLFGNSWMVLEYLKNGDLSMCAA
FT                   YVAWLLRVTKGYAIKIVNPGGTEAWGWGKNVHGLDDEVPYFGITPREIVTGLAKVNEML
FT                   GLPHSVHVHPNNLGHPGNWETTIDTMDCVKDIKAKPKFGERDTVYYNTHLQFHSYGGTS
FT                   WKDCVSKGVETADYVNKHKHVMIDVGQVTLDETTTMTADGPMEYDLHMTNGLKWANCDV
FT                   ELETGSGVVPFIYSPKGPVYALQWAIGLDIFLYTNPEKLILTTDHPNAGPFVRYPRVIA
FT                   WLLSKEYRDDWIQNRVHAWAAQKSHITETDREYSMYEIAQITRANSSKVLGLSGDRGHL
FT                   GVGAKADVSIYDISPEEKSGKKIEKAFLEAAYVLKNGDIVVKNGNVVKEVYGDTIFVNA
FT                   EVNETLEAELLKDLNMKFRKLYSVNMENYPVQDAYANSWMPINIDATEIQ"
FT   gene            501184..502002
FT                   /locus_tag="MmarC7_0495"
FT   CDS_pept        501184..502002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0495"
FT                   /product="Formylmethanofuran dehydrogenase"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: mmp:MMP1249 tungsten containing
FT                   formylmethanofuran dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65564"
FT                   /db_xref="GOA:A6VGI8"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI8"
FT                   /protein_id="ABR65564.1"
FT                   /translation="MNELILNLKGDVSVPIEVDKILPEKIQEMSLEEISKIELIQGNKT
FT                   AKMSEIFDIELKESTVAKVIINNCSKKVKRIGEKMTSGEIVVNGDAGMYVGVEMKGGKI
FT                   TVNGDAESWVGQNLKGGEITINGNAENYVGSAYRGDWRGMSGGTITITGNAGSELGEYL
FT                   KGGTIVIKGNTKIMPGVHQNGGMIIIEGDIEGRAGGEMMKGAIVVYGKILEALPSFKFE
FT                   GIVEDPLVKLSKKDAGTQLKGTFIKFTGDYVNNKPKGELYAAIDNNKNLL"
FT   gene            502095..502598
FT                   /locus_tag="MmarC7_0496"
FT   CDS_pept        502095..502598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0496"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /note="KEGG: mmp:MMP1250 6-pyruvoyl tetrahydropterin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65565"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGI9"
FT                   /protein_id="ABR65565.1"
FT                   /translation="MILELNGIYAGLRFSSAHIVFGHDSCGVIHGHSYYVDVKLSGEPS
FT                   GEFGFVCDFKILKQIVKELCGELDHKLLVPRDHENMEYSMEGDSIYLEYVEKSGNVKKY
FT                   MFPVEDINLLPLKSTTAEDLSIYFAKFIEDKLRKMDLEKSVEWIETTVNEGIGQGARYI
FT                   LNLK"
FT   gene            502689..503249
FT                   /locus_tag="MmarC7_0497"
FT   CDS_pept        502689..503249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0497"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65566"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ0"
FT                   /protein_id="ABR65566.1"
FT                   /translation="MNLELSVTEAMSTPVATVTLDTTAYDVANILKDKGIGCLVVLNDA
FT                   GKPVSIITERDLALGVASRNLKSKEVIVEEIASPKLIAIAPKSTIMDAARKMDLENVKR
FT                   LPVIDGDELLGIVTVSDITKLSPELFNIMVETNEIHNSEYPYSGTEEIEGICEICGSTD
FT                   SVNYINGRYICKNCTEDSEGEDE"
FT   gene            503273..504112
FT                   /locus_tag="MmarC7_0498"
FT   CDS_pept        503273..504112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0498"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmp:MMP1252 CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65567"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ1"
FT                   /protein_id="ABR65567.1"
FT                   /translation="MKIKTIVGEKKVEKVYPTTKIIEALDMMDKKNIRRISVVDPGTGR
FT                   VEGILTNMDIVDLLGGGSKYNLVKFKHNHNMLSAINEPVKEIMTDNVVLIKENAELDEV
FT                   INLFVEEKIGGMPVIDKSGVLITTINERDVIKYLKDQVDEKLLVKDCMTENVVFATPGE
FT                   RLKDVARTMLRNGFRRLPVVSEEKLVGIITSTDFVKLFGSDWAFNHMKTGNIREITNVR
FT                   MQDIMKTDIVSVTSDIKLINAVAKMNELNIGVIPVVDGEKLIGLLTEKDIVKCIYKK"
FT   gene            504222..505118
FT                   /locus_tag="MmarC7_0499"
FT   CDS_pept        504222..505118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0499"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   mmp:MMP1253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65568"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ2"
FT                   /protein_id="ABR65568.1"
FT                   /translation="MKIKPECALCITRQVVDVAKELTDNKSEQFKIIAWGLEKISEMYG
FT                   ESSVPSFMGTELHRHLKEKTQNSDPYKNLKDVANEFALKYLNDVEHLLESDDELERLQK
FT                   KVKLAIAGNVIDFGPFSTDVNIENMVKTTLDGKLDLDFSEELLNELKSSKKVFYTCDNA
FT                   GEVVFDLPLIKELKNYVEVVVSVKGSPILNDATLEDVKTAGIDKVTKVITSGTDTIGIR
FT                   FEESSEEFLSELNSSDFIIAKGMGNYESLTEYEEKQGKSEKIPVYYILKAKCEPVAEHV
FT                   GVHEGDNVLLRKEISKV"
FT   gene            505182..506231
FT                   /locus_tag="MmarC7_0500"
FT   CDS_pept        505182..506231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0500"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein; KEGG: mmp:MMP1254
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65569"
FT                   /db_xref="GOA:A6VGJ3"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGJ3"
FT                   /protein_id="ABR65569.1"
FT                   /translation="MVTYKDAGVDIYKEDKVIRALASQIKFERTDAIKPADLKGHYAGA
FT                   IEFGDYYLVLCTDGVGSKMVVAEMANKFDTVPIDMIAMNVNDAICIGAEPVALVDYMAV
FT                   EDITEDIASQIGKGLNDGIKESNINLIGGETASLPNMIKGVDLAGTVLAVVKKDEIVSG
FT                   KEVKPGNVIVGLRSSGIHSNGLSLARKVFFEISNLDVKSKLSHGKTVAEELLTPTKIYV
FT                   KPVLEMIKQVNVKGLAHITGGGFRKLKRLNKDVCYKIDELPEILPIFKEIQNLGNVADQ
FT                   EMFKTFNMGIGFCVIVEKDDAEKIIEISNHHNIAAFVIGKIEESVEVNGETKRETVLVE
FT                   YNNKKMIME"
FT   gene            506274..507938
FT                   /locus_tag="MmarC7_0501"
FT   CDS_pept        506274..507938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0501"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   PFAM: tRNA synthetase B5; KEGG: mmp:MMP1255
FT                   phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65570"
FT                   /db_xref="GOA:A6VGJ4"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR040659"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGJ4"
FT                   /protein_id="ABR65570.1"
FT                   /translation="MPTINVNKVDLERLSNISLSDKMIEDRFPMMGVEVEEIFEEVDKS
FT                   GKKQKMVQFSINPDRPDYLSVEGLARGFRGFMGITTGIQEFEVLPSDIKVTVEENKTRP
FT                   YVAFALVKNVLMDELVLESMINLQEKLHWAIGRDRKKLAIGIHDFDKVKAPFTYKEIKG
FT                   DEIKFVPLGYEDEEMTPREIIEKHEKGIKYAHLIQDDRFPIIVDVNGEVLSLPPIINGT
FT                   LTKVTPTSKNLLIDITGTEKEAVEETLNIIVCALAERRGTIVSVNVNGKKYPDLTLKSR
FT                   IISIESINKKLGLELNPGEIIQAVKKSGMDALYEDGNLIVKIPAYRNDILHNVDLKEEI
FT                   AINYGYEKFEGKLPSVATTGSKDPVEKKCNAMSDLMIGLGFYEVMNLTLSNQDTLFEKM
FT                   NLKVEEKDYIEVLKPASIEHRVLRTSILPLLLETLYINKHHSLPQKIFEIGDCVIIDEN
FT                   DTETDTKCKNIKKIAGAITHPLTNFNEIKSSTEALLREFFEDFEFENYEHPAFIPGRCA
FT                   KIIKDGKEVGFFGEIHPEVILNFELEHPIVGFEITIE"
FT   gene            508000..508497
FT                   /locus_tag="MmarC7_0502"
FT   CDS_pept        508000..508497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65571"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ5"
FT                   /protein_id="ABR65571.1"
FT                   /translation="MQLFILDSDPAKAAKMHCDKHVVKMPLEAAQILSTVHHIHASIYK
FT                   EKCYKKTHEKHPCVIWASKTRKNYEWTLNLLKALLAEYTYRYGKIHKSSEILNYLEYNP
FT                   VKSDLNELTPFAQAIPTEYISNDAVSAYRKYYIAEKSRFCKWTKRKAPDWYLKGLKKDN
FT                   KT"
FT   gene            complement(508498..509172)
FT                   /locus_tag="MmarC7_0503"
FT   CDS_pept        complement(508498..509172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0503"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: mmp:MMP1257
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65572"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ6"
FT                   /protein_id="ABR65572.1"
FT                   /translation="MGFITSISQHSLSPITGRLEDFPINLFLRNLDKNEYSILKNYNLE
FT                   CNGDSAVIDYLIISRYGIFVINSKNISGIIAKSKDGKWIQKTNGRENLIENPLLKNDKS
FT                   IKMLKEMFSLNIEIIPITVFNATSKIEVEFDSVINSPKLIRQIKQYENPVIDKKEVENI
FT                   LYALLHHNNSKPGLNVGEYPVVKIINGDKNYFCPKCGSKLKTSEIEKSHKCPNNLKCGL
FT                   KL"
FT   gene            complement(509202..510170)
FT                   /locus_tag="MmarC7_0504"
FT   CDS_pept        complement(509202..510170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0504"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   mmp:MMP1258 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65573"
FT                   /db_xref="GOA:A6VGJ7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ7"
FT                   /protein_id="ABR65573.1"
FT                   /translation="MLIRPRRLRTNQKIRDLVRETVLTKNDLVMPIFIDENLKNDEKTP
FT                   ILSMPGQFRYGIDSAVNECVEISKSGVPAVILFGIPTEKDEFATSAINENGGVQKVISK
FT                   VKANLGDDLLVIADVCMCEYTSHGHCGIINGEEILNDETLEILGNIALSYAKAGVDIVA
FT                   PSDMMDGRVLKIRNVLDENGFKNVSIMSYAAKYASAFYGPFRDAAESTPQFGDRKSYQM
FT                   DIGNSKEALKEIELDIQEGADLILVKPALPYLDIVKMAKEASNIPVGGYCVSGEYSMIE
FT                   AAAQNGWIDRERAIFETLLGIKRAGADFIITYWAKEVANWL"
FT   gene            complement(510313..511641)
FT                   /locus_tag="MmarC7_0505"
FT   CDS_pept        complement(510313..511641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0505"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: mmp:MMP1259
FT                   NAD(P)H: rubredoxin oxidoreductase (NPOR)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65574"
FT                   /db_xref="GOA:A6VGJ8"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ8"
FT                   /protein_id="ABR65574.1"
FT                   /translation="MDVVIVGSGAGGLTTASNIKKHDKNAKVTVITSDNYIAYSPCAIP
FT                   YVIGKEIADFESIIMHTPEDYKTKGIDVIIEAEVLDVVSNENKVIYKKDGTETEIKYDN
FT                   LVLATGGTPFVPPIEGVNLDGVFKVRTIDDGQKITEWAKDTKNAVVAGAGAIGIEIAFG
FT                   LKELGLDVTVVEMVPQVFPRALDPDMAETVQKYLEEQGIKIILEKPVGKIIGNDKVEAV
FT                   LVGEETIPAEMVIMSTGVRSNIELAKKAGCEIGRWAVLTNEKMQTSIENIYAVGDCVEV
FT                   IDAITMQNTLSPFGTTAVRQGKVAAKRIAGLEAEIKPVLNSMVSKIGSLEIGGTGMTET
FT                   AAKMNGIEVVLGYSKALTRARYYPGGKAIYIKMVADKNTNRVIGCQIISEERVAERVDA
FT                   MSVAISNGMTVEELANQEFCYAPPVSMVIDPIVFAAEDTLDKF"
FT   gene            complement(512018..512794)
FT                   /locus_tag="MmarC7_0506"
FT   CDS_pept        complement(512018..512794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0506"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   mth:MTH571 nitrogenase reductase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65575"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGJ9"
FT                   /protein_id="ABR65575.1"
FT                   /translation="MPKMIICGRGGCGKSTLITLMAQKIDEQGKKVLIVDSDESNLGLS
FT                   TMVGTGPAEKTLMDYLGGRPVVMGKLMAAMRTNWEEKLELFQESSLNELSSEFVSWNGN
FT                   KGFMQIGKIEHSHEGCACPMGVIAKDFLNHVIVDKNEWVLVDTEAGVEHFGRGIVEGVD
FT                   SVIMVIDPSNDAVLLSEKVSELSKEAGKPFGVVLNRVDDETRSILEDAISEKNIPIIGV
FT                   IPYSKTMARENLKGNRLDNNMIEGDIGEIITSVESK"
FT   gene            complement(513015..514163)
FT                   /locus_tag="MmarC7_0507"
FT   CDS_pept        complement(513015..514163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65576"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK0"
FT                   /protein_id="ABR65576.1"
FT                   /translation="MLLIKKFAIIASLLLALLFAGCTDSTSSDAEVADLKVAYLTSDHD
FT                   APLFVAAEYPELFQEEYGVYLKEVEDKNTYELYENDKLVANVEFIKVIEGGAKIMTLMA
FT                   QGQVDVGLNGVPPAVFSIDQGSNAKIVSPAQSEGSAIVIRSDIPAENWEEFVEYVKKQA
FT                   ESGVQVKIGHPLPTSIQYVMIKSALDTEGITYTENPNEKDAMVQLINCKGQGTMPQLLS
FT                   SNELDAVIAWEPTPEQLAVSGIGKSVLYSGDIPPEGMWENHPCCVFVASNNAIENKRDG
FT                   LKTFLKLMALSNNEITANQELAINASAEWLGTDLEVEELSIPNIGFTNEIGSLESIGPE
FT                   FVKVMDEQGAMTGQLAGLENAEEINAILYDFTIYNEIMEEIQ"
FT   sig_peptide     complement(514071..514163)
FT                   /locus_tag="MmarC7_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.618 at
FT                   residue 31"
FT   gene            complement(514269..514841)
FT                   /locus_tag="MmarC7_0508"
FT   CDS_pept        complement(514269..514841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65577"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK1"
FT                   /protein_id="ABR65577.1"
FT                   /translation="MVTIVPINEEERASILNGLKSSVPATKLITLKKIVDLTVLRPESL
FT                   QYMEMTDKMSIQRIISGIERIMDYDIDEVLKREAAIALEKVKVTLGSKFVENLIYCQNC
FT                   NSVVDIGWENCANCGSNLTEMIYPETKPCPNCNKHTTENWNNCAHCGFQLIKEEDKVQK
FT                   CTGCKREVDPTWMVCPYCGTRLKGSKK"
FT   gene            complement(514819..515342)
FT                   /pseudo
FT                   /locus_tag="MmarC7_0509"
FT   gene            complement(515360..516169)
FT                   /locus_tag="MmarC7_0510"
FT   CDS_pept        complement(515360..516169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0510"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mmp:MMP1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65578"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK2"
FT                   /protein_id="ABR65578.1"
FT                   /translation="MSFEVTFDGVKYSCVNCTYCCSCKSWRVYLSYFDRMRLEGYENYI
FT                   EKSNSEYGHVLALRNGKCGLIENNLCKLQIEKGYDSKPAMCKLFPFSFMVKWNGEMLLI
FT                   LKHYCNGIQAGKTSKRTINHAIECCEELYHDQLSELSINGTEASEKTQLDEKTKIYWEE
FT                   REELGKYLFKTKKFDSFSEKYFEIFSEGASDTIDKIKSKNNFDIKIKKSREKEILRYMQ
FT                   ELNKREHFRKMSFKKELDNLINVGLTISDYEDPLKGEAVIDSKLLLN"
FT   gene            complement(516186..517679)
FT                   /locus_tag="MmarC7_0511"
FT   CDS_pept        complement(516186..517679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0511"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   mmp:MMP1264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65579"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK3"
FT                   /protein_id="ABR65579.1"
FT                   /translation="MDNLMGYVIGETSNTELNFLAKQLPEIGSYVSINYCDLEILGMVE
FT                   SVNQGCKIFEEVYNIKDFEKLKYFENNDSYYTIGKIKILGDVKNMQIPRIPPKPGTEVY
FT                   NASEKILGEIFSKGTIEIGNLISADSKVKLDVNKLCSRHLAILAITGMGKSNTVSVLLE
FT                   ELNNIHATVLVFDMHREYVEIEAKSSIIRRNIIRPKINVYNMSYDALMTLAGVDPQATV
FT                   QRAMGRRAMKKIKETYKEVDFNTVDEYINSIINELNYYMGMDEFKSKVDSILTLIMRFE
FT                   DLMTFKDKITAINYNPIQDIKENYVNIVDISELDESSTDLIISYFTGEILKDRKKVLWD
FT                   TKVAKPIFIIYEEAHLIVPQNRPTKSKVPISKIAREGRKFGVGICLVSQRPKTLDQESL
FT                   SQCNNFIISKLIEPSDQKHVQHASENLSEDLLKQLPGLNVGEAVIIGPCLKIPAMVKIK
FT                   RFEGEYGGEDVKFDELWTIEKEKNIPEFIESNELFNDDL"
FT   gene            complement(517770..519665)
FT                   /locus_tag="MmarC7_0512"
FT   CDS_pept        complement(517770..519665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0512"
FT                   /product="putative aspartyl-tRNA(Asn) amidotransferase, B
FT                   subunit"
FT                   /note="TIGRFAM: putative aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit; PFAM: GatB/Yqey domain
FT                   protein; GAD domain protein; GatB region; GatB central
FT                   domain protein; KEGG: mmp:MMP1265 glutamyl-tRNA(Gln)
FT                   amidotransferase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65580"
FT                   /db_xref="GOA:A6VGK4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004414"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGK4"
FT                   /protein_id="ABR65580.1"
FT                   /translation="MDYDYEKLGLKVGLEIHQQLNTKRKLFCNCPTKIRDDEPHGEIER
FT                   VLRPSQSEMGHVDKAALLESKKEKKFIYQYYNDTTCLVELDDEPPHDVAPEAVDTALEV
FT                   STLMNMKMADEIQVMRKMVIDGSNTSGFQRTMFVSQEGFIETDYGNIGVTSICLEEDAC
FT                   KKIEDGKDYTKYCVDRLGIPLLEITTEPDITSPKMGKEAARRIGTILRATGKVKRGLGT
FT                   IRQDVNISIKGGARIEVKGVQNLDLIEKIIENEVTRQISLNEIKEELLKRNAEVIDEIK
FT                   DITELLKDTESKVLKSALKNKGVIKAILLNGFSGMIGREVQPGRRLGTEFSDRGKVLGG
FT                   VGGLFHTDELPKYGITEEEVIKLKEFMSCGENDAVILVADKKNKVERALNAVIERAKES
FT                   MIGIPEETRKALDDGNTSYLRPLPGAARMYPETDVPTITITEEKLEMVRNNLPEMPEEK
FT                   LVRFVNEYELNEDLAKQMVMSYHVDLFESLAKKYSKIKPTLIATTLEATLKEIKREGLE
FT                   TEVLTEEHLDEVFKGLSEDKMSKEAVPDVIKGFIENPAKNLDEVLEIKGMSSMSVEEVE
FT                   SIIEDIINQNISTVNEKGMGAMGLLMGRCMAQLRGNADGKLINTTLQKKLKEKVQ"
FT   gene            complement(519697..520953)
FT                   /locus_tag="MmarC7_0513"
FT   CDS_pept        complement(519697..520953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0513"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, subunit D"
FT                   /note="TIGRFAM: L-asparaginase, type I; glutamyl-tRNA(Gln)
FT                   amidotransferase, subunit D; PFAM:
FT                   Asparaginase/glutaminase; KEGG: mmp:MMP1266
FT                   glutamyl-tRNA(Gln) amidotransferase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65581"
FT                   /db_xref="GOA:A6VGK5"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGK5"
FT                   /protein_id="ABR65581.1"
FT                   /translation="MDIGDFVKLKLENTTYSGTVMPSLNEDTIVIKMKSGYNVGIDKNK
FT                   IKNIEILESGDKPKYGLPPLNLEKNPKLKNISILSTGGTVASRVDYKTGAVHPAFTADD
FT                   LIMAVPELLDIANIKGKVILNILSENMLPKYWVMTAEAIKEEIENGAEGIVIAHGTDTM
FT                   HYTASALSFMVNSEVPIILVGAQRSSDRPSSDAALNIISAVKAATEPIKGVYVLMHGET
FT                   GDTVCHLHEGTKVRKLHSSRRDAFKSVNKTPFAEINPFTKEVKYLRDVKNQDKSKIKEI
FT                   VLNTNLEEKVALIKVYPGIDSEILKFYVDKGYKGIILEGTGLGHTPETFFEGIDYANEN
FT                   NVLVAMTTQTINGRVNMNVYSNGRELQAKGVIPCEDMLSEVAFVKLMYLLGNYEIEDAK
FT                   ELMSKDIAGEINESINLEC"
FT   gene            complement(521047..521757)
FT                   /locus_tag="MmarC7_0514"
FT   CDS_pept        complement(521047..521757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65582"
FT                   /db_xref="InterPro:IPR024131"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK6"
FT                   /protein_id="ABR65582.1"
FT                   /translation="MRILDIDLDFFLNKIAFWKKGNKRLDEKEYVVWKKDKFIEFLENN
FT                   CNLSKNNKIKGRIVKKHHEAFYFWRELIEKNEIEVPFDVIHIDAHADLGLGDFSYKYIM
FT                   EELLHKPVEKRNDPEMMYEGNYLAFAIANRWIDRLTYVTHPKGGNDLLNFHFKDYDVKS
FT                   GIIQLKKTEKIENEIKNVKILDLEPEVPFKLISGNDYIEKGNFDYVVFSISPKYTPKTI
FT                   DRLIPIVKEYIEEI"
FT   gene            521895..522911
FT                   /locus_tag="MmarC7_0515"
FT   CDS_pept        521895..522911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0515"
FT                   /product="Domain of unkown function DUF1786 putative
FT                   pyruvate format-lyase activating enzyme"
FT                   /note="PFAM: Domain of unkown function DUF1786 putative
FT                   pyruvate format-lyase activating enzyme; KEGG: mmp:MMP1268
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65583"
FT                   /db_xref="GOA:A6VGK7"
FT                   /db_xref="InterPro:IPR014846"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK7"
FT                   /protein_id="ABR65583.1"
FT                   /translation="MNILCIDIGKGTQDILYFDTEKNVENAIKLILPSPTTIISRKIMK
FT                   LKEDLRINGKLMGGGPVSFAIMQKLKKGYNVEISERCARTIRDDLDEVREKGIVIKDEI
FT                   KNPNVNLEDLDFEMLKSIFSSMNQEFSPDVVCVACQDHGFVKGQSDRITRFKYFEKKLN
FT                   ETKDPYEFYFDNKKHKTDNFSRFESILKTLDENKYNGFVMDSKMASVCGILNYANENNI
FT                   NEFIGLDIGNGHTLGVSMQNQKINGLFEHHTRLIDAQKLKDIVERTCNGTLKNEEVYKD
FT                   NGHGACVTCKTEPESILIAGPNRELFKNYGAYAYPGGDVMITGCIGLLDVYNKIGKI"
FT   gene            complement(522936..524252)
FT                   /locus_tag="MmarC7_0516"
FT   CDS_pept        complement(522936..524252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0516"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase;
FT                   Dimethylmenaquinone methyltransferase; KEGG: mmp:MMP1270
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65584"
FT                   /db_xref="GOA:A6VGK8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017120"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK8"
FT                   /protein_id="ABR65584.1"
FT                   /translation="MQVKSELPPVQVALDLVDLPRAIEIAKEAVAGGVTWVEAGTPLIK
FT                   SEGMNAIRELRKNFQNLTIVADMKTMDAGSTEVEMAAKAGANVILILGVGPDSMIKDAV
FT                   KAGKKYGVLVGTDLIATEDPIKRAVELEEMGVDIINIHVGLDQQVLNVDPVELVKRVSE
FT                   NCKKAKIAAAGGLNSETAVKAYEAGADIIIAGGTLYKSADPEQTARDIIKGLETGKPVK
FT                   TDKFKKFNENELVNAFNVVSTSNISDAMHRTGEMNGLKPVWNSEKPLKFAGPAVTVRTY
FT                   SGDWSKPVSAIDDCEAGNVLVIDNCSSEIACWGGLATLSCKTKGVVAIVIDGAVRDVEE
FT                   ILKIGIPVYARSITPTAGEPKGFGEINAVIECAGRTVEPGDWIVGDENGIIVVPKNEAM
FT                   EIANRAIDVKEREDRVKEEITRGTTLAKTIRLKDWELKK"
FT   gene            complement(524338..525777)
FT                   /locus_tag="MmarC7_0517"
FT   CDS_pept        complement(524338..525777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0517"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   KEGG: mmp:MMP1271 2-oxoisovalerate oxidoreductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65585"
FT                   /db_xref="GOA:A6VGK9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGK9"
FT                   /protein_id="ABR65585.1"
FT                   /translation="MTEITEKIMKKPNAMPEVFERKGGSAPTATHYCAGCGHGIIHKLM
FT                   AEAIDELEIVDRCVLISPVGCAVFAYYYFDCGNIQVAHGRAPAVGTGVSRAEGNAIVMS
FT                   YQGDGDLASIGLNETIQAANRGEKMAVFFVNNTVYGMTGGQMAPTTLIGEKTVTCQTGR
FT                   DPRFAGYPIHMCELLSSLKAPVFIERVSVSDIAHIRKAKRAIKKALEIQRDGKGYAFVE
FT                   ILSPCPTNLKQDAKAAEKFINEEMEKEFPLQNFRDRSAEVETLDRGESDFSKECLDKIF
FT                   EVNSKGSEDPSEDLSFEEKLVKIAGFGGQGVLSMGLTLAEAACRDQKYVSWYPSYGPEQ
FT                   RGGTSNCSVIISGHEIGSPVVYSPGVLIALNKPSLENFAKDVKVGGTIIYDENIGDFEI
FT                   PNGVTAIKVPASKIATEMGVSRAANTVMLGVLSAIGYTGLSESVFVGAIEQTFSKKPKL
FT                   IPINVEILNAGISWAKENLAL"
FT   gene            complement(525779..526834)
FT                   /locus_tag="MmarC7_0518"
FT   CDS_pept        complement(525779..526834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0518"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: mmp:MMP1272 2-oxoisovalerate
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65586"
FT                   /db_xref="GOA:A6VGL0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL0"
FT                   /protein_id="ABR65586.1"
FT                   /translation="MATQLVKGNTAVIIGAMYAGCDCYFGYPITPASEILHEASKYFPM
FT                   VGRKFVQAESEEAAINMVYGAASTGKRVLCATSGPGMSLKQEGISFLAGSELPCVLVNV
FT                   QRAGPGLGNIGPEQADYNQAVKGGGHGNYKNIVLAPNSVQEMCDFTAKAFVLATKYKNP
FT                   VIVLSDGVLGQMVEPLKFPEQAIKPEIDDSWAVRGTKETRKNLVTSIFLDFKELEEFNY
FT                   KLQDKYAVIKENEQDFEGYMLEDAEIILVSYGISSRISKTAVDVARKEGIKVGLFRPKT
FT                   LYPFPEKELNKLAERKCTFISVEMSNGQMAEDIKLATCCKRPIELVNRLGGNLIEVDQI
FT                   LAKIKEIAGGN"
FT   gene            complement(526845..527102)
FT                   /locus_tag="MmarC7_0519"
FT   CDS_pept        complement(526845..527102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0519"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1273 2-oxoisovalerate oxidoreductase
FT                   subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65587"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL1"
FT                   /protein_id="ABR65587.1"
FT                   /translation="MKTDENMECSTKKPYPVINTLECKACERCIIACPKDVLEMSKDWN
FT                   ERGYHYVIYTGEGCTGCGNCYYTCPEPLAIEVHIPLKKCD"
FT   gene            complement(527164..528843)
FT                   /locus_tag="MmarC7_0520"
FT   CDS_pept        complement(527164..528843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0520"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmp:MMP1274 acetyl-CoA synthetase, AMP-forming-related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65588"
FT                   /db_xref="GOA:A6VGL2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL2"
FT                   /protein_id="ABR65588.1"
FT                   /translation="MVSLVNEYVKKTEFESYEDFVETFKIDVPENFNFAYDIVDEYAKI
FT                   APEKIAIVWCDDNNDEKIFTFNDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFC
FT                   MLGLHKIGAVAIPATHMLTTKDIVYRIEKAGLKMIVCIGENGVPEYVDEAVSEINSDVL
FT                   KACVVNLNQKNWIDFSKELGESSEEFTRPVGEMDTKNNDVLVAYFSSGTTGYPKLIQHD
FT                   HEYPLGHITTAKYWQNVEDDGLHYTVADSGWAKCIWGKLYGQWIAGTAVFVYDYDRFDA
FT                   GNMLEKIAKYKVTTFCAPPTIYRFMIKQDISKADFSSVHYAVTAGEPLNPEVYNKFLEF
FT                   TGLRLMEGFGQTETVVSVANFPWMDPKPGSMGKPVPIFDLMIKGPDGKECDVGEEGELV
FT                   FKTKDGKPLGLFSGYFKDPERTKKSWYDGYYHTGDTAWKDEDGFLWFVGRNDDLIKSSG
FT                   YRIGPFEVESALISHPAVLECAITGVPDPIRGQIVKATIVLTPDYEASEELKKELQDHV
FT                   KHNTAPYKYPRAIDFVKELPKTISGKIRRVEIREKDEEKSNN"
FT   gene            complement(528882..529436)
FT                   /locus_tag="MmarC7_0521"
FT   CDS_pept        complement(528882..529436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0521"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: mmp:MMP1275
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65589"
FT                   /db_xref="GOA:A6VGL3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL3"
FT                   /protein_id="ABR65589.1"
FT                   /translation="MKEKMKEIASRVRELRELSEISIEEMADHLNVSPEIYQHYEEGTC
FT                   DIPASVLYEIAHKFEVDMGLLLTGEETRMHIFTVTRKGKGVSVERRKQYKYENLAEKFI
FT                   HKKAEPFIVTVEPRTDGKKPSKNSHPGQEFNYILEGTIKLYIHNNEVVLEEGDSIFFDS
FT                   GYDHAMEALNGKNAKFLAIIM"
FT   gene            complement(529678..531297)
FT                   /locus_tag="MmarC7_0522"
FT   CDS_pept        complement(529678..531297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0522"
FT                   /product="Succinate dehydrogenase"
FT                   /EC_number="1.3.99.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: mmp:MMP1277
FT                   fumarate reductase/succinate dehydrogenase, flavoprotein
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65590"
FT                   /db_xref="GOA:A6VGL4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL4"
FT                   /protein_id="ABR65590.1"
FT                   /translation="MITDVLIIGGGGAAARAAIECGQKNVVIASKGLFGKSGCTVMAEG
FT                   GYNAVLNPEDSFEKHYSDTMKGGGYINNKKLVEVLIKNAPKEFKNLEKFGCIFDRSEKA
FT                   EFAQRPFGGQSFNRTCYSGDRTGHEIIAGLMEYLNKFERIKILEDTMAIKLIVDEVEEN
FT                   GKKLKKCFGAVFLDLLNGDIYPVYAKSTILATGGAGQIYPITSNPKQKVGDGFAIAYRE
FT                   GVELVDMEMVQFHPTGMLGTGILVTEAVRGEGGILYNKNKERFMKNYDSKRMELSTRDV
FT                   VAKAIYNEIQEGRGIDGAVYLDVTHLDPEIIEEKLETMFSQFLMVGVDIRKEPMKVAPT
FT                   AHHFMGGIKINENCETNISGLFACGEVAGGIHGANRLGGNALADTQVFGAIAGKNALNY
FT                   AEMELDISKVYAFVEEYIQDLKNTFKDSNSGDNVYSLIDELKKTMWDFVSISRDEIGLN
FT                   AALEKINEINGKAVSINGIVDFSKKLELENMILVSEIVINSALLRTESRGAHFRNDYPK
FT                   TNDGCTGNFVACDGKIKFEKIE"
FT   gene            complement(531320..531649)
FT                   /locus_tag="MmarC7_0523"
FT   CDS_pept        complement(531320..531649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0523"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   mmp:MMP1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65591"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL5"
FT                   /protein_id="ABR65591.1"
FT                   /translation="MKKISAKLLRIYLKEEDKYGKELLINSIIKTLKSNGIAGATVFKG
FT                   YCGYGTRGFSRIDILRLSMNLPAVIECIDYEEKLNDIMPKLVEMVSENGLITVQDIEVF
FT                   KELKK"
FT   gene            complement(531654..532022)
FT                   /locus_tag="MmarC7_0524"
FT   CDS_pept        complement(531654..532022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0524"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: mmp:MMP1279 camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65592"
FT                   /db_xref="GOA:A6VGL6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL6"
FT                   /protein_id="ABR65592.1"
FT                   /translation="MREILLIGLGGFFGAILRYFVSGIIPVKFGIPTGTLIVNLLGSFI
FT                   LGFIVYSSLFGSLSPEYRLLIITGFCGALTTFSTFSYESFVMLEYNHYLEVGLNIILNV
FT                   FGCLVMIYFGRLASMFFW"
FT   gene            532127..532204
FT                   /locus_tag="MmarC7_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            532127..532204
FT                   /locus_tag="MmarC7_R0003"
FT                   /product="tRNA-Arg"
FT   gene            complement(532276..532614)
FT                   /locus_tag="MmarC7_0525"
FT   CDS_pept        complement(532276..532614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0525"
FT                   /product="protein of unknown function DUF486"
FT                   /note="PFAM: protein of unknown function DUF486; KEGG:
FT                   mmp:MMP1280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65593"
FT                   /db_xref="GOA:A6VGL7"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL7"
FT                   /protein_id="ABR65593.1"
FT                   /translation="MKQYLPVLLLVLSNIFMTFAWYGHLKYKMSPLWIVILVSWGIAFF
FT                   EYCLQVPANRIGSNYFTPAQLKVIQEIITLVIFSIFSVLYLKEEFRWNYAVGFFFIILA
FT                   AIFIFKKW"
FT   gene            532686..533198
FT                   /locus_tag="MmarC7_0526"
FT   CDS_pept        532686..533198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0526"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmp:MMP1281 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65594"
FT                   /db_xref="GOA:A6VGL8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGL8"
FT                   /protein_id="ABR65594.1"
FT                   /translation="MSTNLKINIRPTTVSDAPLIFEFINELARYENLEDSVLATEEIIK
FT                   ESLFGKKQYAEALIVEADLKPVGLVLFFHNFSTFLGKPGIYIEDLYIREEFRGIGIGRK
FT                   TFEYLSNLAKERNCGKIEWTVLDWNPARKFYEKMGAVPVDDWLIYRLTGDKIDELSEKY
FT                   QKSENKN"
FT   gene            complement(533214..533765)
FT                   /locus_tag="MmarC7_0527"
FT   CDS_pept        complement(533214..533765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65595"
FT                   /db_xref="GOA:A6VGL9"
FT                   /db_xref="InterPro:IPR022970"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGL9"
FT                   /protein_id="ABR65595.1"
FT                   /translation="MKLIGITGMPGSGKSAITKLAEKYKITVVSMGDVVRHETSKQGLI
FT                   LNPENVGNTAVKLRELHGKEAIAIPCLNYVNEKYNCEDFVIIEGIRSIYEVNYLKKHAK
FT                   LDIIAIHSSPKTRFDRLSGRNREDDSNDWNTFVERDERELNFSIGNVIALSDYMVVNEG
FT                   NYNDFIHDLENTLKNIIKAD"
FT   gene            complement(533804..534007)
FT                   /locus_tag="MmarC7_0528"
FT   CDS_pept        complement(533804..534007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65596"
FT                   /db_xref="GOA:A6VGM0"
FT                   /db_xref="InterPro:IPR007166"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM0"
FT                   /protein_id="ABR65596.1"
FT                   /translation="MSVALKKFFSNRGQLSLEFSVLILAVITAAILLGYHLIVSSKAVQ
FT                   ESNIDTINNTHNTAMDALSEVS"
FT   gene            534120..536555
FT                   /locus_tag="MmarC7_0529"
FT   CDS_pept        534120..536555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0529"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: mmp:MMP1284 DEAD/DEAH box
FT                   helicase:helicase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65597"
FT                   /db_xref="GOA:A6VGM1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM1"
FT                   /protein_id="ABR65597.1"
FT                   /translation="MIIVRKLKKKKEEIQFVDLTDERAYYGIIRPANNRITLYKCREEK
FT                   AGNVNPVQPSKLLNFVRSNKVFLSTDEESLKLEEFLKQNNIKYGYIDLCPFCIIKGKFS
FT                   EITDKYKIYNSETCLECAIDEVKHEVAVNEEFIEKLLRRFKDANKVIELFKSKNPLKNP
FT                   ELTKYDVLTGNVDDEIKNYTIDELEIPDFLKEIIKNRGIDELLPVQTLSVKAGLLKNDN
FT                   LLITSATSSGKTLIGELAGIKNISEKKGKFLFLVPLVALANQKYVEFKERYENEGYSVS
FT                   LRVGMGRLSENKGGDINSSIDSDIIIGTYEGIDYLIRSGKLKDVGTVVIDEVHSMNMDE
FT                   RGARLDGLIGRLRYLFNCQMIYLSATVGNPEELASKLGSKLVLYNGRPVPLERHLIFTK
FT                   NDYGKLNLVNDIVKQEFSSKSKYGFRGQSLIFTFSRKRAEYISNYLNTKGIKSDYYHGG
FT                   MEYSKRRTVEDNFLKQKTMCVVTTAALAAGVDFAASTVVLESLAMGGDWLNPSEFQQMC
FT                   GRAGRKGMHDKGKVYSLVEIGKKYHAKMENSEDEISFKLLNSEPEEVSLEYSEDEEFEQ
FT                   VLANVCAIKNYRSKVTIPDVSKVPVLGKNLGLNYVLDSLSNFHMLELQNKNINTTRYGY
FT                   ATSVSFLYPKDAEKIRKNLHKDPIDLVVSISPFENVYIPANLKNKITKTTNTNIPTRFT
FT                   DAFEVIKENFEKIKDKTLRDEILPWLIEFDEMIEEDIINYNSKKVLNLRIIKKTPLQIS
FT                   KVIHDVLKLQTYSGDIYSYLETAINTLDAVERIGNIYNKKIAKESAILKKKMENPYKN"
FT   gene            complement(536552..537352)
FT                   /locus_tag="MmarC7_0530"
FT   CDS_pept        complement(536552..537352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65598"
FT                   /db_xref="GOA:A6VGM2"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM2"
FT                   /protein_id="ABR65598.1"
FT                   /translation="METLILFTLILILSANFSRYSFEDNSNEIEEDLFEPIILIHDVSP
FT                   VYLEDLKEIDEVISKYGYSKRTYLFLIVNHANDNPLKENQNFVKYIRYLQTKGYNVELH
FT                   GYDHIEREFDCNYSIASEKIEKSLEILNTYKFDEISCILPPRYGISEDSKKAMLNNGFS
FT                   IIIGQYAFEMNNNSVYTYNITNKEYTWYLEENNTKNQLNLAEEEYLESEYKYFLSIHPK
FT                   AVNYGGGIEFLNEFLNFTKEENRFNSEDPMDVYMYFGIKKIDFS"
FT   sig_peptide     complement(537281..537352)
FT                   /locus_tag="MmarC7_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.476 at
FT                   residue 24"
FT   gene            complement(537473..537545)
FT                   /locus_tag="MmarC7_R0004"
FT                   /note="tRNA-Gly2"
FT   tRNA            complement(537473..537545)
FT                   /locus_tag="MmarC7_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(537564..537636)
FT                   /locus_tag="MmarC7_R0005"
FT                   /note="tRNA-Gly1"
FT   tRNA            complement(537564..537636)
FT                   /locus_tag="MmarC7_R0005"
FT                   /product="tRNA-Gly"
FT   gene            537870..539189
FT                   /locus_tag="MmarC7_0531"
FT   CDS_pept        537870..539189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0531"
FT                   /product="TOPRIM domain protein"
FT                   /note="PFAM: TOPRIM domain protein; SMART: Toprim sub
FT                   domain protein; KEGG: mmp:MMP1286 DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65599"
FT                   /db_xref="GOA:A6VGM3"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGM3"
FT                   /protein_id="ABR65599.1"
FT                   /translation="MDLGTTKYIIYTELIADGYVEKHDVIGAIFGQTEGLLSNELDLRD
FT                   LQKSGRIGRIDVDLENINGKSFAKITLPSSLDKVETSILAATLETIDRVGPCFATVKIT
FT                   EVEDIRVSKRQYITNRARSILRKLMDEMIDTYEITEEIKESLRTEEIMEFGPENLPCGP
FT                   NVVHSDSIIVVEGRADVLTLLRCGIKNTVAVEGTSVPKSIMELTKKKTTTAFTDGDRGG
FT                   ELILKELLQTCDIDYVARAPYGKEVEGTSKKEIMKCLRAKVPVEQIVGNNCNNSCNVSE
FT                   VINSNSPEEIVESVTPKYFEKVETPVTEPVFDDNVVEEETVIVEPVKKTETEIIDVDAA
FT                   NESQVDKKFSGVKEIVDSIKNTGNVKFVVDGTEKTNTFKEFLTNIHEIKKMDFFAADMP
FT                   ISQKIVDLLYDKTPIIVGKEINVTKKPVNLRLFSFDEIVA"
FT   gene            539223..539516
FT                   /locus_tag="MmarC7_0532"
FT   CDS_pept        539223..539516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0532"
FT                   /product="Protein of unknown function UPF0058"
FT                   /note="PFAM: Protein of unknown function UPF0058; KEGG:
FT                   mmp:MMP1287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65600"
FT                   /db_xref="InterPro:IPR002753"
FT                   /db_xref="InterPro:IPR036519"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM4"
FT                   /protein_id="ABR65600.1"
FT                   /translation="MHKDELIQLHQLLVYMRKDLARKFGIELEESFKEYDELNIRPHHI
FT                   HRTKSEHTFAIFLLSGTIGKILSEKGNVPRSVASRLSDTGEKLSKEIARKKR"
FT   gene            539556..540833
FT                   /locus_tag="MmarC7_0533"
FT   CDS_pept        539556..540833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0533"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: mmp:MMP1288
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65601"
FT                   /db_xref="GOA:A6VGM5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM5"
FT                   /protein_id="ABR65601.1"
FT                   /translation="MVKNLVNSVEKVVFEKSTKKFGVSRILKENDDKPVFIKDVNGYPV
FT                   IGNLCTRDVIANSLGIEKEDLMKHMVESIDNEKKGELIVDESLEKLYINDDLEKIHEYP
FT                   IPTYYGKDAGPYLTSGVVIVKDKDEGVNASIHRILVRPDGNLAIRMVEQRHLHYIYNKN
FT                   IGNGEVDCAIVIGVHPAVLLAASTSGDVSFNELKYASALMKKPLNLVKCKTVDLEVPEA
FT                   EFIIEAKITAEMVDEGPFVDITGTYDVIRKQPLIKITALRRKEEAIFHALLPGGSEHKI
FT                   LMGLPQEPRMYKGIRNTVPSLKNVALTQGGCCWLNAVVSIDKKTEGDGKNAILAALAAH
FT                   PSLKHVTVVDGDINIYDANDVEYAVATRVQSDKDIIIISGAKGSSLDPSADHKNKLTAK
FT                   MGIDATMSLLKGKEEFIRAEIPENDE"
FT   gene            complement(540893..541414)
FT                   /locus_tag="MmarC7_0534"
FT   CDS_pept        complement(540893..541414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0534"
FT                   /product="ribosomal protein L10.e"
FT                   /note="TIGRFAM: ribosomal protein L10.e; PFAM: Ribosomal
FT                   protein L10E; KEGG: mmp:MMP1289 ribosomal protein L10E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65602"
FT                   /db_xref="GOA:A6VGM6"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGM6"
FT                   /protein_id="ABR65602.1"
FT                   /translation="MALRPARCYRTTERRSYTRKEYVRAVPQPKVVHYVMGNSSVEFPV
FT                   EVQLISKSDILIRHNALESSRIAGNKYILRECGRTGYLFNIRVYPHEILRENKMAAGAG
FT                   ADRISDGMRLSFGKAVGTAAKVKKGQEIITIGVNPEKFYAAKEALRRCSMKLPTACKIV
FT                   VTKGQDLIRD"
FT   gene            complement(541541..542224)
FT                   /locus_tag="MmarC7_0535"
FT   CDS_pept        complement(541541..542224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0535"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   mmp:MMP1290 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65603"
FT                   /db_xref="GOA:A6VGM7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM7"
FT                   /protein_id="ABR65603.1"
FT                   /translation="MQYENTNNENNTSGTQDIQKFKKYIRTEKKADERPKVIVMGRSNV
FT                   GKSTFVKLVTGKNVRVGKKPGVTLKISEYDMGTYILVDLPGFGFMEGIEKKAQEKIKDQ
FT                   IIDYVENNKDTIAASIHILDAKSFIDIVERWDNKGEVPIDLEMADFLEELELNPIFVVN
FT                   KMDKIKNSEWDNHLDRVSETLGFLPPWRQWLDNFVPAITRDNYGIDGIKHRINKRINGF
FT                   KKSKK"
FT   gene            complement(542238..543461)
FT                   /locus_tag="MmarC7_0536"
FT   CDS_pept        complement(542238..543461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0536"
FT                   /product="Alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   mmp:MMP1291 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65604"
FT                   /db_xref="GOA:A6VGM8"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM8"
FT                   /protein_id="ABR65604.1"
FT                   /translation="MLLSLNFEVHQPNRLRKSVNSNSGDLWNRYVDVELNKEIFNKVAD
FT                   KCYIPSNMIMLELIDNYDIEISYSITGVFLEQALEFNEEVVELFRDLAKTGNVEFLGET
FT                   YHHSLSSLFEEHDEFKEDILEHKKLIKELFGYKTTTFRNTELIFNNKIAETIKEMGFNG
FT                   MFTEGTNRILDWRSPNYVYSSLSGLNVLLRNYNLSDDIGFRFSSRDWKEYPLMADKYAN
FT                   WLSNTPGDCINLYMDYETFGEHQWYDTGIFEFLRHLPKELDNHNHIEYATPSEIFELCK
FT                   SKDTIDVFEFSTLSWADSERDISAWLGSKMQQLSFQKLKEIRGYLNQYLQQFDEKERKE
FT                   LIEYKIYKNMQTSDNFYYMCTKGFNDMDVHSYFSHFSTPYDAYAAYLDTYYDFKNHLVL
FT                   KLLSTYFK"
FT   gene            complement(543528..545393)
FT                   /locus_tag="MmarC7_0537"
FT   CDS_pept        complement(543528..545393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0537"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   mmp:MMP1292 glucan 1,4-alpha-glucosidase (glucoamylase)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65605"
FT                   /db_xref="GOA:A6VGM9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGM9"
FT                   /protein_id="ABR65605.1"
FT                   /translation="MVGIIGNGNILAKIDDSGSIEYMFYPSLGYEKHIFDASFAIFNHG
FT                   LKWAWDNNWDINQSYVKDTNILRTTYECNEFLMESRDYIPISHNIIIKQISISNKTDET
FT                   QDLKLFFYENLRMGEIPKENTVQFIKDHQTILKYDGTYSTCIGSDKKIDSYQCGVRSSD
FT                   KSALLDIANGLLKEYSSSSGLITDSAISWNLKLLPGQKQSVSVYIIINQYNGDYQKLME
FT                   IMDSIKVVIDNHEDFYQLTNSYWKNLLETTISKLSANELNRVMMCEDLCKRSFLTLLLL
FT                   CDRGGGIMASPSLYPDYRHVWCRDGGYIAVALSLCGQSSIVEKYFEWCRKTQNEDGSWV
FT                   QSYYINGIPRLTAIQIDQVGTTLWAALIHYRKSDNEKFLKKNWAMIKKAADYLSNVAVT
FT                   LYPSYDLWEEKYGVFTYTLGSVYGGLKSAIEIAKILEENSESIEKWQNASEFLKEEVVE
FT                   KIYLNDKNRFLKALHPKDEALDSSILGISFPFNLVNADDPKMVATADQIESAFNYKVGG
FT                   IGRYPEDVYFGGNPWIINTLWLYMYYEMLVYTLSKNKSIKKEILENYREKCSELFDWAC
FT                   KYTFSGLMPEQIHKDLGVPISAMPLGWSHAMFIIAIHGDFDILIP"
FT   gene            complement(545489..546664)
FT                   /locus_tag="MmarC7_0538"
FT   CDS_pept        complement(545489..546664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0538"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: mmp:MMP1293 glycosyl
FT                   transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65606"
FT                   /db_xref="GOA:A6VGN0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN0"
FT                   /protein_id="ABR65606.1"
FT                   /translation="MRVSIVTWEYHPIMVGGLAVHCKGLSEALVRAGNEVDVITVGYDL
FT                   PEYEEVNGVNVYRVKPISHNNFLTWAMFMANSLEKKIGSLGVENYDVIHCHDWMTSFVG
FT                   SNLKHTAKKPYVQSVHSTERGRCGGINSEDSIAINDAEWWGSYESNQLIAVSHSTKDEM
FT                   CYGFNTPWEKVNVIYNGVNPWEFDIDGNDNEKYNFRRSLGLSDNENMILFVGRLAYQKG
FT                   VEHLIRGFQKFLIGHPSSKLIVAGEGHMQGHLEHIAWTLGCRDRVIFLGFKNGNFLKKL
FT                   YKYADACVIPSVYEPFGIVALEAMAAGTPVVASDIGGLSEIINHEYNGVKVYPRDADSI
FT                   AWGLDRVISDWGFREWIIKNAKHDAYTKYSWDAIANQTVQVYKRAIEMMKQ"
FT   gene            546774..548345
FT                   /locus_tag="MmarC7_0539"
FT   CDS_pept        546774..548345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0539"
FT                   /product="Starch synthase"
FT                   /EC_number="2.4.1.21"
FT                   /note="PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: mmp:MMP1294 glycosyl
FT                   transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65607"
FT                   /db_xref="GOA:A6VGN1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN1"
FT                   /protein_id="ABR65607.1"
FT                   /translation="MKIAILTPTIAPLTSIGGLGDILEDLPKFLKNLGNEVFVITYDHQ
FT                   NKISKRPHEIIKKIEIKYQGSKFFFDVIKTVHPESNFEIFAFSNSEINSLDNWDPIKYE
FT                   IFADLVVSFLSDIENIECVSGHDWPCGLAIAKCHEKLNLPTTLTIHNEAFKGPIIEYKG
FT                   HVLSFLEHGIYFSDAFNTVSPNHAEEIRNLDFLKNLSKDKPFHGIINGIDSEIYAPEYI
FT                   VERMKILSNGKLNPKDYCYIENYDISNAAKVKPQIKESWFCNCKNLKKYINDWNEMDKS
FT                   NISGSNIEIYGSIKGELKTPLIGFVGRATYQKGFDLIFETMPEVLEENNASFILLSKGE
FT                   KSIEENIKDFAESYPNKIMALVGHCPPIVPIIYAGCDWTVVPSLWEPCGLTQMESMAYG
FT                   TPVIARNTGGLSDSVISLHPDPHKNPNFDIATGVLFNDYDKSGFKWGIEHGLYWTFYNL
FT                   DEACLFINYKHVHCPESPYEENSPLSLMIKNCYYHVQKNLSWQNNDSAERYRALFGGAM
FT                   YKHYFK"
FT   gene            548373..549686
FT                   /locus_tag="MmarC7_0540"
FT   CDS_pept        548373..549686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0540"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   mmp:MMP1295 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65608"
FT                   /db_xref="GOA:A6VGN2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN2"
FT                   /protein_id="ABR65608.1"
FT                   /translation="MNGELSFKYDNVMEESLGNSGISINELESFRDESSKTIEILKEKE
FT                   LNGNLGFLDVLNDNLDRYQELKEYSKNFENMLIIGIGGSNLGLRATEAGILGNFSSRYE
FT                   IPRIFYMDNSDPEKTQDILSNIDLEKTLVFVISKSGNTVETLANFFIVRTLMKKKNIDL
FT                   KKHVVSITSGGELKKITEKENYIHFEVPENVGGRFSVLSSVGIAPLSCTNVDIEKLIEG
FT                   AKSMEKSCKKEDIFKNPALLNAVIHKIMYNRGKTVSVMMPYIERLRSFGMWYGQLWAES
FT                   LGKKGFGQTPVIAVGATSQHSQLQLYMDGPDDKIATFLKVNKYKNDLKIEYEYEHHLSG
FT                   HNLSEIIGSELVGTENSMTHNNVPNVKISLSELNEITLGKLFLMYEMQTAISGELYGIN
FT                   AFDQPAVEYGKKIAHECLTGSKINSEKYLNGKYTITSK"
FT   gene            549707..551098
FT                   /locus_tag="MmarC7_0541"
FT   CDS_pept        549707..551098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0541"
FT                   /product="ADP-specific phosphofructokinase"
FT                   /EC_number="2.7.1.146"
FT                   /note="TIGRFAM: ADP-specific phosphofructokinase; PFAM:
FT                   ADP-specific phosphofructokinase/glucokinase; KEGG:
FT                   mmp:MMP1296 ADP-dependent phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65609"
FT                   /db_xref="GOA:A6VGN3"
FT                   /db_xref="InterPro:IPR007666"
FT                   /db_xref="InterPro:IPR011790"
FT                   /db_xref="InterPro:IPR015990"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN3"
FT                   /protein_id="ABR65609.1"
FT                   /translation="MELLNQFKNFSNVSIFLAYNVNVDALKYLADSSDIEKLKENFSDS
FT                   DIGLKIEEYPRTIEKPIDFVARLIHAMKSGKPAEVPLKNNLEIEPFFNGLNYNEERIGG
FT                   QVGIISNLLSILNLKRIIFYSPILAKKQAEMFENNENLVFPNLIDGKLVLKKPIESFKN
FT                   DELKINRIFEYKEDIEFHLQNEKIITPRSNRFIVASRPENLRIEIEKGLKNHLPDIGRL
FT                   VDCAIISGVQAIKEEYSDGKTAEYYLNRVKEDIKLLKKENKDLKVHFEFASIQNTEMRK
FT                   KIAESILPEVDCVGMDETEIANIIHVLGYEELSEGILKYSRIEDVLKASKILLERYNLE
FT                   GMQVHTLYYIMYLCKKGGILSDKSLEKTLEFATILASTKAALGQISNVGDLKIGLEIPH
FT                   NKHGQLLKELVEKISKEKELEDYRIILVPSRIVENPKSTVGLGDTISAGAFVGYVSELK
FT                   KLKNK"
FT   gene            complement(551100..552263)
FT                   /locus_tag="MmarC7_0542"
FT   CDS_pept        complement(551100..552263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0542"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: mmp:MMP1297 formate
FT                   dehydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65610"
FT                   /db_xref="GOA:A6VGN4"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN4"
FT                   /protein_id="ABR65610.1"
FT                   /translation="MSNEMYYVQASDPAILEKGECGGAVTALFKYLLDKGIVDGVLALK
FT                   KGLDVYDAIPTFVTSSEDLLSTAGSLHCAPTMWGGIIKEYLQDVKIAVPVKPCDMRAIV
FT                   ELAKRVQINLDNVYMIGLNCGGTVPPKTAMEMIKLFYEVDPKDVVKEEIDKGKFIIVMK
FT                   DGSHKEVKMHDLEDNGYGRRVNCQRCDEKIPRKADIAAGNWGVIGEDAGKYTFMEVCTE
FT                   KGKQLLKDAEKDGYVKTKAPNPKGIEIRAKVESSMLKMGEDYKNKWLEEKYPSIEEWNR
FT                   QWNKCIKCYGCRDVCPVCFCKECALTADYIDTGSIPPDPIMFQGVRMSHMAFSCVNCGQ
FT                   CEDVCPMEIPVARIFHKIQEKTRKELGYRPGVDDKAPPALGGSCPTQ"
FT   gene            complement(552299..554323)
FT                   /locus_tag="MmarC7_0543"
FT   CDS_pept        complement(552299..554323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:553928..553930,aa:Sec)
FT                   /locus_tag="MmarC7_0543"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: mmp:MMP1298 formate dehydrogenase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65611"
FT                   /db_xref="GOA:A6VGN5"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN5"
FT                   /protein_id="ABR65611.1"
FT                   /translation="MELNFIHTICPYCGTGCGVDLVVKDGKLVGTNPFKRHPVNEGKTC
FT                   IKGSYCHEFVHRDDRLKTPLIRKNGELVEASWDEALELISGKLKDYSPEEIGFFSSARC
FT                   TNEDNYVFQKFARTVMKTNNVDHCARLUHSATVVGLGQAFGSGAMTNSISDIEDADCIF
FT                   IIGSNTFEQHPLIARRVVRAKEKGTKIIVIDPRYTPTAKQADLYLQLLPGTNIAVLNAI
FT                   MNVIVKEKLIDEEFIKNRTKGYEELKKTLETYTPEYASKLSGVAPELIVEAAKMYGSAG
FT                   AASILYCMGITQFTTGVNNVKSCCNLAMITGNIGKPGTGVNPLRGQNNVQGACDMGALP
FT                   NVFPGYQAVPANHEKYAEAWNTSVDPNVGLSIPDMLAKAGEQVKCIYVMGENPMVSDPD
FT                   IHHVEHALKSLDLLIVQDIFLTETAQVADVVLPGASWAEKDGTFSNTERRIQKINKAVD
FT                   SPGEAIADWKIVKMIAEKMGQGELFNFNTPEEVFQEISKVTPQYAGVTYERLGVDGLHW
FT                   PCKTCEDPGTPILHCEKCLTPDGLGNIFAIDYADPDEMADLEYPMTLTTGRIIFHYHTG
FT                   TMTRRSKHMADEINEGFVEIHPEDAKNMGIKNKQKVKVSTRRGEVVVNAKVTPNIKQGV
FT                   VFMPFHFAETAANILTNPAQDPNCKIPEYKVCAAKVEKI"
FT   gene            complement(554628..555080)
FT                   /locus_tag="MmarC7_0544"
FT   CDS_pept        complement(554628..555080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0544"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: mmp:MMP1299 carbonic
FT                   anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65612"
FT                   /db_xref="GOA:A6VGN6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN6"
FT                   /protein_id="ABR65612.1"
FT                   /translation="MGENAKPKKKLAIVTCMDTRLVNFLSEKLGIAQGDAKVIKNAGNI
FT                   ITEDVIRSLVIAVYLLDVEDIMVIGHTDCGMAAADFETVKKKMVERGANPNFTPDFEAW
FT                   LGRMYCEETNVIEGVELLKNHPAFPKDINIDGYVMDIESGDLVKIA"
FT   gene            complement(555101..555634)
FT                   /locus_tag="MmarC7_0545"
FT   CDS_pept        complement(555101..555634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65613"
FT                   /db_xref="GOA:A6VGN7"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN7"
FT                   /protein_id="ABR65613.1"
FT                   /translation="MQLNVSLSDLKRHAKTTPSAFISLIICLVFTAWSVYVSRNIWILI
FT                   MAIPFILGLTLIPIKISQMNKELSDQLLPEYVNYAEEYNISEITKDSLNQRVKVTGKLD
FT                   KVIYGISTKPTIRVKDNTGEIFSNLISPVPEGIKKGDIIELYGIVAKDYKFFGIMGIPN
FT                   LWKPKIYGIGVRKI"
FT   sig_peptide     complement(555530..555634)
FT                   /locus_tag="MmarC7_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.486 at
FT                   residue 35"
FT   gene            complement(555672..556496)
FT                   /locus_tag="MmarC7_0546"
FT   CDS_pept        complement(555672..556496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0546"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG: mmp:MMP1301
FT                   formate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65614"
FT                   /db_xref="GOA:A6VGN8"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN8"
FT                   /protein_id="ABR65614.1"
FT                   /translation="MDVNPPDKMVELAGNAGQVKGNLSPSQLLVRGVMGGAYIAIGGGL
FT                   ATVVGTGIGTALGAGFGKFMAAAVFPVGLILIILTGMELVTGDMMLLPVAVFQRKASYA
FT                   QLIKVWIYVYIGNLIGSLIYASMMAFGPLRSFDTTTGAASVNAFGQSAINTAQAKVLPY
FT                   MAAGSVGWLAALVKGIGCNWLVNLAVIGSMASTSILGKFFMIWFPIMAFVATGFEHCVA
FT                   NMYFIPAGMMLGATVSVADWWLWNIIPVTIGNIIGAVVFVSMIYQFAYGKKI"
FT   gene            complement(556731..556976)
FT                   /locus_tag="MmarC7_0547"
FT   CDS_pept        complement(556731..556976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65615"
FT                   /db_xref="InterPro:IPR021603"
FT                   /db_xref="InterPro:IPR038549"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGN9"
FT                   /protein_id="ABR65615.1"
FT                   /translation="MVFEGKFIITTADDIPGLGLYYMGIVSAVSDNVDAIVEDLKKQVL
FT                   AKGGMGLVAFRIACADGKFLGYGTAVKADEGQFTMA"
FT   gene            complement(557189..559108)
FT                   /locus_tag="MmarC7_0548"
FT   CDS_pept        complement(557189..559108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0548"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mmp:MMP1303 sensory
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65616"
FT                   /db_xref="GOA:A6VGP0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP0"
FT                   /protein_id="ABR65616.1"
FT                   /translation="MNTIPPIKRLGTKLIIYSIITALIPIVMLGAVSTDTINTEMTNQA
FT                   QEKINDDLNTAESVVTLKLDKISAMNKYIVSNGDTVDLLKKGNTLELKNVALSYKDASD
FT                   PDFVVFFDKDGNVIARSNSDVTGDKSYESLFKMVINSTGYTSIEVLDKEAIKYENVDEI
FT                   VNIDIKGTEDSIDSTESVQDSAMALISIEPIYDEDGTLLGAAMAADILNKDYSIVDTVK
FT                   DASKDATTIFLGGVRISTNVQDNGGRAIGTLVSEEVYKYVVLDGNTYYGRAFVVNEWYL
FT                   TAYEPIYDSNGKIIGMLFVGTPESKFLALQADVRNQTFAVGLIGLFIALMVSYLINRGI
FT                   ISPLEQLKQGAERVSNGRYDQKVIVDSDDEFGELAKAFNKMATQINISDEKLKKHAEEL
FT                   KASYNELKELDNLKSELIAIVSHELRTPLTSIKGYVELVLDGTMGAINDSQKKCLQVAD
FT                   DNIVRLRRLIESMLDLSKIERGELEMYREKVNLKGIVCDVIEYLKPLATEKNIKLNREV
FT                   EEITIEADKDRITQVLTNLIENAIKFSPANESIMISGVLEDEHVHLKVTDHGAGIPKKD
FT                   MEKVFNRFYQVDSSTKRKKGGSGLGLAVCKSIVEAHKGSIWVESELGKGSTFHILLPIS
FT                   TESQ"
FT   sig_peptide     complement(559007..559108)
FT                   /locus_tag="MmarC7_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.408 at
FT                   residue 34"
FT   gene            complement(559135..559494)
FT                   /locus_tag="MmarC7_0549"
FT   CDS_pept        complement(559135..559494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0549"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: mmp:MMP1304
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65617"
FT                   /db_xref="GOA:A6VGP1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP1"
FT                   /protein_id="ABR65617.1"
FT                   /translation="MKKILVVEDEEDILNLVKIILEINNYEVIVAHDGYQGLEQVKENP
FT                   DLIILDIMMPGMTGWEFLDKIRNEGFEIPVIVLTANAQMSTLETAINKKVDDCVVKPFD
FT                   REDLMEKVSSILNKN"
FT   gene            559718..561121
FT                   /locus_tag="MmarC7_0550"
FT   CDS_pept        559718..561121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0550"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745; KEGG:
FT                   mmp:MMP1305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65618"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP2"
FT                   /protein_id="ABR65618.1"
FT                   /translation="MEFIEFGYGTSTDENSLKAGAHAASNALKMMKKYSEKPNIVFLYS
FT                   SPDYDPEEVLNGVKLILGNTVQIVGGSSKFQVCGNKFLENGVSIGILGSKYFSTGMGVG
FT                   LGISINPKESGKKAVKDAVENLGMLPKLLYVIMDFCKCEEQVLKGIVEELGVTIPIFGG
FT                   VSSDNFEFEHTYQYGNDVYLDSIVCVAFGGDIVPKISYNDHEYKEHHGKLENVINKSEK
FT                   RAIEEIGNISAIKRYIEISGYEGSVKDLEKDPKFYLSHPLGILDTAGDIHFKGPIAIKN
FT                   KKLITGSNISNSNELKIETIDKNELKKIFETNTNVLKNTQPHYDPAFTFYNISSFLSEI
FT                   DPEEIEKLIENSDINPFFGSSTFGEISFRKYGNYSMSMCSFAPDLVTISAKEGIHMFTK
FT                   HPATKETLLKIHELGGSVKVEELAKSLGIHRRSAYDRIDPLLKYGFIEKDQAVITITDF
FT                   GKLLLKFEF"
FT   gene            complement(561146..561907)
FT                   /locus_tag="MmarC7_0551"
FT   CDS_pept        complement(561146..561907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0551"
FT                   /product="Protein of unknown function DUF137"
FT                   /note="PFAM: Protein of unknown function DUF137; KEGG:
FT                   mmp:MMP1306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65619"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP3"
FT                   /protein_id="ABR65619.1"
FT                   /translation="MMVPESHPRYKSLLNRDRIVEAFESGVLAKGGMIAHGRGETFDYL
FT                   IGENTTDVALNSIRVSAALLVLAENPVISVNGNSVALAKDEFVELAKELNGKIEVNLFY
FT                   RTSEREEKIKDVFESDIGDGIVLLGIDNADKQIPGVDHLRGKVSESGIYTADVVLVPLE
FT                   DGDRAEALVKMGKTVIAIDLNPLSRTARKSTISIIDELTRCIPLITEYVIEYKKMDRAE
FT                   LLKIVESYNNEENLRNILNLISKRLTSIDLI"
FT   gene            complement(561970..563112)
FT                   /locus_tag="MmarC7_0552"
FT   CDS_pept        complement(561970..563112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0552"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: protein of unknown function Met10;
FT                   methyltransferase small; KEGG: mmp:MMP1307
FT                   methyltransferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65620"
FT                   /db_xref="GOA:A6VGP4"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP4"
FT                   /protein_id="ABR65620.1"
FT                   /translation="MSFQIDKRAYQSLKNFSNIIYKNAIINKDDFSKTEEIVDITYNGN
FT                   FVAKALYDPKFPLIKILTRENEEIDKDFFFKRINNANNYRTDILNYNDTYRMIYAEADY
FT                   LPSIILDKYNKIASIQISSNIMDNYSDLIFECISEITDVETMYVQSGKKGSDVKTKIFG
FT                   DKSQIETVISEGNAKFNVNMKGHKTGFFLDQRDNRIDLENYVKPGDKVLDVCSYTGGFA
FT                   VHAGINGGNVTAVDLSEKALAVAEENMELNGVKNYNFIVSNAFDAMKEMIKNNEKFDVV
FT                   VLDPPAFTDSSKDIKNALNAYNSMNYLGLKLAKRILVTCSCSHHIDRENFKNTIVSSSI
FT                   RAKKEIRQIGAYRTQAPDHIITMANKDLEYLKCLFFNVVN"
FT   gene            complement(563163..563810)
FT                   /locus_tag="MmarC7_0553"
FT   CDS_pept        complement(563163..563810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0553"
FT                   /product="putative transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: putative transaldolase; PFAM:
FT                   Transaldolase; KEGG: mmp:MMP1308 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65621"
FT                   /db_xref="GOA:A6VGP5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGP5"
FT                   /protein_id="ABR65621.1"
FT                   /translation="MKFFLDTANVEKIKEFNALGLVDGVTTNPSLIKKEGRDFYEVIKE
FT                   ICAIVDGPVSAEVIALDAEGMVKEARELVKLAENVVVKIPMTKEGMKAVNILSKEGIKT
FT                   NVTLIFSANQALLAAKAGASYVSPFVGRLDDVGQDGMFLISEVMQVFSAYGIETEVIVA
FT                   SVRHPIHVIESAKMGADIATIPFDVLDKLFNHPLTDNGIEKFLADWEAHMNR"
FT   gene            complement(563886..564497)
FT                   /locus_tag="MmarC7_0554"
FT   CDS_pept        complement(563886..564497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65622"
FT                   /db_xref="InterPro:IPR019218"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP6"
FT                   /protein_id="ABR65622.1"
FT                   /translation="MKIYNNFENEIPKKLFLAGIHGSESKYTSQILENLQKNILNLKTF
FT                   GNIIIVSELVNDSKYYSTLNPEYYETETGKSLLELIGKYKPEFYFEIHSYSKKSYSNLT
FT                   ELKRVDLKGIPPFVDLNNGVLMASISPILRGKFKKTDLCMTIEVPNWKVDEVEKTVLEI
FT                   LEFGITSKNKNGMVEKIFNKYPKEVSYAKWLADEFNLTFL"
FT   gene            complement(564531..565136)
FT                   /locus_tag="MmarC7_0555"
FT   CDS_pept        complement(564531..565136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0555"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="PFAM: IMP cyclohydrolase; KEGG: mmp:MMP1310 IMP
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65623"
FT                   /db_xref="GOA:A6VGP7"
FT                   /db_xref="InterPro:IPR010191"
FT                   /db_xref="InterPro:IPR020600"
FT                   /db_xref="InterPro:IPR036795"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGP7"
FT                   /protein_id="ABR65623.1"
FT                   /translation="MYIGRFLVLGKTDEGNPFVTYRVSSRSFPNRVAKVMDDNTVAILP
FT                   KDLEEMFKNPYITYNCVKLVGDVAIATNGSHTDIIADKIKLGLPIRDALSYSLLTMDYE
FT                   KDDYNTPRIAVVLTKDSAYMGYVSENDVRIKKVELESGKAYYLSVYEACNITKHQVISV
FT                   AGKTAEEVTKFVMDYEEFEKPVTAATVLLKDGFKLATL"
FT   gene            complement(565162..565320)
FT                   /locus_tag="MmarC7_0556"
FT   CDS_pept        complement(565162..565320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0556"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1311 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65624"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP8"
FT                   /protein_id="ABR65624.1"
FT                   /translation="MEILDKCVGCAGCVPFCPVGAISAVGKAEIDIEICTNCAICKSYC
FT                   PLNAITE"
FT   gene            complement(565339..565965)
FT                   /locus_tag="MmarC7_0557"
FT   CDS_pept        complement(565339..565965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65625"
FT                   /db_xref="GOA:A6VGP9"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGP9"
FT                   /protein_id="ABR65625.1"
FT                   /translation="MMKVYSLTKISPIFWIFLIPLIILGLILIIPIIFLAIVLGAIYLG
FT                   YKKIKSGINGIIRKLKTKKIKVTGSSDNGEVLINFSKKLEIEEESVEEDIPVIFEDKCE
FT                   NWEHKQFINYLMNNGLSENDEKLYYFDKSVYPVYKKTYPVNEVIKLYEETPEEDMIVLG
FT                   LKGDYDDPKLLYIIPKEKCKSRMSISELKEYEINLKNQEINNLSL"
FT   sig_peptide     complement(565843..565965)
FT                   /locus_tag="MmarC7_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.645) with cleavage site probability 0.608 at
FT                   residue 41"
FT   gene            complement(565974..566948)
FT                   /locus_tag="MmarC7_0558"
FT   CDS_pept        complement(565974..566948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0558"
FT                   /product="XPG I"
FT                   /note="PFAM: XPG-like; XPG I; SMART: Helix-hairpin-helix
FT                   domain protein class 2; KEGG: mmp:MMP1313 flap
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65626"
FT                   /db_xref="GOA:A6VGQ0"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ0"
FT                   /protein_id="ABR65626.1"
FT                   /translation="MGVQFGDLIPKTEISLKFLKNKTVAIDAMNVIYQFLSSIRLRDGS
FT                   PLKNKNGEITSTYNGIFYKTIYMLENEMTPIWVFDGKSHDLKEKTKEERRKSRNGALDS
FT                   YLEAKEQNNLEEMQKYAKRANFLDKKTIDNSKKLLELMGIPYINAPSEGEAQCAELVKS
FT                   NDAFCVISQDYDSILYGAENVVKNITSSNKDIELIELQKTLSELNVSLNQLIDVAILIG
FT                   TDYNPGGLKGFGPKKAIDTVKKGQMEKYISEIENYSEIRKIFDEPNVTSEYDTKLKTPK
FT                   KEELAEFLIEENDFSKDRILPNIEKISNLLGNKKSQKNLEAWF"
FT   gene            complement(566986..569271)
FT                   /locus_tag="MmarC7_0559"
FT   CDS_pept        complement(566986..569271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0559"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein; RNA
FT                   binding S1 domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; KEGG: mmp:MMP1314 phosphoesterase,
FT                   RecJ-like:RNA binding S1:OB-fold nucleic acid binding
FT                   domain related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65627"
FT                   /db_xref="GOA:A6VGQ1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ1"
FT                   /protein_id="ABR65627.1"
FT                   /translation="MIENCKICGGTGKKVVKYSECPECEGKGYLEEFETKSHFKNASKN
FT                   SKYDFDDEEIPCPTCNGTGKIPEYEDCEYCNGTGKVVKCDSCGREIGKYPEDKDLNTCE
FT                   NCSGKEEEQKENKKVVYVLDNMFTMNDLEEGKFYKGKINRTEKYGVFVQLNEKTRGLLR
FT                   FREVVGKRPSDFNIGDEIIVQVSELKLEKRELDLRYVPIAGYKLEKLEKEHELIDIKEI
FT                   FDTGLMNMKDKVIRVQGEVLQAAQTPGPTVFTITDGSEVAWVAAFESAGVRTHPDVVMG
FT                   SIIDVVGSVSVRDGKLQIERMKLEKLEGDAEQKVKDKIDIELDKKAEPDSDIEFLVESD
FT                   ILEKLRPKMADVAKRIRRAVLDGRPVIIRHHADTDGYCGGIAIEKAVIPVLEKYSMDSG
FT                   AQWHYFRRSPSKAPFYELEDVTKDLVFSIEDYLRFGQKMPLIVLVDNGSTDEDIPAVSQ
FT                   VKAYDIEVVVVDHHFPGEVIDGKVEIDEFVEAHVNPYLVGGDSNLTAGVLATEVARMIN
FT                   PDVTELVEHLPGIAVVGDHAKGEAVENYIKIALERLTKCSAEFGTGKVYSREDVEKIGQ
FT                   CMDFEAFYLKFMNGMGIVEDIYGMNKKDFARHEKLINILYERAMAMVDRQMKAVRPAIK
FT                   TEILPNGIVFNTLDVEKYAHKFTFPAPGKTCGFAHDSIVQQYEPGTPVITLSYGPDFGV
FT                   VRATDAVSEKFSFNLNHIVTQFIDEIPEASLDGGGHECAGSLKFVEGLREKVINRFSEV
FT                   VLEMKEKD"
FT   gene            complement(569599..570132)
FT                   /locus_tag="MmarC7_0560"
FT   CDS_pept        complement(569599..570132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0560"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: mmp:MMP1315 2-oxoglutarate oxidoreductase gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65628"
FT                   /db_xref="GOA:A6VGQ2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ2"
FT                   /protein_id="ABR65628.1"
FT                   /translation="MRKEIRFSGFGGQGIILAGVILGRAASLYAGKEAVQTQSYGPEAR
FT                   GGASKSEVVISESEIDFPKVIQPDILISMSQPAFDKYGYDLKENAKVIVDRDLVTIPNG
FT                   YEGKYEVYKVPFTEIANKEVGLGIVANIVMLGALTKLAELVSKEEVEKALLDSIPKGTE
FT                   KKNLMAFEKGYDYL"
FT   gene            complement(570142..570939)
FT                   /locus_tag="MmarC7_0561"
FT   CDS_pept        complement(570142..570939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0561"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: mmp:MMP1316 2-oxoglutarate
FT                   oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65629"
FT                   /db_xref="GOA:A6VGQ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ3"
FT                   /protein_id="ABR65629.1"
FT                   /translation="MHPSLKYMRKDRLPHIFCSGCGNGIVLNCFTNALDKLSLKNEDYI
FT                   AISGIGCSSRVPGYLFCDSLHTTHGRPIAFALGTKVIQNDKKVVVFTGDGDLSAIGGNH
FT                   FIHGCRRNIDITVICINNNIYGMTGGQCSPTTPHEKKATTAPYGNPENPLDLCELAKAA
FT                   GATYVARWTTANPIQLANSIKKGMDKKGFSFIEVVSQCPTYYGRFNVSRKPSEMMKNLK
FT                   ESATTVRKAETIEKEELLNKIIVGEFLNIEKPEYVEQLKKLQE"
FT   gene            complement(571037..571813)
FT                   /locus_tag="MmarC7_0562"
FT   CDS_pept        complement(571037..571813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65630"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ4"
FT                   /protein_id="ABR65630.1"
FT                   /translation="MIETISYQELKGNNKEIVDEQFEKLIAELKEKYNAQVLSNESDDE
FT                   GELYTRITELKIKFETVLDYIKYCLMYGADLDVVSPTKLKISGNEMGNTILYIIDFFKK
FT                   FAKKFGVAFNVYVKNEVDADINALKEGLCDEDDIYLMESEEGLLRVKAVFEGDGKSEEI
FT                   IIKKILASLNPDIVVNKVITKSMDESKGIFSGLVAIEMFCKPFDIVEVAYKFLPVAISF
FT                   ENSDIELDISELQDIGNDLGGAVFELTHAAANMNKK"
FT   gene            complement(571960..573561)
FT                   /locus_tag="MmarC7_0563"
FT   CDS_pept        complement(571960..573561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0563"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: Lysyl-tRNA
FT                   synthetase class 1c; KEGG: mmp:MMP1318 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65631"
FT                   /db_xref="GOA:A6VGQ5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ5"
FT                   /protein_id="ABR65631.1"
FT                   /translation="MHWADATSEKIMKKRNANEYVVSSGITPSGHIHIGNARETLTADA
FT                   VYKGIAKSGANAKLIFVADDYDPLRKLYPFLPQEFEKYIGMPLSEIPCPEGCCKSYADH
FT                   FLMPFLNSLDDLGVDITTHRANECYKAGMYDDVIITALENRLKIKEILDSYRKEPLADD
FT                   WFPLNVVCEKCGKMHETKVTAYNSEDKTITYVCKCGFENTVQPFNGIGKLPWRVDWPAR
FT                   WGIFGVTAEPMGKDHAASGGSYDTGIKIARQIYNYQAPEKMVYEWIQLKIGDKAMPMSS
FT                   SSGVVFAVKDWNEICHPEVLRFLILKGKPTKHIDFDLKAISNLVDDYDELERKYFELIE
FT                   KRKTEELNDSEDEKISLYELVTPKKPEKLPLQVAYRFCSIIAQIALDKETQEIDMERVF
FT                   DILGRNGYNPAEFSEYDKSRLEKRLYMSKKWASDYGENLEINDLEQAKEQYETLSEEQK
FT                   AWLKLFAEEVEKIEIDATTVHELMYETATKLDLAPKEAFVASYKILLGKNYGPKLGSFL
FT                   ASLKKEFVIGRFSLTE"
FT   gene            complement(573736..573809)
FT                   /locus_tag="MmarC7_R0006"
FT                   /note="tRNA-Cys1"
FT   tRNA            complement(573736..573809)
FT                   /locus_tag="MmarC7_R0006"
FT                   /product="tRNA-Cys"
FT   gene            574177..574264
FT                   /locus_tag="MmarC7_R0007"
FT                   /note="tRNA-Ser1"
FT   tRNA            574177..574264
FT                   /locus_tag="MmarC7_R0007"
FT                   /product="tRNA-Ser"
FT   gene            574324..574773
FT                   /locus_tag="MmarC7_0564"
FT   CDS_pept        574324..574773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0564"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: mmp:MMP1319 SSU
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65632"
FT                   /db_xref="GOA:A6VGQ6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR019977"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ6"
FT                   /protein_id="ABR65632.1"
FT                   /translation="MTQTEFKHRIRISKTDLEGKNPLEYALQEMKGIGRAMARAVIRVT
FT                   ELDPKQQAGYLADEDVLKIESVLEDPATHGIPSWMFNRKKDVYSGLDKHLIETDLVLTV
FT                   QEDITNMKKIRCYRGVRHELRLPCRGQRTRGSFRKGTSMGVKRKK"
FT   gene            574794..575330
FT                   /locus_tag="MmarC7_0565"
FT   CDS_pept        574794..575330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0565"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: RNA-binding S4
FT                   domain protein; KEGG: mmp:MMP1320 SSU ribosomal protein S4P
FT                   (S9E)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65633"
FT                   /db_xref="GOA:A6VGQ7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR022802"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGQ7"
FT                   /protein_id="ABR65633.1"
FT                   /translation="MGDPRRLGKKYDTPNHPWIGERIQSEREISQKYGLVNKKELWKME
FT                   TQLRNYRRQARKLISDTTTQGGKEAVQLFNVLKRYAILVEQEPTLDHVLSLNIESILER
FT                   RLQTMVYKKGLAKTAKQARQFIVHGHIAVNGKRVTSPSYLVSVAENDAIEYVPNSPMAS
FT                   ENHPERTAAVSEENQ"
FT   gene            575340..575714
FT                   /locus_tag="MmarC7_0566"
FT   CDS_pept        575340..575714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0566"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: mmp:MMP1321 SSU
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65634"
FT                   /db_xref="GOA:A6VGQ8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGQ8"
FT                   /protein_id="ABR65634.1"
FT                   /translation="MSQKWGLVHIYASYNNTILHVTDLTGAETIAKVSGGMIVRNQRDE
FT                   SSPYAAMQAAFKIADLMRDKGIDQVHVKVRATGGQKSKNPGPGAQAAIRALSRAGIRIG
FT                   RIEDATPIPHDGTTPKRKNR"
FT   gene            575772..576314
FT                   /locus_tag="MmarC7_0567"
FT   CDS_pept        575772..576314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0567"
FT                   /product="RNA polymerase insert"
FT                   /note="PFAM: RNA polymerase dimerisation; RNA polymerase
FT                   insert; SMART: RNA polymerase RpoA/D/Rpb3-type; KEGG:
FT                   mmp:MMP1322 DNA-directed RNA polymerase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65635"
FT                   /db_xref="GOA:A6VGQ9"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGQ9"
FT                   /protein_id="ABR65635.1"
FT                   /translation="MKMELKAPLSFSSALRRIMISEVPTYAIENVYFYENTSSMYDEVL
FT                   AHRLGLIPIKGVPVSGDEVIVLTISKEGPCMVYSSDLKSESGEPAFENIPIVKLAEGQK
FT                   LELEAEALVGTGKIHAKWQPCNAVYKQISNDEVEFKIESFGNMDAEDIVRSSLEILKNK
FT                   AEKFLSELEGRELSDEN"
FT   gene            576375..576737
FT                   /locus_tag="MmarC7_0568"
FT   CDS_pept        576375..576737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0568"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mmp:MMP1323 LSU
FT                   ribosomal protein L18E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65636"
FT                   /db_xref="GOA:A6VGR0"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR0"
FT                   /protein_id="ABR65636.1"
FT                   /translation="MKKIMSTNPKTPELIQKLKEESFKNSAPIWKDVAKKLAKPARKKV
FT                   EVNVSKISRYASEGDVILIPGKVLGAGSLKINVTVAAFSFSETAKSAIEAVGGKCLTIE
FT                   ELIAENPKGSKVTIMA"
FT   gene            576758..577171
FT                   /locus_tag="MmarC7_0569"
FT   CDS_pept        576758..577171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0569"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; KEGG: mmp:MMP1324
FT                   LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65637"
FT                   /db_xref="GOA:A6VGR1"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR1"
FT                   /protein_id="ABR65637.1"
FT                   /translation="MVVVNAENAVVGRLASYVAKLALSGEEVTVVNAEKAIMTGNKEYI
FT                   FQKYVQLRTRKSISNPKKMGPKYPRRPDDIVRRVIRGMLPYKKPRGVEAFKNIKIEVGV
FT                   PEGVSIDINLGSEPNTIKYVTVGELSQFLGAKF"
FT   gene            577185..577589
FT                   /locus_tag="MmarC7_0570"
FT   CDS_pept        577185..577589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0570"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: mmp:MMP1325 SSU
FT                   ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65638"
FT                   /db_xref="GOA:A6VGR2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGR2"
FT                   /protein_id="ABR65638.1"
FT                   /translation="MKVVHTVGKRRTAIARATAKEGSGKIRINKKPLELMEPKYIKMKL
FT                   MEPVILAGEALSNIDVDIDVKGGGIVSQMDATRTALGKAIVEFTGKMELKEKFLSYDRT
FT                   LLVSDARRTEPHKPSKSSKGPRAKRQKSYR"
FT   gene            577628..577834
FT                   /locus_tag="MmarC7_0571"
FT   CDS_pept        577628..577834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0571"
FT                   /product="RNA polymerase, N/8 Kd subunits"
FT                   /note="PFAM: RNA polymerases, N/8 Kd subunits; KEGG:
FT                   mmp:MMP1326 DNA-directed RNA polymerase, subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65639"
FT                   /db_xref="GOA:A6VGR3"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGR3"
FT                   /protein_id="ABR65639.1"
FT                   /translation="MIFPIRCFSCGAVISEVYEEYRTRLKDGENPEEILNDLEVKKYCC
FT                   RRMFASHRLDNDRELFDDIVEYK"
FT   gene            577871..577944
FT                   /pseudo
FT                   /locus_tag="MmarC7_R0008"
FT                   /note="tRNA-OTHER1"
FT   tRNA            577871..577944
FT                   /pseudo
FT                   /locus_tag="MmarC7_R0008"
FT                   /product="tRNA-OTHER"
FT   gene            577982..578158
FT                   /locus_tag="MmarC7_0572"
FT   CDS_pept        577982..578158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0572"
FT                   /product="RNA polymerase Rpb6"
FT                   /note="PFAM: RNA polymerase Rpb6; KEGG: mmp:MMP1327
FT                   DNA-directed RNA polymerase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65640"
FT                   /db_xref="GOA:A6VGR4"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR4"
FT                   /protein_id="ABR65640.1"
FT                   /translation="MKLTKFETARLVGARSLQISDGAPLTIESDRTSSLNLAEDEIKQG
FT                   KLPLCVKKQVKKN"
FT   gene            578190..579125
FT                   /locus_tag="MmarC7_0573"
FT   CDS_pept        578190..579125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0573"
FT                   /product="enolase"
FT                   /note="KEGG: mmp:MMP1328 enolase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65641"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR5"
FT                   /protein_id="ABR65641.1"
FT                   /translation="MENSTSIKRITAKKVFKDSKIQVRIATLTNKGIGYDVIDAENPDY
FT                   VISDVENVIAPELVGYPAYDQDIIDSIICDTSVDSPKVTMGTSLSVARAAANSVEIPLF
FT                   KHIGGVLSTNLPIVGCSLVSDGINQLLTIPMAESIGEMIYIYNKILSELSEEYDFRNNY
FT                   GEYVSKDIFKDIGKFKEIISNISEDEDIEILSGAKISEFKKEIEELDYLESSEIIEFDG
FT                   ILCTENIDEEADFSKIDPYSMGTLTEMNYYINYTVEKGLTPTISGNNTSFPHLAIGFKV
FT                   PFLRANINSKVLNEIWNIERILNSPNITRF"
FT   gene            579173..579361
FT                   /locus_tag="MmarC7_0574"
FT   CDS_pept        579173..579361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0574"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1329 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65642"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR6"
FT                   /protein_id="ABR65642.1"
FT                   /translation="MSVVIDYDKCKGPECAECVNTCPVEVFEIQGNKVVVARESDCTLC
FT                   MVCVDVCPTNAITVKED"
FT   gene            complement(579383..579649)
FT                   /locus_tag="MmarC7_0575"
FT   CDS_pept        complement(579383..579649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0575"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: mmp:MMP1330 hydrogenase expression/formation protein
FT                   (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65643"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR7"
FT                   /protein_id="ABR65643.1"
FT                   /translation="MCLAIPSVVIDIFEEDGEKYALAEYKGVKQKAKLALLEGVEIGDY
FT                   VLIHTGYALEKMSEDEAKLSLDAWEELFDVLDEMDGVKKENSE"
FT   gene            complement(579746..580219)
FT                   /locus_tag="MmarC7_0576"
FT   CDS_pept        complement(579746..580219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0576"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   mmp:MMP1331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65644"
FT                   /db_xref="GOA:A6VGR8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR8"
FT                   /protein_id="ABR65644.1"
FT                   /translation="MDFVSIGMDLVASYGLLAIFLIGFSEPIFQPIPTEVFMLGGLALG
FT                   LDWRYVILVSTVGSTLGGIVTYFISSRYGENLFLKIFKKEKYSSAEEFLNKWGALGIIL
FT                   ISFTPIPFEVICWISGIFKMPFKIYVSALIISRIIKHGLVVLPFAALASILPF"
FT   gene            complement(580258..581412)
FT                   /locus_tag="MmarC7_0577"
FT   CDS_pept        complement(580258..581412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0577"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmp:MMP1332 NAD binding
FT                   site:FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65645"
FT                   /db_xref="GOA:A6VGR9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGR9"
FT                   /protein_id="ABR65645.1"
FT                   /translation="MIAVVGGGPAGLSCAHALARRGLEVELYEMDKLGGTCLNYGCRYV
FT                   NALKEVSDVIDNLNAITGKKHVLEDIISLNELHEKVYKIHRSMREGAKKTLDELGIFVK
FT                   FEEFKEEYEKNYDYVVYATGQNYARNYLGVECAIHSELPYLKKLPKKILIIGGGTVAAE
FT                   YASIFSTFGSEVTVYVRSKFLKKIEDDELRDYIINDLSNFKITHSEEELNKMLHDDEYF
FT                   NILAIGGTPRYKTNEYFQVDGKSKVYACGDSVRGGYTPISNREGKIVAENIYNEIKNLP
FT                   LKKMEYGIEIATIRMPISILVVGKQTKDFKTSYNRPGRGYYFRKTEKRGMNRIYYENGK
FT                   AVGAVVMTTATELAPYFAQYLKGIDVYKDFLEVYPTTDPYYWQV"
FT   gene            581496..582617
FT                   /locus_tag="MmarC7_0578"
FT   CDS_pept        581496..582617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0578"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: mmp:MMP1333
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65646"
FT                   /db_xref="GOA:A6VGS0"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGS0"
FT                   /protein_id="ABR65646.1"
FT                   /translation="MNTFGDNFRVTTWGESHGKALGAVIDGCPANLPISEQDIQNELNR
FT                   RRPGYSIFSTPRKEEDKVEILSGIFEGKTTGTPISGLVFNKGQKSKDYSKIKDTPRPGH
FT                   ADLNYFLKYGNYDYRGGGRSSGRTTIGNVIGGAVAKKLIEFTHNIKIIGYSTKIGKIKG
FT                   DFDYYKNPKFFESDSNIEKLLKKIENNPLRCPSKNSDEMKDYVIDAMDKKDSVGGIIEI
FT                   IIKGIPQGVGNPVFNKLEGKLGSAFIGINAVKGFEIGRGFEASELYGSEMNDAYHIYEN
FT                   SIKEMTNNAGGIIGGISTGSPVVLRVSIKPTPSISKIQDSMNLISNKDEKIEIGGRHDP
FT                   IIVPRVIPVLESMAAITVADLMISSGYINPCRI"
FT   gene            583014..584180
FT                   /locus_tag="MmarC7_0579"
FT   CDS_pept        583014..584180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0579"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   mmp:MMP1334 solute-binding protein/glutamate
FT                   receptor:ATP/GTP-binding site motif A (P-loop):GTP-binding
FT                   protein, HSR1-related:GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65647"
FT                   /db_xref="GOA:A6VGS1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS1"
FT                   /protein_id="ABR65647.1"
FT                   /translation="MLNNSVKHLKIDNMENKIPMRRMVHKIIYECNIVLLVVDARDPET
FT                   TRNRALEEYTIEKNKKLIYVINKSDLVPKKILEKWKDNFKSENPNSSVVFVSAKEKLGT
FT                   KMLRDEIKAYLNSNNIKYGQVGIVGYPNVGKSSIINALTGKKSARSGLTAGLTVGEQWV
FT                   KLTKDIKLLDSPGIIEPKDEDELVISGALRYEKADDIISPALKILQRIHTFDNTILNEY
FT                   YGFEIGEEINIELLEKIGTKLNFLTKDGKIDIDRTSKSIIREFQNGKLNYHRMNLKKYE
FT                   QKRTKNIDFITKYLQNFPFINDADQIISHLENIDELGTMNTRPVIGMKELDDAFVIISF
FT                   SEKSRDTGRKKVEELARMSDIELYSLGGGRVGKHRIYIGVGEKIKNTI"
FT   gene            complement(584184..585137)
FT                   /locus_tag="MmarC7_0580"
FT   CDS_pept        complement(584184..585137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0580"
FT                   /product="mevalonate kinase"
FT                   /note="TIGRFAM: mevalonate kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: mmp:MMP1335 mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65648"
FT                   /db_xref="GOA:A6VGS2"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS2"
FT                   /protein_id="ABR65648.1"
FT                   /translation="MNTIKTPSKIILFGEHAVVDGYPAISMALDLKTTGEIEENSDTIS
FT                   IDLVDLNEIFEITPELIKNLEISNFSPALKYVLCAAKSTIYYLSEFKNLKEIKPFKLKI
FT                   YSEIPLSCGLGSSASVVVTVIRSILSFYKIELENDEVINLAYSVEKEVQGRASVTDTAT
FT                   ISLGGMIEIVNGEYRPMPNDLEEFIKTCRFLVVNVEERTRKTAELVHEVSKHPEKEQIF
FT                   EEIGKIISTVRWVSDKSELGKLMNENHELLKKFGISTEKLDLVAKVGQKYGYGGKLTGA
FT                   GGGGSAIILLKEDREELLKELKKIGVIGIYECKMAN"
FT   gene            complement(585148..586554)
FT                   /locus_tag="MmarC7_0581"
FT   CDS_pept        complement(585148..586554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0581"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor GTP-binding; GTP-binding protein
FT                   HSR1-related; elongation factor Tu domain 2 protein; KEGG:
FT                   mmp:MMP1336 archaeal translation factor specialized for
FT                   selenocysteine insertion"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65649"
FT                   /db_xref="GOA:A6VGS3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038661"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS3"
FT                   /protein_id="ABR65649.1"
FT                   /translation="MDFKNINLGIFGHIDHGKTTLSKVLTEIASTSAHDKLPESQKRGI
FT                   TIDIGFSAFKLENYRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHM
FT                   LILDHFNIPTIVVITKSDNAETEEIKRTEMFMKSILQSTQNLKNSSIIPISAKTGSGIT
FT                   EIKNLIINTLNNTEIIRNTDSYFKMPLDHAFPIKGAGTVVTGTINKGIVKVGDELKVLP
FT                   INMSTKVRSIQCFKENVMEAKAGDRVGMAIQGVEAKQIYRGCILTSKDTNLQVVDKIVA
FT                   KIKISDIFKYNLTPKMKVHLNVGMLIVPAVAVPFKKLTVGKSEENVILNEVISGNECYC
FT                   VFELEEKVLAEVGDRVLITRLDLPPTTLRICGHGLIEEFKPIKDLNIKKEVLREGKIKI
FT                   DKSRTVIEELAQSKVAAEKLIGEEISIEGKDVVGKIKGTFGTKGLLTAEFNGNVENRDK
FT                   VLLNRLRRWG"
FT   gene            586664..587143
FT                   /locus_tag="MmarC7_0582"
FT   CDS_pept        586664..587143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0582"
FT                   /product="coenzyme F420-reducing hydrogenase delta subunit"
FT                   /note="TIGRFAM: hydrogenase maturation protease; coenzyme
FT                   F420-reducing hydrogenase delta subunit; hydrogenase
FT                   maturation peptidase superfamily; PFAM: peptidase M52
FT                   hydrogen uptake protein; KEGG: mmp:MMP1337 hydrogenase
FT                   maturation protease, related"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65650"
FT                   /db_xref="GOA:A6VGS4"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004411"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS4"
FT                   /protein_id="ABR65650.1"
FT                   /translation="MIPDSLKYEILVFGCGNLVFADDGFGYEVISKLETMELPKNVGII
FT                   DAGTGAPYYLMSIMDEECLTKKIIIVDIIDFQLPPGTLKILSTEELTKIDKYTFDAHDM
FT                   PLSDYLIKAQESGIDVTVIGCQAKRVSMPDIEVGLTDEVRAAIDGAVDLVLEHIK"
FT   gene            587261..587455
FT                   /locus_tag="MmarC7_0583"
FT   CDS_pept        587261..587455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65651"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS5"
FT                   /protein_id="ABR65651.1"
FT                   /translation="MKSYKIKLFFSGDEDIVKTETVEAENPFEAKELLLKKYGAVKPRL
FT                   QDKTLEILSKIEILDYNII"
FT   gene            complement(587467..588276)
FT                   /locus_tag="MmarC7_0584"
FT   CDS_pept        complement(587467..588276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0584"
FT                   /product="protein of unknown function DUF890"
FT                   /note="PFAM: protein of unknown function DUF890; KEGG:
FT                   mmp:MMP1339 SAM (and some other nucleotide) binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65652"
FT                   /db_xref="GOA:A6VGS6"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS6"
FT                   /protein_id="ABR65652.1"
FT                   /translation="MWKTMKPEPLELGLKIEDAILVNEKLKDFIVYKSGKPRIDFKNKE
FT                   AMKEYNIAILRHIFGLDMDFHEDALIPTPINRYLFIKNIFDEKDDIKEVLEIGTGSGII
FT                   SILIAKYFECNVTATDTVFDYLKIAEENISKNNLDSKIILVDSKGKIIFDIPELKNKKF
FT                   DLIISYPPYYADNSVASKRSFGGAFASEVELIGGGKYGEVFSQKIIEEGMDYLNEGGII
FT                   AIMFPEKPFERRKLVEDKIQELGLTLKKSEITTGKRIRHIIKAKKEK"
FT   gene            588369..589484
FT                   /locus_tag="MmarC7_0585"
FT   CDS_pept        588369..589484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0585"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mmp:MMP1340 DNA
FT                   repair exonuclease of the SbcD/Mre11-family"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65653"
FT                   /db_xref="GOA:A6VGS7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS7"
FT                   /protein_id="ABR65653.1"
FT                   /translation="MQFVHMADNHLGYRQYNLDERENDIYESFLECIDKIIEIRPDFVI
FT                   HSGDLFESPQPSVNAIRCAIEGFLKLKEKNIPIYLIHGNHDIPKSQQKGKPFGLLKKIL
FT                   GNSLLTFGKNKSHIFNNEIFIGGIEYVSHNKIPKTYEDLEKINSDSKDYKKKILLFHQS
FT                   VNPFIPQSFEMQLTDFPKDLNYIAGGHIHQRVLKPVNDGNSVFSYAGSTDIMSVSEVRD
FT                   YQKNGKGFYLGDLSGDFDINSIQKIDVECRNFIIDKKIKNENDYEKIIKELQNLQGEKK
FT                   PVIYCDIVENLFNSFNDEIAELTLYKRINRIDENLEESLIINESSIEEIFQEYIKNKEM
FT                   DVNFVYGLYKKLLENDEDSLLYVNDYFKGNY"
FT   gene            589497..592478
FT                   /locus_tag="MmarC7_0586"
FT   CDS_pept        589497..592478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0586"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: mmp:MMP1341 DNA
FT                   double-strand break repair rad50 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65654"
FT                   /db_xref="GOA:A6VGS8"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS8"
FT                   /protein_id="ABR65654.1"
FT                   /translation="MIIKTIKMENFRSHRNTSINFNKGITSIIGQNGSGKSSIFQAMNF
FT                   ALFAPRGSNFRIENLMQQGAASFSVELEFEMMGNTYLVKRKRFQNKTDDKLYVNGKLNA
FT                   ESASEINKKIEEILEIDNSVFSNAIYIKQGEIANLIQMTPRDRKEVIGKLLGIEKYEKA
FT                   AEKMNIVKKSYEEMLFKLEGELTQEPEILENLEKLKNEVSESEVLKEEVLKKYGNLETV
FT                   KLEKNLELTQMEEKFTENNRLKENLKDIILEIKNINLEIQNFKNSLNLVVEESENLSKN
FT                   EENYKKYLELELNIKDLNTNLTSHRSDYESYNKLKTIEESLLKELNSLKESLKDNKKNP
FT                   DELKKNLKENEGKILSLDKIKEKIKELEFIEKQICEIETHKKTVENLFNSVKIYENSIK
FT                   TFEELKTKKNSYENLLKEKIDVEKKLRTENDEKIKLISELTVFEKIEEKINLENELKEK
FT                   YEELSEKIDKLNEIVLKKESKISEYKNSKAELEKTNDSCHVCQSKISEEKKQELLRKYN
FT                   NEIQNEQLSTESLKKQLEIILTKKEQIKLKLNEIDSFKSKYGELKEKKNYLLKIEESLV
FT                   ENNQKLDELNEKINEYSSLNDEMDLIEIKLKDLEKDHKNYNYSAQFVAKNDESESLKKK
FT                   LELSKIIGNYDFSKIENEKKSLENLKDELKNIIYNLDREINIKTELKNIQNDISSKIGI
FT                   AECYVRWETQKSDFENKISNCKESYEKYMKSHAVLKNYSKTYIIEINNLNEFLNQKIAE
FT                   KQQLCGKLLETRAEIEKNIQITNYNPELHENAKRLYENIFNEFNDISRTLERINSELKL
FT                   KSENINYLNEKIQNLANKKEERKKIEEFKEYLDKIKREIFSKDGFQRYLREKYIPLIQR
FT                   HTNHIFQEFELPYSHIQLKDDYSLIVDGLPVETLSGGEQIAVSLALRLGISKAVCNNIE
FT                   CIILDEPTAYLDEDRRKNLLNIFKNIKTIHQMAIITHHQELEQIADNIIKVRKIGENSK
FT                   ISLE"
FT   gene            592487..592882
FT                   /locus_tag="MmarC7_0587"
FT   CDS_pept        592487..592882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0587"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   mmp:MMP1342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65655"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGS9"
FT                   /protein_id="ABR65655.1"
FT                   /translation="MYRIIPDTNFLIYTFKQGINFEYELNSAIDRGYKIYIMDCVLKEL
FT                   DKLKSEFKGKEKLSANMALKYAKNFEIIEYSDGKYADEMIINYSKENKDVIICTNDKKL
FT                   KKELIDNGTPIILVKQHNHFELQGYLK"
FT   gene            complement(592898..593698)
FT                   /locus_tag="MmarC7_0588"
FT   CDS_pept        complement(592898..593698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65656"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT0"
FT                   /protein_id="ABR65656.1"
FT                   /translation="MLEIVFLGGGGGRWESITQVKGTGGFRIHSEDITMHVDPGAGALV
FT                   RMNQLQINPWKTDAIISTHCHPDHYTDAENLVEAMTKGMTKKQGVLIGNNSVLNGNSRF
FT                   EKGISTYHQSRVGERHVLGPYDKININNWELAATKTKHNDPETIGFKLETEDGLIGYTS
FT                   DSEYIDSLIEDFDCVDFLIANIIRVKGQKVPGHMCSNDIIEIVNSMKKKPKMLAMYHMG
FT                   MKMTDPDSEARYISENIDIPVVPAKIGLKIILENKNCRFDYIKY"
FT   gene            complement(593710..594192)
FT                   /locus_tag="MmarC7_0589"
FT   CDS_pept        complement(593710..594192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmp:MMP1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65657"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT1"
FT                   /protein_id="ABR65657.1"
FT                   /translation="MGSEYMKYSFIFLISAILIFSGCIEDNITTESNGTSLLNNTSSEN
FT                   PNIEVEADDSSESKNSSEIGSIPFKVLEFGIYGDSYKHYESNVKDDKTVIEVYMGKKLG
FT                   SDNIIEINSIKLENGVLIVNVEEITPETISDRVIVYPYEIVEVNGIYNNVEFKVIE"
FT   gene            complement(594182..594976)
FT                   /locus_tag="MmarC7_0590"
FT   CDS_pept        complement(594182..594976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0590"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase; KEGG:
FT                   mmp:MMP1345 undecaprenyl pyrophospahte synthetase related
FT                   protein (di-trans-poly-cis-decaprenylcistransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65658"
FT                   /db_xref="GOA:A6VGT2"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT2"
FT                   /protein_id="ABR65658.1"
FT                   /translation="MPLFKFYEYLSKFGALKLYERELESKISKYPLPKHVGIIMDGNRR
FT                   LAKKLGENPELGHNLGASKVHEVINWCVSLGIHTVTLYAFSLENFNRPENEVKVLMDLF
FT                   EKEFIEIADHPGVHKDKIRVSVIGRREMLPEYVQKAIMYAEEKTKDYSDHFVNFAIAYG
FT                   GQQEIIDSVKKIAEKVKDNEIEIEDITIELISKNLYTSNLPSPNPDLIIRTSGEERISN
FT                   FLTWQSCYSELYFCETYWPTFRKVDLLRSIREYQKRERRYGK"
FT   gene            complement(594993..595727)
FT                   /locus_tag="MmarC7_0591"
FT   CDS_pept        complement(594993..595727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0591"
FT                   /product="basic helix-loop-helix dimerization domain bHLH"
FT                   /note="KEGG: mmp:MMP1346 basic helix-loop-helix
FT                   dimerization domain bHLH"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65659"
FT                   /db_xref="GOA:A6VGT3"
FT                   /db_xref="InterPro:IPR016764"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT3"
FT                   /protein_id="ABR65659.1"
FT                   /translation="MYAIGIGKNRDEVLIAVENLKKEGIDVELVDSPNVLIDGLINKRY
FT                   CGAVRGSLSSSDLIPILRKKIGKFYRASILKNPFNNEIFILAPVGIDEISEDPKMSLDE
FT                   KLEIIKYSLEFLKSREITPKVGILSAGRLSDVGRSKKIDDSIIEAENLLKRVKSLEFFE
FT                   NPEIDHKGILIEEYLKEGYNIIISDDGISGNLLFRAFALVCNLEGFGAIILNSENIKFI
FT                   DTSRSGSWKRYYNAVKFLKEGF"
FT   gene            complement(595855..596055)
FT                   /locus_tag="MmarC7_0592"
FT   CDS_pept        complement(595855..596055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0592"
FT                   /product="Transcription factor CBF/NF-Y histone"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/archaeal
FT                   histone; Histone core; KEGG: mmp:MMP1347 archaeal histone
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65660"
FT                   /db_xref="GOA:A6VGT4"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT4"
FT                   /protein_id="ABR65660.1"
FT                   /translation="MAELPVAPMERILKSAGAERVSRDAAVMLAEALEEIAVDVAKEAV
FT                   GLAKHAGRKTVKADDLKLAMK"
FT   gene            complement(596245..597327)
FT                   /locus_tag="MmarC7_0593"
FT   CDS_pept        complement(596245..597327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0593"
FT                   /product="2,
FT                   5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: mmp:MMP1348 hypothetical protein; TIGRFAM:
FT                   2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase; PFAM: bifunctional deaminase-reductase domain
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65661"
FT                   /db_xref="GOA:A6VGT5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR022972"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT5"
FT                   /protein_id="ABR65661.1"
FT                   /translation="MDKQEYLEKLLLIIDDLKLLAEKGIPILVEGPNDILSLKNLKIKA
FT                   NFITVSNTPVFQIADDLIAKNIPEVILLTDFDRAGRVYAKNIMEEFQSRGIKVNNLIRK
FT                   EIIKYSHGDLKDIESLYPYISRRITINGDLSDIMVPYVISNVGMTLDGKLATIENDSRI
FT                   SGENDLKRVHEIRKDVDAILVGIGTVLKDDPRLTVHKINASPKDNPLRIVVDSSLKISL
FT                   NARVLNKDAKTVIATTTPISDEKEEKIRKLKEMGITVLRAGVQKVDLRKIMNEIYKMGI
FT                   NKILLEGGGTLNWGMFKENLINEVRVYIAPKVFGGANSPTYVDGEGFKNVEECTKLELK
FT                   NYYPLDDGIVLEYRVIGSSK"
FT   gene            complement(597355..598131)
FT                   /locus_tag="MmarC7_0594"
FT   CDS_pept        complement(597355..598131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0594"
FT                   /product="NAD+ synthetase"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD synthase; KEGG:
FT                   mmp:MMP1349 NAD+ synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65662"
FT                   /db_xref="GOA:A6VGT6"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT6"
FT                   /protein_id="ABR65662.1"
FT                   /translation="MIRTNEQLDELANNICDFIREQVENADAKGVVVGLSGGIDSALVA
FT                   YLSVKALGKENVFGVIMPEKNSNPDDEKYGKLVAESLGIDYTIFDITPVLVAFGAGGYV
FT                   EGKEFDKRVDANLKPRIRMTEVYYHANKKNYLVAGTSNKSEIYMGYGTKYGDLGSDFLT
FT                   IGNLFKTEVRQLAGYVGVPKEIIDKAPSAGLWDGQTDEGELGISYETLDKLLNLMEKGK
FT                   EIDDICEFLGISLEKMEELMIRITTNKHKSLPLPMP"
FT   gene            complement(598147..599460)
FT                   /locus_tag="MmarC7_0595"
FT   CDS_pept        complement(598147..599460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0595"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mmp:MMP1350 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65663"
FT                   /db_xref="GOA:A6VGT7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023979"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT7"
FT                   /protein_id="ABR65663.1"
FT                   /translation="MKITIYSKDIYTYGAMLVGGILKEKHKHDVKLTKDIKNKKLFLKS
FT                   DIVIFSLYSTLNIIDPVIKETIDYLKSKNVKIYIAGPVSAYPEIILNELTVDGVILGEG
FT                   ELTTPEIVSGSTEGLAYIENGEIIVNNPKIKPDLDFSKIYVPKDIEAQNVRGANVYIET
FT                   HRGCLGHCTFCQVPEFFGRDIRSKPIELIIEEVMELKKNGVKRIAISGGTGSLYNFKNT
FT                   VNKNKFIEMIESVSNIIGRENLSVPDMRVDYVDEEVLNAIKTYSIGWVFYGIESGSDKL
FT                   LNSMKKGTNTKKNLKAIELAKDCGVKVAGSFIVGHPKEKEVDFLMTKDFIVDAELDDVF
FT                   VSAAEPIPRTELCTEVLNTEMDKNPTFITHNGPYRKYGLKENEARAYDLMLHSEMWKST
FT                   PRMITNNLSKVYLDEAKMQGSDIRKATELIFKYGDFLI"
FT   gene            complement(599466..599951)
FT                   /locus_tag="MmarC7_0596"
FT   CDS_pept        complement(599466..599951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0596"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: mmp:MMP1351 ribosomal-protein-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65664"
FT                   /db_xref="GOA:A6VGT8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGT8"
FT                   /protein_id="ABR65664.1"
FT                   /translation="MIVNIRKFREKDLKRVMEIEKESFDKNYPEFLMMHIYTSFPDGFL
FT                   VAENEEGKIVGYIIALMEWGNGHVVSIAVDSAYQNYGIGNALLNAVENFLFNECHAKHC
FT                   VLEVRFDNKKAREFYYKRNYVDRKVLYNYYDDGADAILMIKRRFDLYGNYPIFVNMW"
FT   gene            complement(600087..600875)
FT                   /locus_tag="MmarC7_0597"
FT   CDS_pept        complement(600087..600875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0597"
FT                   /product="thiazole biosynthesis enzyme"
FT                   /note="TIGRFAM: thiazole biosynthesis enzyme; PFAM:
FT                   thiamine biosynthesis Thi4 protein; FAD dependent
FT                   oxidoreductase; KEGG: mmp:MMP1352 NAD binding
FT                   site:TonB-dependent receptor protein:thiamine biosynthesis
FT                   Thi4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65665"
FT                   /db_xref="GOA:A6VGT9"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGT9"
FT                   /protein_id="ABR65665.1"
FT                   /translation="MDGKLRADEVAVTKSILKSTFNMWMDIIDVDVVIIGAGPSGLTAA
FT                   KYLAQNGVKTVVLERHLSFGGGTWGGGMGFPNIVVEKPADEILREAGIKLDEVDGEDEL
FT                   FTADSVEVPAKLGVAAIDAGAKILTGIVVEDLILKEDKIAGVVIQSYAIEKAGLHIDPL
FT                   TISAKYVIDSTGHDASAVHTLARKNKDLGIEVPGEKSMWAEKGENSLTRNTREIFPGLY
FT                   VCGMAANAYHAGYRMGAIFGGMYLSGKKCAEMILEKLENK"
FT   gene            complement(600971..601946)
FT                   /pseudo
FT                   /locus_tag="MmarC7_0598"
FT   gene            602079..603230
FT                   /locus_tag="MmarC7_0599"
FT   CDS_pept        602079..603230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0599"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="TIGRFAM: thiamine biosynthesis/tRNA modification
FT                   protein ThiI; PFAM: thiamine biosynthesis protein; THUMP
FT                   domain protein; ExsB family protein; KEGG: mmp:MMP1354
FT                   thiamine biosynthesis protein:THUMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65666"
FT                   /db_xref="GOA:A6VGU0"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU0"
FT                   /protein_id="ABR65666.1"
FT                   /translation="MKKFIVRYGEIGTKSRQTMHRFEKLLAKNISKLAKKHGISAEVEI
FT                   IHTRLIVDVAEENFEKMKELLKKVPGIVSFSPCYYIDPDIEQIKEISSELFEKELERYK
FT                   NKENITFRVKTQRPQKKFPLTSLEVNMAVGGPISEKYGIKVDLTNPTISLDIEVFNEYA
FT                   YVFAERIEGIGGIPVGTQGRVLVLISDGIDSPVSAYMMAKRGCKLLLLHMKTSDEGLEK
FT                   TQKLAEVLSDFDPEAKFVYVDFKEELAKIKAELTEINRDKYTCIYCKKYMLKLAEKHAK
FT                   WHKCDAIINGDNMGQVASQTLKNLRVISEGIDYPILRPLIGLDKVEIMDIARKIGTFEI
FT                   STSKEVSCFAVPKHPITNATPEEIEKIEEQLSNLRNCDECNNC"
FT   gene            603245..603925
FT                   /locus_tag="MmarC7_0600"
FT   CDS_pept        603245..603925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0600"
FT                   /product="transferase hexapeptide repeat protein"
FT                   /note="KEGG: mmp:MMP1355 bacterial transferase hexapeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65667"
FT                   /db_xref="GOA:A6VGU1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU1"
FT                   /protein_id="ABR65667.1"
FT                   /translation="MNSNPFETYRDIRIMNENPKYLVKGDGIVREKIKSENVEIGEYTY
FT                   YSGYYERKEFKDCIMYLDEIDNRKDVDKLIIGKFCSIASGVKFVMGGNQGHRYDWISTY
FT                   PLTLISETPEDLKSENGKGYLKKGDTVIENDVWIGANVTIMPGVKIGSGAVIATGSVVT
FT                   KEVPPYTIVGGNPAKIIKKRFSEEKIELLLKIKWWDWPIEKIKSNIKILMSDDFEELKK
FT                   ICEE"
FT   gene            complement(603943..604878)
FT                   /locus_tag="MmarC7_0601"
FT   CDS_pept        complement(603943..604878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0601"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mmp:MMP1356
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65668"
FT                   /db_xref="GOA:A6VGU2"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU2"
FT                   /protein_id="ABR65668.1"
FT                   /translation="MKCKKCGGPSIYYQKHSGNNYCRTCFIKETKRKVRKTLGRDVLKN
FT                   NIKVAMGLSGGKDSLVMAHILNEFYKQIPKSKILAIIVNEGIEGYRTDGIDAAVKFCEE
FT                   HGIEYRIVHFKDYLGTNLDEIVKLAKEKNLTMNPCSFCGVIRRKILNRVSIEEKCDYLA
FT                   IGHNLDDVAQAVMMNYIEGDVKKLAFLGKSLKNPKFVKRIKPLEKIPEEEVLLIADLLE
FT                   LKYHKSPCPYSCLSFRSEVCEITDTLEKNHPGAKYSIVRGYERLLEHIELPGYTGECKI
FT                   CGDLSATEVCKVCSYLKNLGILEKSKFEKI"
FT   gene            complement(604894..605148)
FT                   /locus_tag="MmarC7_0602"
FT   CDS_pept        complement(604894..605148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0602"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: mmp:MMP1357
FT                   thiamineS"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65669"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU3"
FT                   /protein_id="ABR65669.1"
FT                   /translation="MDLTIKFFAKCREDFGEGLKISIDLDEVTVLELIEILEKDYNLNL
FT                   KEDFENGKIIVSKDFEIVSSNDLINKSGEIGIYPPVSGG"
FT   gene            complement(605192..605590)
FT                   /locus_tag="MmarC7_0603"
FT   CDS_pept        complement(605192..605590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0603"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mmp:MMP1358 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65670"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU4"
FT                   /protein_id="ABR65670.1"
FT                   /translation="MKKRVFYWISGSNVREPVVSNVVLGTGVMVNILKAKMEPREGFLI
FT                   LELTGDEGQIEKALEILRKFGEAEDIPKMIQKDDEKCIDCGACVVHCPVGALSVDNEFK
FT                   ILLDEEECIGCKNCAKICPVNAIKIFEI"
FT   gene            complement(605604..607145)
FT                   /locus_tag="MmarC7_0604"
FT   CDS_pept        complement(605604..607145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0604"
FT                   /product="protein of unknown function DUF39"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF39; KEGG: mmp:MMP1359 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65671"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR016426"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU5"
FT                   /protein_id="ABR65671.1"
FT                   /translation="MKTVHEINEKIRNGDAVVVTAEEMIDIVDELGAEKAAVEIDVVTT
FT                   GTFGAMCSSGAFLNFGHSDPPIKMYKTYLNGVEAYSGLAAVDAYLGAAQTNSDDDIDIS
FT                   YGGSHVLEDLVAGKEIELVAEGYTTDCYPRKKVSTTITLDDLNQAILVNPRNCYQSYNG
FT                   ATNSTEEKIYTYMGALLPEFGNLNYSGAGQLNPLQNDFNTETKTYNTIGMGTKIFLGGA
FT                   QGYITGAGTQHSPNGGFGTLMVQGDLKEMSTKYLRGATIPKYGSTLYMGIGIPIPVLNA
FT                   EIAKTCAIKDEDISVPILDYGIPRRDRPELGVTNYKQARSGKVTIEVEVEGKKVDKCMK
FT                   TASVSSYKVSREISKELKNWISNSEFTLTERLEPLKSAAPKPMKAKMKLVKDILSKPAV
FT                   VGSLKMSITEASRILIENNINHLPIIDENGKLSGIITSWDIAKAMAQDKHSISEIMTTY
FT                   IVSATPDETIDMAARKMSRNNISGLPVVDSNNKVLGVVSAEDISKLIGRTGLHKI"
FT   gene            607399..607635
FT                   /locus_tag="MmarC7_0605"
FT   CDS_pept        607399..607635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0605"
FT                   /product="RNA polymerase Rpb5"
FT                   /note="PFAM: RNA polymerase Rpb5; KEGG: mmp:MMP1360 RNA
FT                   polymerase H/23 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65672"
FT                   /db_xref="GOA:A6VGU6"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGU6"
FT                   /protein_id="ABR65672.1"
FT                   /translation="MKVSSHAMVPTHEIIPREEIPLLLEKYNIKLQQLPKLLDTDPLVL
FT                   EVEAAPGDVLKITRMSPTAGESTYYRLVIATSL"
FT   gene            607719..609218
FT                   /locus_tag="MmarC7_0606"
FT   CDS_pept        607719..609218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0606"
FT                   /product="RNA polymerase beta subunit"
FT                   /note="PFAM: RNA polymerase Rpb2 domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2 domain 3; KEGG:
FT                   mmp:MMP1361 DNA-directed RNA polymerase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65673"
FT                   /db_xref="GOA:A6VGU7"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU7"
FT                   /protein_id="ABR65673.1"
FT                   /translation="MESRVVVDAFFKENSLVKHHIDSYDDFVKNKIQKIIDEVTGVETE
FT                   IKGGYKVSFDKVRVTKPINKEADGSVKEITPMEARIRNLAYSAPLYLEMIPTVGEDEEE
FT                   KVLSPVEVYIGELPVMLGSEICHLCGKSEEELIKYGEDTKDPLGYFIVNGSEKAVVAQE
FT                   DLIPNRIICEKVEKNNKIVDIAKVFSTRHGFRALCTVERNPDGLLNVSFPGMPSTIPLV
FT                   ILMRALGAESDREIIELISDEPTVVMQLIANLQEAREEHAINTTEDALEHIGKRVAPGQ
FT                   PKEYKLKRAETILCNYLLPHMGVESAKLGAKCKYLGRMAKNSIELYLGLRVEDDKDHYS
FT                   NKRLKLAGDLMEDLFRHSFNQLIKDIKYQLERQAIRNKEPSIQAAVRSDVLTERMRHAM
FT                   ATGNWVGGRTGVSQLLDRTSYLATVSQLRRVVSPLSRSQPHFEARDLHATQWGKICPSE
FT                   TPEGPNCGLVKNLAVMCKVTTDESDDNVIELLKELGLTKEN"
FT   gene            609262..611097
FT                   /locus_tag="MmarC7_0607"
FT   CDS_pept        609262..611097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0607"
FT                   /product="RNA polymerase Rpb2 domain 6"
FT                   /note="PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   Rpb2 domain 7; RNA polymerase Rpb2, domain 4; RNA
FT                   polymerase Rpb2, domain 5; KEGG: mmp:MMP1362 glycoside
FT                   hydrolase, family 1:DNA-directed RNA polymerase, beta
FT                   subunit:ATP/GTP-binding site motif A (P-loop)"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65674"
FT                   /db_xref="GOA:A6VGU8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU8"
FT                   /protein_id="ABR65674.1"
FT                   /translation="MEKQTNVYVNGKLIDTTEDPETLVKNLRDNRRSGKLSPSTSISFN
FT                   EESNDVHISTDGGRAVRPLVVAENGASKLTEELLEKVDAQELTFHELVESGVIEYLDAE
FT                   EEENARIAMYADEVTEENTHVEIDPLVILGIGAGVAPYPEHNSAPRITMAAAMSKQSLG
FT                   IPMANIKWRMDTRGHLLHYPQVPLVRTKHQEILGFDKRPAGQNFVVAVMSYEGYNMEDA
FT                   FIINKASLERGLGRSTFFRSYESFEKRYPGGQLDKFEVPEKGVRGYRAEEAYRNLGDDG
FT                   LIDLESEVRSGDVILGKTSPPRFLEEQEITLQTKSQRRDTSVTIRHGEEGIVDLVILSE
FT                   TKEGNRLGKVRVRDLRIPEFGDKFASRHGQKGVIGLIVPQEDLPYTEDGVIPDLIINPH
FT                   AIPSRMTIGQVLEMIGGKVGSLECRRIDGTIFSGESEWKLREGLEKYGFKHHAKEAMYD
FT                   GKSGRKLECDIFVGVAYYQKLHHLVAGKIHARSRGPIQVLTRQPTEGRAREGGLRFGEM
FT                   ERDVLVAHGAAMLLKERLLDESDPHEDYVCAKCGEIAIFDYKRGMKFCPVCGESEDIQD
FT                   NRKIPPVKIAYAFKLLLDELKSMGIDPKLELKDRA"
FT   gene            611148..613817
FT                   /locus_tag="MmarC7_0608"
FT   CDS_pept        611148..613817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0608"
FT                   /product="DNA-directed RNA polymerase subunit A'"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase subunit A';
FT                   PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 4; SMART: RNA polymerase I subunit A domain protein;
FT                   KEGG: mmp:MMP1363 RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65675"
FT                   /db_xref="GOA:A6VGU9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGU9"
FT                   /protein_id="ABR65675.1"
FT                   /translation="MDRFDVPKEIGDITFGLLSPEQIRTMSVAKIVTADTYDDDGYPID
FT                   GGLMDTRLGVIDPGLVCKSCSGRVGTCPGHFGHIELSKPVIHIGFAKDIYKILKAVCPH
FT                   CGKVTITEIKRDEYLEKMAKLEEDGGDPWTLCDDLLKEAAKGSVCPSCGEVKADVKYDK
FT                   PTAYHQLDGKAQKQLTSSEVREILEKIPGEDCKLLGINAKVARPEYMVLTVLPVPPVTV
FT                   RPSITLESGERSEDDLTHKLVDIIRINQRLEENINGGAPNLIIEDLWDLLQYHINTYFD
FT                   NEAPGIPPARHRSGRPLRTLAQRLKGKEGRFRHNLAGKRVNFSARTVISPDPRLSINEV
FT                   GIPKLIAKELTVPEKVTPYNIERVRALLRNGADTHPGVNYVIKKVKTKDGKEEEYKIKI
FT                   TDANKDMWVENITDGMVIERHLSDGDVVLYNRQPSLHRMSIMAHKVKVLPYRTFRHNLC
FT                   VCPPYNADFDGDEMNVHVPQSEEARAEAETLMLVEKHIVSPRFGGPIIGAIHDFISGAY
FT                   VLTSSLFTKDEALTLLKSSGLDNELGEADVVENKVEYYSGKSLFSKTLPEGLSLQYRAK
FT                   ICKKCDTCTKEECEHDAYVVIRNGKLLQGVIDKNGFGSEAGIILNTLVKDFGSEDARVF
FT                   LDSATKMSIKAMVLKGFTTGIDDEDIPEEAIQEIQDLLNKAEQDVEDIVEKYENGTLES
FT                   LPGRGVEESREAYIMQILGKARDQAGNVAEKYLSKENHAALMARTGARGSLLNITMMAA
FT                   SVGQQSVRGGRVFRGYRERTLPHFGKGSLDAKSHGFVRSCYKKGLAPTEYFFHAMGGRE
FT                   GLVDQAVRTAQSGYMQRRLVNALQDIRAEYDGTVRDSRGLVVQFEYGEDLVDPAKADHG
FT                   KGVDLDKIFTKVNSKYEN"
FT   gene            613862..615022
FT                   /locus_tag="MmarC7_0609"
FT   CDS_pept        613862..615022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0609"
FT                   /product="DNA-directed RNA polymerase, subunit A''"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, subunit A'';
FT                   PFAM: RNA polymerase Rpb1 domain 5; KEGG: mmp:MMP1364 RNA
FT                   polymerase, A/beta'/A' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65676"
FT                   /db_xref="GOA:A6VGV0"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV0"
FT                   /protein_id="ABR65676.1"
FT                   /translation="MQMADLEKKLENSVLPPLLKRELSEKILKEEISEEYLVDEIISET
FT                   IRAYERTLVEPGEAVGVVAAQSIGEPGTQMTMRTFHYAGVAELNVTLGLPRMIEIVDAR
FT                   KEPSTPTMTIYLNDEFKGDREKASMVAKNIESTDVESVSEDISVDLINECITIVLNMHQ
FT                   LESRGLTVADVIESIKSKMKLKIEDHENVLNLKIKTPSLKALRKRLPKVRAIHLKGVQN
FT                   IKRVIIRKEVDEYILYSEGSNIKEVFDIEGVDTTKTTTNNIVEIQDVLGIEAARNAIIY
FT                   EMDATLGNQGLTVDKRHLMMVADLMCTDGVVKPIGRHGIGGEKASVLARAAFEETVKHL
FT                   YSASMRGYVDELGGVVENIIVGKPIAMGTGCIDVCIDKKYEEGKEL"
FT   gene            615226..615546
FT                   /locus_tag="MmarC7_0610"
FT   CDS_pept        615226..615546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0610"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   mmp:MMP1365 ribosomal protein L30E"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65677"
FT                   /db_xref="GOA:A6VGV1"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV1"
FT                   /protein_id="ABR65677.1"
FT                   /translation="MRRRSSMDINRAIRVAVDTGNVVLGTKQAIKNIKHGEGQLVIIAD
FT                   NCAKDVREDIFYYTQLSETPVYTHQATSIELGAICGKPFPVSALLVLEPGNSAILNVNN
FT                   EE"
FT   gene            615563..616084
FT                   /locus_tag="MmarC7_0611"
FT   CDS_pept        615563..616084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0611"
FT                   /product="NusA family KH domain protein"
FT                   /note="TIGRFAM: NusA family KH domain protein; PFAM: KH
FT                   type 2 domain protein; KH type 1 domain protein; SMART: KH
FT                   domain protein; KEGG: mmp:MMP1366 KH domain:KH domain, type
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65678"
FT                   /db_xref="GOA:A6VGV2"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGV2"
FT                   /protein_id="ABR65678.1"
FT                   /translation="MKIKLNTEDIMRISLFEKMTGANVIDSTSDDEKIVFVVKEGDIGA
FT                   AIGKGGENVKSATEKFGKKIDLIEYSEDVKQFIKNIFAPVELEDVWTKKFSDDLVVYVR
FT                   VHPRLRRAVIGDKGKNIDRAVDIAGRLAGVKNIKVVAGLRKDNDKKPKQDEIPEKAAES
FT                   STNVEAEENQ"
FT   gene            616094..616537
FT                   /locus_tag="MmarC7_0612"
FT   CDS_pept        616094..616537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0612"
FT                   /product="ribosomal protein S23 (S12)"
FT                   /note="TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   ribosomal protein S12/S23; KEGG: mmp:MMP1367 SSU ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65679"
FT                   /db_xref="GOA:A6VGV3"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV3"
FT                   /protein_id="ABR65679.1"
FT                   /translation="MAGSKSPKGEFAGRKLLLKRRASRWHHYKYVNKALSLKLKADPLE
FT                   GAPMGRGIVVEKVGLEAKQPNSAIRKCVRVQLIKNGRQVTAFAPGNHAINFIDEHDEVV
FT                   IEGIGGPSGQAKGDIPGVRYKVVMVGKNSIRELVRGRQEKVKR"
FT   gene            616571..617137
FT                   /locus_tag="MmarC7_0613"
FT   CDS_pept        616571..617137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0613"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: mmp:MMP1368 SSU
FT                   ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65680"
FT                   /db_xref="GOA:A6VGV4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV4"
FT                   /protein_id="ABR65680.1"
FT                   /translation="MEIKLFGKWDSETVTVKDPSLKSYVSVAPVLVPHTAGRNSKKSFD
FT                   KSKMNIVERLANKLMANQENTGKKHETLAIVEEALTIIENRTKENPVQVLVDALENSGP
FT                   REETTRISYGGIAFLQSVDVSPSRRLDTAFRNIALGASQSAHKNKKTVAQCLADEIIFA
FT                   SKADMQKSFAVRKKEEKERVAQSAR"
FT   gene            617240..619423
FT                   /locus_tag="MmarC7_0614"
FT   CDS_pept        617240..619423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0614"
FT                   /product="translation elongation factor aEF-2"
FT                   /note="TIGRFAM: translation elongation factor aEF-2; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: mmp:MMP1369 translation elongation factor EF-2"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65681"
FT                   /db_xref="GOA:A6VGV5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV5"
FT                   /protein_id="ABR65681.1"
FT                   /translation="MGRRAKMVEKVKTLMEKHDQIRNMGICAHIDHGKTTLSDNLLAGA
FT                   GMISKELAGDQLALDFDEEEAARGITIYAANVSMVHEYGGKEYLINLIDTPGHVDFGGD
FT                   VTRAMRAIDGAVVVCCAVEGVMPQTETVLRQALKEKVKPVLFINKVDRLINELKLTPEE
FT                   LQGRFMKIIAEVNKLIEKMAPEEFKKEWLCDVVTGKVAFGSAYNNWAISVPYMQRSGIS
FT                   FKDIIDYCEQEKQGELADKAPLHEVILDMAIKHLPNPLQAQKYRIPNIWKGDAESEIGK
FT                   SMVACDPNGPLAGVVTKIIVDKHAGAISACRLFSGRIKQGDDLYLVGSKQKARAQQVSI
FT                   FMGAERVQVPSISAGNICALTGLREATAGETVCSPSEILEPGFESLTHTSEPVITVAIE
FT                   AKNTKDLPKLIEILRQIAREDNTVRVEINEETGEHLISGMGELHIEVITNTKIGRDGGI
FT                   EVDVGEPIVVYRETITGTSPEIEGKSPNKHNKLYMIAEPMDESVYAAYVEGKIHDEDYK
FT                   KKTTADGEARLVEAGLDKDQAKKVMSIYNGNMIVNMTRGIVQLDEARELIIEGFKEGVR
FT                   NGPLAAEKVQGVKIRLVDATFHEDAIHRGPAQIIPAVRFGVRDAVAQAKPVLLEPMQSV
FT                   YINTPQDYMGDGMKEINNRRGQILDMEQEGDMSIIKSSVPVAEMFGFAGAIRGATQGRC
FT                   LWSVEFSGFERVPAELQPKIAKQIRDRKGLKSE"
FT   gene            619508..620794
FT                   /locus_tag="MmarC7_0615"
FT   CDS_pept        619508..620794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0615"
FT                   /product="translation elongation factor EF-1, subunit
FT                   alpha"
FT                   /EC_number="2.7.7.4"
FT                   /note="TIGRFAM: translation elongation factor EF-1, subunit
FT                   alpha; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein; KEGG: mmp:MMP1370 translation elongation
FT                   factor EF-1, subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65682"
FT                   /db_xref="GOA:A6VGV6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV6"
FT                   /protein_id="ABR65682.1"
FT                   /translation="MAKEKPILNVAFIGHVDAGKSTTVGRLLLDGGAIDPQLIVRLRKE
FT                   AEEKGKAGFEFAYVMDGLKEERERGVTIDVAHKKFPTAKYEVTIVDCPGHRDFIKNMIT
FT                   GASQADAAILVVNVDDAKSGIQPQTREHVFLSRTLGISQLAVAINKMDTVNFSEADYNE
FT                   MKKMLGDQLLKMVGFNPDNITFVPVASLHGDNVFKKSDKTPWYNGPTLAEVIDAFQPPE
FT                   KPTTLPLRLPIQDVYSITGVGTVPVGRVETGIIRPGDKVIFEPAGAVGEIKTVEMHHEQ
FT                   LPSAEPGDNIGFNVRGVGKKDIKRGDVLGHTTNPPTVAADFTAQIVVLQHPSVMTVGYT
FT                   PVFHAHTAQIACTFMELQKKLNPATGEVLEENPDFLKAGDAAIVKLMPTKPLVIESVKE
FT                   IPQLGRFAIRDMGMTVAAGMAIQVTAKNK"
FT   gene            620843..621151
FT                   /locus_tag="MmarC7_0616"
FT   CDS_pept        620843..621151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0616"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: mmp:MMP1371 SSU
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65683"
FT                   /db_xref="GOA:A6VGV7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV7"
FT                   /protein_id="ABR65683.1"
FT                   /translation="MQKARIKLSSTQHTELDGVCDQIKAIAEKTGVDMAGPIPLPTKAL
FT                   KVTTRKSTDGEGSSSFDRWTMRVHKRVIDIEADERTMKHIMKVRIPDTVQIEIELRN"
FT   gene            621436..622749
FT                   /locus_tag="MmarC7_0617"
FT   CDS_pept        621436..622749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0617"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: mmp:MMP1372
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65684"
FT                   /db_xref="GOA:A6VGV8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGV8"
FT                   /protein_id="ABR65684.1"
FT                   /translation="MVFKAYDIRGIYEKDLDDNFAYSLGKLVGKKYERIMVGNDIRIGS
FT                   KKLLKPFIYGIIENSKVYYAGEISTPLMYFGTLKKFDLGVILTASHNPKEYTGFKMCDI
FT                   NAIPLSPVDEIKPDFEMFKLSDTQKEEIENLDLESLKVDISSEYSKFLTENIEKTNRKI
FT                   AVDFANGATTHAEKEILEKILENKIFINDFPDGNFPAHEPDTLKKECLIDIINTVKENS
FT                   CEFGLIFDGDGDRIGMVDEEGEILAGDILTAIISNEILNDVKGKIVYDLRCSKIVPEII
FT                   SKNGGTPVKTRVGHYFIKKLMHEIDAEFAGEFSNHFYFKSVGYFESPLLALNYILKALE
FT                   REGKPLSEISKMYKKYFHSGEINFKVVDQNKSIESIEKKYENICKIEKLDGISLYCDDF
FT                   WFNVRSSNTEPLLRLNLEAENEKTMNDKLKEIKDIINS"
FT   gene            complement(622817..623902)
FT                   /locus_tag="MmarC7_0618"
FT   CDS_pept        complement(622817..623902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0618"
FT                   /product="IMP biosynthesis enzyme PurP-like protein"
FT                   /note="PFAM: IMP biosynthesis enzyme PurP-like; IMP
FT                   biosynthesis enzyme PurP; KEGG: mmp:MMP1373 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65685"
FT                   /db_xref="GOA:A6VGV9"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGV9"
FT                   /protein_id="ABR65685.1"
FT                   /translation="MIPKEEIMGIFEKYNKDEVTIVTVGSHTSLHILKGAKLEGFSTAV
FT                   ITTRDRDIPYKRFGVADKFIYVDKFSDISKEEIQQQLRDMNAIIVPHGSFIAYCGLDNV
FT                   EDTFKVPMFGNRAILRWEAERDLEGQLLGGSGLRIPKKYGGPDDIDGPVMVKFPGARGG
FT                   RGYFPCSTVEEFWRKIDEFKAKGILTEDDVAKAHIEEYVVGANYCIHYFYSPLKDQVEL
FT                   MGIDRRYESSIDGLVRVPAKDQLELSIDPSYVITGNFPVVIRESLLPQVFDMGDKLATK
FT                   AKELVKPGMLGPFCLQSLCNENLELVVFEMSARVDGGTNTFMNGSPYSCLYTGEPLSMG
FT                   QRIAREIKLALELKMIDKVIS"
FT   gene            624020..624739
FT                   /locus_tag="MmarC7_0619"
FT   CDS_pept        624020..624739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0619"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="TIGRFAM: ribonuclease HII; PFAM: ribonuclease
FT                   HII/HIII; KEGG: mmp:MMP1374 ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65686"
FT                   /db_xref="GOA:A6VGW0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VGW0"
FT                   /protein_id="ABR65686.1"
FT                   /translation="MNEDIKNNLNNSDEFNGKIIVGLDEAGRGPVIGPMVIASVKINEN
FT                   DLPKLHDLGLKDSKQLTKKKREELYIKISEICDVKKIVIDPEKIDEQMEIINLNKIELG
FT                   AFSKLANHFIKENENISIYIDACSSNEQSFSNQFKAKLINKNVEIIAEHKADENYKIVS
FT                   AASIIAKVTRDNVIEEYKEIFGEIGSGYPSDPKTKKFLKNYVHENKGLPKIARKSWATS
FT                   KNLLKEIEESKIFQWVK"
FT   gene            624739..625611
FT                   /locus_tag="MmarC7_0620"
FT   CDS_pept        624739..625611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0620"
FT                   /product="tRNA methyltransferase complex GCD14 subunit"
FT                   /note="PFAM: tRNA methyltransferase complex GCD14 subunit;
FT                   KEGG: mmp:MMP1375 SAM (and some other nucleotide) binding
FT                   motif"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65687"
FT                   /db_xref="GOA:A6VGW1"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGW1"
FT                   /protein_id="ABR65687.1"
FT                   /translation="MVNKTLVIDNRGKKYLLNKDLDNFGNDLGVVDLVGKEEGSILMTN
FT                   KGGEFYFVTPTIHDIIKKMKRSVTTLLPKDIGLIIAECGIENGETVVEAGTGSAALTIY
FT                   LANAVGKEGKIITYEKRPEFAKIARKNLEIVGAVRKNQKIIGIDDEDEEEMEIVENGLY
FT                   NVTQKIGDITEKIEEENIDVLVLDMPDPWNVVEHAKKSLKKAKGRIAIYVPYVEQAKKG
FT                   VEALKEHGFLDIRTVECIVRDIEISEKGVRPSTRMIGHTGYITTARVCPEEVVKYVPKK
FT                   PKDAEKIEE"
FT   gene            625701..625961
FT                   /locus_tag="MmarC7_0621"
FT   CDS_pept        625701..625961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MmarC7_0621"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: mmp:MMP1376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MmarC7_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABR65688"
FT                   /db_xref="GOA:A6VGW2"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A6VGW2"
FT                   /prote