(data stored in SCRATCH3701 zone)

EMBL: CP000746

ID   CP000746; SV 1; circular; genomic DNA; STD; PRO; 2319663 BP.
XX
AC   CP000746; AAKC01000000-AAKC01000117;
XX
PR   Project:PRJNA13370;
XX
DT   06-JUL-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Actinobacillus succinogenes 130Z, complete genome.
XX
KW   .
XX
OS   Actinobacillus succinogenes 130Z
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Actinobacillus.
XX
RN   [1]
RP   1-2319663
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Lowry S., Clum A., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Ivanova N., Vieille C., Richardson P.;
RT   "Complete sequence of Actinobacillus succinogenes 130Z";
RL   Unpublished.
XX
RN   [2]
RP   1-2319663
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Lowry S., Clum A., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Ivanova N., Vieille C., Richardson P.;
RT   ;
RL   Submitted (25-JUN-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 0f3839ee38897128a955f83903e969dd.
DR   BioSample; SAMN02598296.
DR   EnsemblGenomes-Gn; Asuc_R0001.
DR   EnsemblGenomes-Gn; Asuc_R0002.
DR   EnsemblGenomes-Gn; Asuc_R0003.
DR   EnsemblGenomes-Gn; Asuc_R0004.
DR   EnsemblGenomes-Gn; Asuc_R0005.
DR   EnsemblGenomes-Gn; Asuc_R0006.
DR   EnsemblGenomes-Gn; Asuc_R0007.
DR   EnsemblGenomes-Gn; Asuc_R0008.
DR   EnsemblGenomes-Gn; Asuc_R0009.
DR   EnsemblGenomes-Gn; Asuc_R0010.
DR   EnsemblGenomes-Gn; Asuc_R0011.
DR   EnsemblGenomes-Gn; Asuc_R0012.
DR   EnsemblGenomes-Gn; Asuc_R0013.
DR   EnsemblGenomes-Gn; Asuc_R0014.
DR   EnsemblGenomes-Gn; Asuc_R0015.
DR   EnsemblGenomes-Gn; Asuc_R0016.
DR   EnsemblGenomes-Gn; Asuc_R0017.
DR   EnsemblGenomes-Gn; Asuc_R0018.
DR   EnsemblGenomes-Gn; Asuc_R0019.
DR   EnsemblGenomes-Gn; Asuc_R0020.
DR   EnsemblGenomes-Gn; Asuc_R0021.
DR   EnsemblGenomes-Gn; Asuc_R0022.
DR   EnsemblGenomes-Gn; Asuc_R0023.
DR   EnsemblGenomes-Gn; Asuc_R0024.
DR   EnsemblGenomes-Gn; Asuc_R0025.
DR   EnsemblGenomes-Gn; Asuc_R0026.
DR   EnsemblGenomes-Gn; Asuc_R0027.
DR   EnsemblGenomes-Gn; Asuc_R0028.
DR   EnsemblGenomes-Gn; Asuc_R0029.
DR   EnsemblGenomes-Gn; Asuc_R0030.
DR   EnsemblGenomes-Gn; Asuc_R0031.
DR   EnsemblGenomes-Gn; Asuc_R0032.
DR   EnsemblGenomes-Gn; Asuc_R0033.
DR   EnsemblGenomes-Gn; Asuc_R0034.
DR   EnsemblGenomes-Gn; Asuc_R0035.
DR   EnsemblGenomes-Gn; Asuc_R0036.
DR   EnsemblGenomes-Gn; Asuc_R0037.
DR   EnsemblGenomes-Gn; Asuc_R0038.
DR   EnsemblGenomes-Gn; Asuc_R0039.
DR   EnsemblGenomes-Gn; Asuc_R0040.
DR   EnsemblGenomes-Gn; Asuc_R0041.
DR   EnsemblGenomes-Gn; Asuc_R0042.
DR   EnsemblGenomes-Gn; Asuc_R0043.
DR   EnsemblGenomes-Gn; Asuc_R0044.
DR   EnsemblGenomes-Gn; Asuc_R0045.
DR   EnsemblGenomes-Gn; Asuc_R0046.
DR   EnsemblGenomes-Gn; Asuc_R0047.
DR   EnsemblGenomes-Gn; Asuc_R0048.
DR   EnsemblGenomes-Gn; Asuc_R0049.
DR   EnsemblGenomes-Gn; Asuc_R0050.
DR   EnsemblGenomes-Gn; Asuc_R0051.
DR   EnsemblGenomes-Gn; Asuc_R0052.
DR   EnsemblGenomes-Gn; Asuc_R0053.
DR   EnsemblGenomes-Gn; Asuc_R0054.
DR   EnsemblGenomes-Gn; Asuc_R0055.
DR   EnsemblGenomes-Gn; Asuc_R0056.
DR   EnsemblGenomes-Gn; Asuc_R0057.
DR   EnsemblGenomes-Gn; Asuc_R0058.
DR   EnsemblGenomes-Gn; Asuc_R0059.
DR   EnsemblGenomes-Gn; Asuc_R0060.
DR   EnsemblGenomes-Gn; Asuc_R0061.
DR   EnsemblGenomes-Gn; Asuc_R0062.
DR   EnsemblGenomes-Gn; Asuc_R0063.
DR   EnsemblGenomes-Gn; Asuc_R0065.
DR   EnsemblGenomes-Gn; Asuc_R0066.
DR   EnsemblGenomes-Gn; Asuc_R0067.
DR   EnsemblGenomes-Gn; Asuc_R0068.
DR   EnsemblGenomes-Gn; Asuc_R0069.
DR   EnsemblGenomes-Gn; Asuc_R0070.
DR   EnsemblGenomes-Gn; Asuc_R0072.
DR   EnsemblGenomes-Gn; Asuc_R0073.
DR   EnsemblGenomes-Gn; Asuc_R0074.
DR   EnsemblGenomes-Gn; Asuc_R0075.
DR   EnsemblGenomes-Gn; Asuc_R0076.
DR   EnsemblGenomes-Gn; Asuc_R0077.
DR   EnsemblGenomes-Gn; Asuc_R0078.
DR   EnsemblGenomes-Gn; Asuc_R0079.
DR   EnsemblGenomes-Gn; Asuc_R0080.
DR   EnsemblGenomes-Gn; Asuc_R0081.
DR   EnsemblGenomes-Gn; Asuc_R0082.
DR   EnsemblGenomes-Gn; EBG00001154733.
DR   EnsemblGenomes-Gn; EBG00001154734.
DR   EnsemblGenomes-Gn; EBG00001154735.
DR   EnsemblGenomes-Gn; EBG00001154736.
DR   EnsemblGenomes-Gn; EBG00001154737.
DR   EnsemblGenomes-Gn; EBG00001154738.
DR   EnsemblGenomes-Gn; EBG00001154739.
DR   EnsemblGenomes-Gn; EBG00001154740.
DR   EnsemblGenomes-Gn; EBG00001154741.
DR   EnsemblGenomes-Gn; EBG00001154742.
DR   EnsemblGenomes-Gn; EBG00001154743.
DR   EnsemblGenomes-Gn; EBG00001154744.
DR   EnsemblGenomes-Gn; EBG00001154745.
DR   EnsemblGenomes-Gn; EBG00001154746.
DR   EnsemblGenomes-Gn; EBG00001154747.
DR   EnsemblGenomes-Gn; EBG00001154748.
DR   EnsemblGenomes-Gn; EBG00001154749.
DR   EnsemblGenomes-Gn; EBG00001154750.
DR   EnsemblGenomes-Gn; EBG00001154751.
DR   EnsemblGenomes-Gn; EBG00001154752.
DR   EnsemblGenomes-Gn; EBG00001154753.
DR   EnsemblGenomes-Gn; EBG00001154754.
DR   EnsemblGenomes-Gn; EBG00001154755.
DR   EnsemblGenomes-Gn; EBG00001154756.
DR   EnsemblGenomes-Gn; EBG00001154757.
DR   EnsemblGenomes-Gn; EBG00001154758.
DR   EnsemblGenomes-Gn; EBG00001154759.
DR   EnsemblGenomes-Gn; EBG00001154760.
DR   EnsemblGenomes-Gn; EBG00001154761.
DR   EnsemblGenomes-Gn; EBG00001154762.
DR   EnsemblGenomes-Gn; EBG00001154763.
DR   EnsemblGenomes-Gn; EBG00001154764.
DR   EnsemblGenomes-Gn; EBG00001154765.
DR   EnsemblGenomes-Gn; EBG00001154766.
DR   EnsemblGenomes-Gn; EBG00001154767.
DR   EnsemblGenomes-Gn; EBG00001154768.
DR   EnsemblGenomes-Gn; EBG00001154769.
DR   EnsemblGenomes-Gn; EBG00001154770.
DR   EnsemblGenomes-Gn; EBG00001154771.
DR   EnsemblGenomes-Gn; EBG00001154772.
DR   EnsemblGenomes-Gn; EBG00001154773.
DR   EnsemblGenomes-Gn; EBG00001154774.
DR   EnsemblGenomes-Gn; EBG00001154775.
DR   EnsemblGenomes-Gn; EBG00001154776.
DR   EnsemblGenomes-Gn; EBG00001154777.
DR   EnsemblGenomes-Gn; EBG00001154778.
DR   EnsemblGenomes-Gn; EBG00001154779.
DR   EnsemblGenomes-Gn; EBG00001154780.
DR   EnsemblGenomes-Gn; EBG00001154781.
DR   EnsemblGenomes-Gn; EBG00001154782.
DR   EnsemblGenomes-Gn; EBG00001154783.
DR   EnsemblGenomes-Gn; EBG00001154784.
DR   EnsemblGenomes-Gn; EBG00001154785.
DR   EnsemblGenomes-Gn; EBG00001154786.
DR   EnsemblGenomes-Gn; EBG00001154787.
DR   EnsemblGenomes-Gn; EBG00001154788.
DR   EnsemblGenomes-Gn; EBG00001154789.
DR   EnsemblGenomes-Gn; EBG00001154790.
DR   EnsemblGenomes-Gn; EBG00001154791.
DR   EnsemblGenomes-Gn; EBG00001154792.
DR   EnsemblGenomes-Gn; EBG00001154793.
DR   EnsemblGenomes-Gn; EBG00001154794.
DR   EnsemblGenomes-Gn; EBG00001154795.
DR   EnsemblGenomes-Gn; EBG00001154796.
DR   EnsemblGenomes-Gn; EBG00001154797.
DR   EnsemblGenomes-Gn; EBG00001154798.
DR   EnsemblGenomes-Gn; EBG00001154799.
DR   EnsemblGenomes-Gn; EBG00001154800.
DR   EnsemblGenomes-Gn; EBG00001154801.
DR   EnsemblGenomes-Gn; EBG00001154802.
DR   EnsemblGenomes-Gn; EBG00001154803.
DR   EnsemblGenomes-Gn; EBG00001154804.
DR   EnsemblGenomes-Gn; EBG00001154805.
DR   EnsemblGenomes-Gn; EBG00001154806.
DR   EnsemblGenomes-Gn; EBG00001154807.
DR   EnsemblGenomes-Gn; EBG00001154808.
DR   EnsemblGenomes-Gn; EBG00001154809.
DR   EnsemblGenomes-Gn; EBG00001154810.
DR   EnsemblGenomes-Gn; EBG00001154811.
DR   EnsemblGenomes-Gn; EBG00001154812.
DR   EnsemblGenomes-Gn; EBG00001154813.
DR   EnsemblGenomes-Gn; EBG00001154814.
DR   EnsemblGenomes-Gn; EBG00001154815.
DR   EnsemblGenomes-Gn; EBG00001154816.
DR   EnsemblGenomes-Gn; EBG00001154817.
DR   EnsemblGenomes-Gn; EBG00001154818.
DR   EnsemblGenomes-Gn; EBG00001154819.
DR   EnsemblGenomes-Gn; EBG00001154820.
DR   EnsemblGenomes-Gn; EBG00001154821.
DR   EnsemblGenomes-Gn; EBG00001154822.
DR   EnsemblGenomes-Gn; EBG00001154823.
DR   EnsemblGenomes-Gn; EBG00001154824.
DR   EnsemblGenomes-Gn; EBG00001154825.
DR   EnsemblGenomes-Gn; EBG00001154826.
DR   EnsemblGenomes-Gn; EBG00001154827.
DR   EnsemblGenomes-Gn; EBG00001154828.
DR   EnsemblGenomes-Gn; EBG00001154829.
DR   EnsemblGenomes-Gn; EBG00001154830.
DR   EnsemblGenomes-Gn; EBG00001154831.
DR   EnsemblGenomes-Gn; EBG00001154832.
DR   EnsemblGenomes-Tr; Asuc_R0001-1.
DR   EnsemblGenomes-Tr; Asuc_R0002-1.
DR   EnsemblGenomes-Tr; Asuc_R0003-1.
DR   EnsemblGenomes-Tr; Asuc_R0004-1.
DR   EnsemblGenomes-Tr; Asuc_R0005-1.
DR   EnsemblGenomes-Tr; Asuc_R0006-1.
DR   EnsemblGenomes-Tr; Asuc_R0007-1.
DR   EnsemblGenomes-Tr; Asuc_R0008-1.
DR   EnsemblGenomes-Tr; Asuc_R0009-1.
DR   EnsemblGenomes-Tr; Asuc_R0010-1.
DR   EnsemblGenomes-Tr; Asuc_R0011-1.
DR   EnsemblGenomes-Tr; Asuc_R0012-1.
DR   EnsemblGenomes-Tr; Asuc_R0013-1.
DR   EnsemblGenomes-Tr; Asuc_R0014-1.
DR   EnsemblGenomes-Tr; Asuc_R0015-1.
DR   EnsemblGenomes-Tr; Asuc_R0016-1.
DR   EnsemblGenomes-Tr; Asuc_R0017-1.
DR   EnsemblGenomes-Tr; Asuc_R0018-1.
DR   EnsemblGenomes-Tr; Asuc_R0019-1.
DR   EnsemblGenomes-Tr; Asuc_R0020-1.
DR   EnsemblGenomes-Tr; Asuc_R0021-1.
DR   EnsemblGenomes-Tr; Asuc_R0022-1.
DR   EnsemblGenomes-Tr; Asuc_R0023-1.
DR   EnsemblGenomes-Tr; Asuc_R0024-1.
DR   EnsemblGenomes-Tr; Asuc_R0025-1.
DR   EnsemblGenomes-Tr; Asuc_R0026-1.
DR   EnsemblGenomes-Tr; Asuc_R0027-1.
DR   EnsemblGenomes-Tr; Asuc_R0028-1.
DR   EnsemblGenomes-Tr; Asuc_R0029-1.
DR   EnsemblGenomes-Tr; Asuc_R0030-1.
DR   EnsemblGenomes-Tr; Asuc_R0031-1.
DR   EnsemblGenomes-Tr; Asuc_R0032-1.
DR   EnsemblGenomes-Tr; Asuc_R0033-1.
DR   EnsemblGenomes-Tr; Asuc_R0034-1.
DR   EnsemblGenomes-Tr; Asuc_R0035-1.
DR   EnsemblGenomes-Tr; Asuc_R0036-1.
DR   EnsemblGenomes-Tr; Asuc_R0037-1.
DR   EnsemblGenomes-Tr; Asuc_R0038-1.
DR   EnsemblGenomes-Tr; Asuc_R0039-1.
DR   EnsemblGenomes-Tr; Asuc_R0040-1.
DR   EnsemblGenomes-Tr; Asuc_R0041-1.
DR   EnsemblGenomes-Tr; Asuc_R0042-1.
DR   EnsemblGenomes-Tr; Asuc_R0043-1.
DR   EnsemblGenomes-Tr; Asuc_R0044-1.
DR   EnsemblGenomes-Tr; Asuc_R0045-1.
DR   EnsemblGenomes-Tr; Asuc_R0046-1.
DR   EnsemblGenomes-Tr; Asuc_R0047-1.
DR   EnsemblGenomes-Tr; Asuc_R0048-1.
DR   EnsemblGenomes-Tr; Asuc_R0049-1.
DR   EnsemblGenomes-Tr; Asuc_R0050-1.
DR   EnsemblGenomes-Tr; Asuc_R0051-1.
DR   EnsemblGenomes-Tr; Asuc_R0052-1.
DR   EnsemblGenomes-Tr; Asuc_R0053-1.
DR   EnsemblGenomes-Tr; Asuc_R0054-1.
DR   EnsemblGenomes-Tr; Asuc_R0055-1.
DR   EnsemblGenomes-Tr; Asuc_R0056-1.
DR   EnsemblGenomes-Tr; Asuc_R0057-1.
DR   EnsemblGenomes-Tr; Asuc_R0058-1.
DR   EnsemblGenomes-Tr; Asuc_R0059-1.
DR   EnsemblGenomes-Tr; Asuc_R0060-1.
DR   EnsemblGenomes-Tr; Asuc_R0061-1.
DR   EnsemblGenomes-Tr; Asuc_R0062-1.
DR   EnsemblGenomes-Tr; Asuc_R0063-1.
DR   EnsemblGenomes-Tr; Asuc_R0065-1.
DR   EnsemblGenomes-Tr; Asuc_R0066-1.
DR   EnsemblGenomes-Tr; Asuc_R0067-1.
DR   EnsemblGenomes-Tr; Asuc_R0068-1.
DR   EnsemblGenomes-Tr; Asuc_R0069-1.
DR   EnsemblGenomes-Tr; Asuc_R0070-1.
DR   EnsemblGenomes-Tr; Asuc_R0072-1.
DR   EnsemblGenomes-Tr; Asuc_R0073-1.
DR   EnsemblGenomes-Tr; Asuc_R0074-1.
DR   EnsemblGenomes-Tr; Asuc_R0075-1.
DR   EnsemblGenomes-Tr; Asuc_R0076-1.
DR   EnsemblGenomes-Tr; Asuc_R0077-1.
DR   EnsemblGenomes-Tr; Asuc_R0078-1.
DR   EnsemblGenomes-Tr; Asuc_R0079-1.
DR   EnsemblGenomes-Tr; Asuc_R0080-1.
DR   EnsemblGenomes-Tr; Asuc_R0081-1.
DR   EnsemblGenomes-Tr; Asuc_R0082-1.
DR   EnsemblGenomes-Tr; EBT00001743626.
DR   EnsemblGenomes-Tr; EBT00001743627.
DR   EnsemblGenomes-Tr; EBT00001743628.
DR   EnsemblGenomes-Tr; EBT00001743629.
DR   EnsemblGenomes-Tr; EBT00001743630.
DR   EnsemblGenomes-Tr; EBT00001743631.
DR   EnsemblGenomes-Tr; EBT00001743632.
DR   EnsemblGenomes-Tr; EBT00001743633.
DR   EnsemblGenomes-Tr; EBT00001743634.
DR   EnsemblGenomes-Tr; EBT00001743635.
DR   EnsemblGenomes-Tr; EBT00001743636.
DR   EnsemblGenomes-Tr; EBT00001743637.
DR   EnsemblGenomes-Tr; EBT00001743638.
DR   EnsemblGenomes-Tr; EBT00001743639.
DR   EnsemblGenomes-Tr; EBT00001743640.
DR   EnsemblGenomes-Tr; EBT00001743641.
DR   EnsemblGenomes-Tr; EBT00001743642.
DR   EnsemblGenomes-Tr; EBT00001743643.
DR   EnsemblGenomes-Tr; EBT00001743644.
DR   EnsemblGenomes-Tr; EBT00001743645.
DR   EnsemblGenomes-Tr; EBT00001743646.
DR   EnsemblGenomes-Tr; EBT00001743647.
DR   EnsemblGenomes-Tr; EBT00001743648.
DR   EnsemblGenomes-Tr; EBT00001743649.
DR   EnsemblGenomes-Tr; EBT00001743650.
DR   EnsemblGenomes-Tr; EBT00001743651.
DR   EnsemblGenomes-Tr; EBT00001743652.
DR   EnsemblGenomes-Tr; EBT00001743653.
DR   EnsemblGenomes-Tr; EBT00001743654.
DR   EnsemblGenomes-Tr; EBT00001743655.
DR   EnsemblGenomes-Tr; EBT00001743656.
DR   EnsemblGenomes-Tr; EBT00001743657.
DR   EnsemblGenomes-Tr; EBT00001743658.
DR   EnsemblGenomes-Tr; EBT00001743659.
DR   EnsemblGenomes-Tr; EBT00001743660.
DR   EnsemblGenomes-Tr; EBT00001743661.
DR   EnsemblGenomes-Tr; EBT00001743662.
DR   EnsemblGenomes-Tr; EBT00001743663.
DR   EnsemblGenomes-Tr; EBT00001743664.
DR   EnsemblGenomes-Tr; EBT00001743665.
DR   EnsemblGenomes-Tr; EBT00001743666.
DR   EnsemblGenomes-Tr; EBT00001743667.
DR   EnsemblGenomes-Tr; EBT00001743668.
DR   EnsemblGenomes-Tr; EBT00001743669.
DR   EnsemblGenomes-Tr; EBT00001743670.
DR   EnsemblGenomes-Tr; EBT00001743671.
DR   EnsemblGenomes-Tr; EBT00001743672.
DR   EnsemblGenomes-Tr; EBT00001743673.
DR   EnsemblGenomes-Tr; EBT00001743674.
DR   EnsemblGenomes-Tr; EBT00001743675.
DR   EnsemblGenomes-Tr; EBT00001743676.
DR   EnsemblGenomes-Tr; EBT00001743677.
DR   EnsemblGenomes-Tr; EBT00001743678.
DR   EnsemblGenomes-Tr; EBT00001743679.
DR   EnsemblGenomes-Tr; EBT00001743680.
DR   EnsemblGenomes-Tr; EBT00001743681.
DR   EnsemblGenomes-Tr; EBT00001743682.
DR   EnsemblGenomes-Tr; EBT00001743683.
DR   EnsemblGenomes-Tr; EBT00001743684.
DR   EnsemblGenomes-Tr; EBT00001743685.
DR   EnsemblGenomes-Tr; EBT00001743686.
DR   EnsemblGenomes-Tr; EBT00001743687.
DR   EnsemblGenomes-Tr; EBT00001743688.
DR   EnsemblGenomes-Tr; EBT00001743689.
DR   EnsemblGenomes-Tr; EBT00001743690.
DR   EnsemblGenomes-Tr; EBT00001743691.
DR   EnsemblGenomes-Tr; EBT00001743692.
DR   EnsemblGenomes-Tr; EBT00001743693.
DR   EnsemblGenomes-Tr; EBT00001743694.
DR   EnsemblGenomes-Tr; EBT00001743695.
DR   EnsemblGenomes-Tr; EBT00001743696.
DR   EnsemblGenomes-Tr; EBT00001743697.
DR   EnsemblGenomes-Tr; EBT00001743698.
DR   EnsemblGenomes-Tr; EBT00001743699.
DR   EnsemblGenomes-Tr; EBT00001743700.
DR   EnsemblGenomes-Tr; EBT00001743701.
DR   EnsemblGenomes-Tr; EBT00001743702.
DR   EnsemblGenomes-Tr; EBT00001743703.
DR   EnsemblGenomes-Tr; EBT00001743704.
DR   EnsemblGenomes-Tr; EBT00001743705.
DR   EnsemblGenomes-Tr; EBT00001743706.
DR   EnsemblGenomes-Tr; EBT00001743707.
DR   EnsemblGenomes-Tr; EBT00001743708.
DR   EnsemblGenomes-Tr; EBT00001743709.
DR   EnsemblGenomes-Tr; EBT00001743710.
DR   EnsemblGenomes-Tr; EBT00001743711.
DR   EnsemblGenomes-Tr; EBT00001743712.
DR   EnsemblGenomes-Tr; EBT00001743713.
DR   EnsemblGenomes-Tr; EBT00001743714.
DR   EnsemblGenomes-Tr; EBT00001743715.
DR   EnsemblGenomes-Tr; EBT00001743716.
DR   EnsemblGenomes-Tr; EBT00001743717.
DR   EnsemblGenomes-Tr; EBT00001743718.
DR   EnsemblGenomes-Tr; EBT00001743719.
DR   EnsemblGenomes-Tr; EBT00001743720.
DR   EnsemblGenomes-Tr; EBT00001743721.
DR   EnsemblGenomes-Tr; EBT00001743722.
DR   EnsemblGenomes-Tr; EBT00001743723.
DR   EnsemblGenomes-Tr; EBT00001743724.
DR   EnsemblGenomes-Tr; EBT00001743725.
DR   EuropePMC; PMC3091790; 21118570.
DR   EuropePMC; PMC3096633; 21611187.
DR   EuropePMC; PMC3256633; 22081396.
DR   EuropePMC; PMC4464251; 26063229.
DR   EuropePMC; PMC4875751; 27206730.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01344; CRISPR-DR34.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP000746.
DR   SILVA-SSU; CP000746.
DR   StrainInfo; 301727; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000129
CC   Source DNA and bacteria available from Claire Vieille
CC   (vieille@msu.edu)
CC   Contacts: Claire Vieille (vieille@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2319663
FT                   /organism="Actinobacillus succinogenes 130Z"
FT                   /strain="130Z"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:339671"
FT   gene            252..1619
FT                   /locus_tag="Asuc_0001"
FT   CDS_pept        252..1619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: msu:MS0485 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73383"
FT                   /db_xref="GOA:A6VK86"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VK86"
FT                   /protein_id="ABR73383.1"
FT                   /translation="MNRNTSSLWADCLLQLQDQVPADKFQMWLRPLQADISSPNQLTIY
FT                   VQNFFSRQWVENNYLADITKLARQLTGNPDFVVKLVEGVKPAPKQNNIVTTKQNAETAV
FT                   DSEQHLQSVEFKTGLNSNHLFENFVEGKSNQLARAVGIKVANNPGDKTANPLFLYGGTG
FT                   LGKTHLLHAVGNGILANNPKARVLYIHAERFVQEYVKATKLGAAENFKKFYRNLDALLI
FT                   DDIQFFAGKELTQEEFFNTFNNLFEGEKQIILTSDRYPREIEKIEDRLKSRFSWGLSVA
FT                   IEPPELETRVAILMKKAEERGVNLAEEVAFFIGQKLRTHVRELEGALNRVIANAEFTGK
FT                   TITIDFVRDTLKDMLALQDKLVTIDNIQKVVAEYYRIKVSDLNSKNRSRSVARPRQLAM
FT                   ALAKELTNRSFPEIGKNFGGKDHTTVIYACDKIQELRETDSSIQEDWSNLIRTLSA"
FT   gene            1638..2738
FT                   /locus_tag="Asuc_0002"
FT   CDS_pept        1638..2738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: msu:MS0486 DNA polymerase
FT                   III beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73384"
FT                   /db_xref="GOA:A6VK87"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK87"
FT                   /protein_id="ABR73384.1"
FT                   /translation="MQFIVSRENLLKPLQQVCGVLSSRPNVPVLNNVLLQIEGDRLTIT
FT                   GTDLEVELSTQAQLNSHGEGTFTIPAKKFLDICRSLPEDAVITVDFEQDRAIVRSSRTK
FT                   FNLATFPAEEYPNLTDWQSEVDFTVSQATMRRLIEATQFSMANNDARYFLNGMKFETEG
FT                   NLLRTVATDGHRLAVCTIELEQDLQNHSVILPRKGVLELARLLDATSEQPARVQIGTNN
FT                   FRVELGSVVFTSKLIDGRFPDYRRVLPRNANRILESDWENLKQSFVRASILSSEKVRTV
FT                   RLELNQNQLTITAKNPEQEEVEEILDVSYQSEPIEIGFNVSYVLDVLNALKCQRVRVRF
FT                   TDASSSCLIEDCEDNTAEYVIMPMKL"
FT   gene            2768..3844
FT                   /locus_tag="Asuc_0003"
FT   CDS_pept        2768..3844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: msu:MS0487 recombinational
FT                   DNA repair ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73385"
FT                   /db_xref="GOA:A6VK88"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VK88"
FT                   /protein_id="ABR73385.1"
FT                   /translation="MAISRLIIENFRNLAAVDLEFDHGFNFLVGNNGSGKTSLLESIFY
FT                   LGHGRSFKSSVSTRIITYDKPYFTLHGRIWEQQHEWSVGLQKQRKEGLTLVKINGEDGN
FT                   KISDLAHLLPMQMITPEGLTLLNGGPSYRRAFLDWGLFHHRPNFHSAWSALNRLLKQRN
FT                   AALQQTYDYTDLQVWDVELSKLAHQVSLWRTDYAEALRPEIEQTCRLFLPELDIQVSFH
FT                   QGWDKNTDYGDLLRENFARDKHIGYTVSGPQKADFRFKANGFPVEDVLSRGQLKLLMCA
FT                   LRLAQGEHLMVQKNRSCIFLIDDFASELDETKRGLLAERLRQSHSQVFVTAITAEQLKQ
FT                   MQPENHRTFSVNNGMISL"
FT   gene            3875..4477
FT                   /locus_tag="Asuc_0004"
FT   CDS_pept        3875..4477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS0296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73386"
FT                   /db_xref="GOA:A6VK89"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK89"
FT                   /protein_id="ABR73386.1"
FT                   /translation="MQKTQLFFQSLYVTLYFLVASLIPFVALLVDVIYFRNAVGEESAV
FT                   EYCQDIFLVILSVLFFRQAHKHPEARSGFLLMGFFFLTMLIREMDNIFDALIYHGSWSL
FT                   LAAPLATFAVVYALLNKTETLNALTDFTQSKEFYSFIIGLLLVLVISRLIGMSWLWRSI
FT                   FYYTYPRIVKNIAEEYTELLGYAIMCFSCVKYIRGKA"
FT   gene            complement(4586..6280)
FT                   /locus_tag="Asuc_0005"
FT   CDS_pept        complement(4586..6280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0005"
FT                   /product="D-lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /note="PFAM: FAD linked oxidase domain protein; D-lactate
FT                   dehydrogenase membrane binding; KEGG: hin:HI1649 D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73387"
FT                   /db_xref="GOA:A6VK90"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012256"
FT                   /db_xref="InterPro:IPR015409"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016172"
FT                   /db_xref="InterPro:IPR016173"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK90"
FT                   /protein_id="ABR73387.1"
FT                   /translation="MSMQQLVSTLTQIVTPSYIITEPSKTEAYRNGYRFGTGNALAVVR
FT                   PANLLEFWQVLKACVEQDVIVINQAANTGLTGGSTPSGNDYDRPIVIINTMRMDSIQVI
FT                   NNAHQVVCFPGSTLNKLENVLQPYGREPHSVIGSSCIGASVIGGVCNNSGGALVQRGPA
FT                   YTEMALFAQLNENGELELKNHLGIDLGSTPEEILTNLQNHHYQQKDIKQNCGNGHDHSY
FT                   CHHVRQVDEDTPARFNADPARHYEASGSAGKLAIFAVRLDTFPLEKNTAVFYIGTNRTS
FT                   VLSDLRRHMLSNFEELPVSGEYIHRDAFDIAARYGKDTFWVIKKFGTDWLPKLFALKAN
FT                   VDRLSKKLPFVPSHFSDKFMQWCSKLIPEHLPKSLWQYRERYEHHLILKMGGKGVEEAR
FT                   AYLADYFKDSGKGAYFECNKAETQAAMLHRFAVASAAIRYRAIHSKEVEEIVALDIALR
FT                   RNDSDWFEMLPPEIDSKIIHKLYYGHFMCHVFHQDYIIKKGCDYEEVEHDMLKLLDRRG
FT                   AQYPAEHNVGHLYEAKPALRKFYKVLDPTNSFNPGIGKTSKKKYWHE"
FT   gene            complement(6429..8249)
FT                   /locus_tag="Asuc_0006"
FT   CDS_pept        complement(6429..8249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0006"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   TrkA-N domain protein; sodium/hydrogen exchanger; KEGG:
FT                   hso:HS_1497 glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73388"
FT                   /db_xref="GOA:A6VK91"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK91"
FT                   /protein_id="ABR73388.1"
FT                   /translation="MAAVEGANQLVHVVTLLGAAVIAVPLFKRLGLGSVLGYLAAGLII
FT                   GPFGLRLFTEPQSIIHVAELGVVMFLFLIGLEMKPSQLWGLRKQIFGLGMLQVLLSGSL
FT                   VMSVARIGLGFSWQTAFIIASGFVLNSTAIVMQILSERNEMASSRGQKMISILLFEDLL
FT                   IVPLLAIVAFLSPVTDIDTHEPLWQKFAIGTGSLTILIVSGIWLLNPLFKALAWTKLRE
FT                   MMTAAALLVVLGSALLMEHAGLSAAMGAFVAGVLLSNSSFRHQLEADIEPFRGLLLGLF
FT                   FLGVGMSLDLNLVFAHLWFILLGVIALMIVNGFGVFLAALLTRSSFSEALDRAFVMALG
FT                   GEFAFVIFAAAAGQRVITPQQQANGVAIIVLSMVFSPLFVLFHKKYLEPRLRKPNEERE
FT                   ADNIDEIRPIIMVGFGRFGQIINEVLTMTNHKVTIIDRDEEIITGMRKLGIKAYYGNAE
FT                   RPEILHHAGIESAQMLIVTSGNKAKATHIVEMARKMNPSLRILSRAYDLFHVFELYEKG
FT                   ADRQVRETFDSALRTARYALEDLGDIDSERIEEITHIYYEENRRRVRLMAEVHDPNYTK
FT                   KFQNKEMIKVALEHDQKTMAKIQQILQRED"
FT   gene            complement(8381..9139)
FT                   /locus_tag="Asuc_0007"
FT   CDS_pept        complement(8381..9139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0007"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: hin:HI0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73389"
FT                   /db_xref="GOA:A6VK92"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK92"
FT                   /protein_id="ABR73389.1"
FT                   /translation="MKKDEVGHNFLARLGKTRLRPGGRRATEWLIEQGNFSTDKTVLEV
FT                   ACNMGTTAIGLAKRYGCYIEGVDLDEKALAKAERNIAERGLQHLIHVQRANAMKLPFAD
FT                   KTFDIVINEAMLTMLPLAAKQKAVTEYFRVLKPGGILLTHDVMLTTEDSETVLKQLRQA
FT                   INITVTPLTQEGWQSLFSNIGFARVETVSGNMTLLSPSGMIYDEGIIGTLKIMKNALKA
FT                   ENRTTFKNMFKVFNDPERKLNFIAVCSRKA"
FT   gene            complement(9268..9936)
FT                   /locus_tag="Asuc_0008"
FT   CDS_pept        complement(9268..9936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0008"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: msu:MS1934 Crp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73390"
FT                   /db_xref="GOA:A6VK93"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK93"
FT                   /protein_id="ABR73390.1"
FT                   /translation="MLKKEQDLAAEPADQQAVSLDPTIDWFISHCHIHKYPTKTTLIHA
FT                   GEKADTLYYLVKGSAIVMAKDDDGKEMILSYLSEGEFFGEVGLFEENQVRTAWVKARTS
FT                   CEVAEVSYKKFRQLLQVNPEILMNLAGQLSHRLQNTSRQVTNLAFLDVTGRIAQTLMNL
FT                   AKLPDAMTHPDGMQIKITRQEIGQMVGCSRETVGRVLKLLEDDNLIAAHGKTIVVFGTR
FT                   "
FT   gene            complement(9964..10185)
FT                   /locus_tag="Asuc_0009"
FT   CDS_pept        complement(9964..10185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0009"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   msu:MS1935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73391"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK94"
FT                   /protein_id="ABR73391.1"
FT                   /translation="MIIPWQSLDDDTLKNVAESFILREGTDYGFEELSLQQKVDNLLGL
FT                   IRSGSAVIVWSELHETIDIKDKDSFLTR"
FT   gene            complement(10207..10857)
FT                   /locus_tag="Asuc_0010"
FT   CDS_pept        complement(10207..10857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0010"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: msu:MS1936
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73392"
FT                   /db_xref="GOA:A6VK95"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK95"
FT                   /protein_id="ABR73392.1"
FT                   /translation="MVEQLEIADLEPAPETHTTKIEKRSVKERRQQVLAVLVNMLHSER
FT                   GMERMTTARLAEAVGVSEAALYRYFPNKTKMFEALLDHIEKNLFTRIDQAKALQTNTVS
FT                   RVHDILLMVLDFARKNPGLTRVLTGHALMFEEARLQLRVAQFFDRLELQFVNVLQMSKI
FT                   REGKSFSVDERMMAAHLVTFCEGQMMRLVRTNFRRTANQGFEQQWKLLAPIFA"
FT   gene            complement(10860..11315)
FT                   /locus_tag="Asuc_0011"
FT   CDS_pept        complement(10860..11315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0011"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: hit:NTHI1127 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73393"
FT                   /db_xref="GOA:A6VK96"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VK96"
FT                   /protein_id="ABR73393.1"
FT                   /translation="MKKIDVKILDSRIGAQFPLPAYATTGSAGLDLRALTDEAFEIQPG
FT                   ETKLIPTGLSVYIADPQLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGPLMVSMWNRS
FT                   DKPFKVEVGDRIAQLVFVPVVQAEFNIVAEFEQTDRGEGGFGHSGKK"
FT   gene            complement(11366..12565)
FT                   /locus_tag="Asuc_0012"
FT   CDS_pept        complement(11366..12565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0012"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein; KEGG: msu:MS1938
FT                   phosphopantothenoylcysteine synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73394"
FT                   /db_xref="GOA:A6VK97"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A6VK97"
FT                   /protein_id="ABR73394.1"
FT                   /translation="MLKAKRIVVGITGGIAAYKSIELIRLLRKSGAEVRVVLTPAAAEF
FT                   VTPLTLQAISGNPVSQSLLDPAAELAMGHIELAKWADAVLIVPASADFIARLTVGMAND
FT                   LLSTVCLATASPILLAPAMNRQMYAQAVTQENIAKLVARGMQFIGPASGFQACGDVGAG
FT                   RMCEPSEIFTALSERLAQKRDLVGLSVAITAGPTREPIDPVRYISNHSSGKMGFAIAAA
FT                   FAERGADVTLIAGPVNLTTPAGVTRINVTSAREMRQIALESAVKNRLFIGCAAVADYRV
FT                   AEVSAQKIKKNSDNDELSLKLIKNPDIIAEVAHLTERRPFVVGFAAETQNVAQYAQDKL
FT                   VRKNLDMICANDVADGNVFGADQNTLHLFWKDGDKLLPTTSKRELAKILAEEIVARYRA
FT                   "
FT   gene            12731..13393
FT                   /locus_tag="Asuc_0013"
FT   CDS_pept        12731..13393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0013"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: hso:HS_0144 DNA
FT                   repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73395"
FT                   /db_xref="GOA:A6VK98"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VK98"
FT                   /protein_id="ABR73395.1"
FT                   /translation="MENQSLMPREKLLKSGAETLENYELLAIFLRTGIKNCPVIQLSQA
FT                   VLRYFGSLRGLISADQEQFCQFKGIGITQYIQLQACTEMTKRYLAEELTFAHEFTNPLT
FT                   VRLYLQTELEHYEREVFSVLFLDNQHRLIKKEDMFRGTINAASVYPREIIKTALYCNAA
FT                   ALILAHNHPSGSAEPSASDKQMTKRIQAAAELMEIRVLDHFVIGKGCYFSFAEQDWL"
FT   gene            13616..13852
FT                   /locus_tag="Asuc_0014"
FT   CDS_pept        13616..13852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0014"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: msu:MS1942
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73396"
FT                   /db_xref="GOA:A6VK99"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VK99"
FT                   /protein_id="ABR73396.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHALNATRRRFLPNLHTHRFWVESENR
FT                   FVTLRLTAKGMRIIDKKGIDAVLADIRARGEKI"
FT   gene            13864..14034
FT                   /locus_tag="Asuc_0015"
FT   CDS_pept        13864..14034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0015"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: msu:MS1943
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73397"
FT                   /db_xref="GOA:A6VKA0"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKA0"
FT                   /protein_id="ABR73397.1"
FT                   /translation="MAAKGAREKIRLVSSAETGHFYTTDKNKRNMPEKMEIKKFDPVVR
FT                   KHVIYREAKIK"
FT   gene            14157..14969
FT                   /locus_tag="Asuc_0016"
FT   CDS_pept        14157..14969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0016"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase; zinc finger Fpg domain
FT                   protein; KEGG: msu:MS1944 formamidopyrimidine-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73398"
FT                   /db_xref="GOA:A6VKA1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKA1"
FT                   /protein_id="ABR73398.1"
FT                   /translation="MPELPEVETAKNGITPYLDGFYIEKIIVRQPKLRWEVSPELSQIS
FT                   HQKVTALSRRAKYLIIHTAQGYIIGHLGMSGAVRIVSPDSPVNKHDHLDIVMNNGKIMR
FT                   YNDPRRFGAWFWTENLDEFPLFAKLGPEPLSGEFNSDYLFKKSRKKPTAVKSFIMNNAV
FT                   VVGIGNIYANEVLFQCGLHPEKPAGKITKTQAALLTETIKKELTRAIAQGGTTLKDFLQ
FT                   PDGKPGYFVQELQIYGKKGCPCPKCGQKIESFTVGQRNSYVCLHCQKK"
FT   gene            15105..16001
FT                   /locus_tag="Asuc_0017"
FT   CDS_pept        15105..16001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0017"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: msu:MS0265
FT                   dihydrodipicolinate synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73399"
FT                   /db_xref="GOA:A6VKA2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKA2"
FT                   /protein_id="ABR73399.1"
FT                   /translation="MSSRTPLFSGSIVALITPMDNHGEVDYDELKKLVEFHINAGTNAI
FT                   VSVGTTGESATLSIDENVKTILKTVEFAAGRIPVIAGTGANATSEAITMTKLLRDSGVA
FT                   GCLSVVPYYNKPTQEGMYQHFKAIAECTDLPQILYNVPGRTGSDMKPETVARLAKIPNI
FT                   VAIKEATGDVSRVKQIKELAGEDFIFLSGDDATGLESIKLGGQGVISVTNNLAAADMAK
FT                   MCEFALSGNFEEAEKINQRLMPLHRDLFIEGNPIPVKWAAYKIGLIKDPFLRLPLTVLS
FT                   EQAQPKVLEALKIAGLI"
FT   gene            16119..17120
FT                   /locus_tag="Asuc_0018"
FT   CDS_pept        16119..17120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0018"
FT                   /product="NlpBDapX family lipoprotein"
FT                   /note="PFAM: NlpBDapX family lipoprotein; KEGG: msu:MS0267
FT                   uncharacterized lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73400"
FT                   /db_xref="GOA:A6VKA3"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="InterPro:IPR014524"
FT                   /db_xref="InterPro:IPR042268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKA3"
FT                   /protein_id="ABR73400.1"
FT                   /translation="MKKCLFPLSVLAVIVATGCGNTSPYANDSYEKHANAPTFTTIDTA
FT                   GIRIIGQNDTYLLPATNVKKGENMDIRPPAIPMAIIGNSVAQFDGERASIIYPSEKAEV
FT                   YNIRQMARLLEERSIKFTTKDNQIETDWTNFGAKTDQGETLLRYQINQVGNQEANALVV
FT                   SVLEAKRDDILFTPSQKEKERYTSSLLNQFIGELNADYRSQAQAVATPTTTGPVQTAII
FT                   TDGNNHLALAMSSEFQQSWSKLGDALPQLGFETEEETVGRGYRKLNYKPLGATEWARLG
FT                   VNRPELEDGEYSMQISAHGKQSSVVISDEDGNAISGDAAQAMYRALANLISK"
FT   sig_peptide     16119..16199
FT                   /locus_tag="Asuc_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.949 at
FT                   residue 27"
FT   gene            17174..17884
FT                   /locus_tag="Asuc_0019"
FT   CDS_pept        17174..17884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0019"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: msu:MS0203 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73401"
FT                   /db_xref="GOA:A6VKA4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKA4"
FT                   /protein_id="ABR73401.1"
FT                   /translation="MKAGNGFTFKRFHINHDRCAMKVGTDGILLGAWADLANSRSILDL
FT                   GTGSGLIALMLAQRSDEDVQIHGVERDPAAARQAQENFRASPWAHRLYLHFGDIADFAQ
FT                   KCGQKFDNIVANPPYFAQGVDCRNHARNAARYTAALSHAQWLEIASSLLTEQGTIHFVL
FT                   PAEQGKTLKQSTALYCVRQCDVISKQGKAAQRVLLSFMKEKKETAYSELTIYDEKNRYT
FT                   LEFIQLTREFYLKF"
FT   gene            18048..19436
FT                   /locus_tag="Asuc_0020"
FT   CDS_pept        18048..19436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0020"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: pmu:PM1167
FT                   hypothetical HI0608"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73402"
FT                   /db_xref="GOA:A6VKA5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKA5"
FT                   /protein_id="ABR73402.1"
FT                   /translation="MSSTSKNPIRGLSILIVDLILFFTLLNILPFNPQENRGLALLVFI
FT                   GILWLTEAFHITITALLVPVFAIGLGVLNTKAAFAPFSEPIIFMFFGGFVIAAVLNIQK
FT                   IDLWIANHVIRLARGSLKLTVFYLFAVTNLLSFFINNTAVAALMLPLTLGILHKVDMKT
FT                   NRNLYVFVLLGIAFSASIGGIATLVGSAPNAIMASQIKISFSEWLAYGVPVTFLLLIAM
FT                   MITLLLVLRPNFNVPFDVEIEEIPMTGKRIITLIVFALTAAFLIFSSVLEPIVRETLGL
FT                   TSAIRSFDALIAMIAVMAFALSGTATWSQIQERTEWGVLLLCGGGMVLSIVLKDTGASK
FT                   ILAETIVSYIGDKNWWLMAIVMAAFILFLTEFTSNTASAALLMPIYISVASSLGLPPIS
FT                   LAAIIACGASCAFMLPIATPPNAIVFATGYIKQKDMLRVGIILNTISILVVGSLSYFFW
FT                   MTWW"
FT   gene            complement(19519..22389)
FT                   /locus_tag="Asuc_0021"
FT   CDS_pept        complement(19519..22389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0021"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: msu:MS0225 DNA polymerase I - 3'-5'
FT                   exonuclease and polymerase domains; TIGRFAM: DNA polymerase
FT                   I; PFAM: DNA-directed DNA polymerase; 5'-3' exonuclease;
FT                   3'-5' exonuclease; SMART: Helix-hairpin-helix domain
FT                   protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73403"
FT                   /db_xref="GOA:A6VKA6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKA6"
FT                   /protein_id="ABR73403.1"
FT                   /translation="MVQIAPNPLVLVDGSSYLYRAFHAFPPLTNSQGEPTGAMFGVLNM
FT                   LKSLISQVRPSHIAVVFDAKGKTFRDKLFEQYKSHRPPMPDDLRRQIQPLHDIIRSLGI
FT                   PLLSVEGVEADDVIGTLAVQASSQGKKVLISTGDKDMAQLVDENIMLINTMSNTLLDRQ
FT                   GVIEKYGIPPELIIDYLALMGDSSDNIPGVAGVGEKTALGLLQGIGSMSEVYANLDKVA
FT                   DLPIRGAKKLGEKLLAAKADADLSYVLATIKTDVKLDVIPEKLIIGTPNNDELAAQFGR
FT                   YEFKRWLSEVLSGNNSMVNPPEQVVRVNRYQAAAAVPKTESAVKNSVKIDRTLYETVTT
FT                   PAQLQSWIEKIQQANLIAVDTETDSLDAMTAELVGISFGLENGEACYIPLAHVHEVAEA
FT                   EEQAQADLFAEPKATGKTSWHRLPDQLNREDCLARLKPVLENADIRKIGQNLKYDLTIF
FT                   ANHGIQVQGVAFDTMLESYVLNSTGRHNMDDLAERYLGHQTISFETLAGKGKNQLTFDK
FT                   IPLAQAAEYAAEDADVTMKLHQTLWAELEKTPTLTTLFKDIELPLVSVLSRIERNGVLI
FT                   DAQALRKQSQEFGERLTALEAKAHEIAGEAFNLASPKQLQEILFNKLHLPVLQKTPKGD
FT                   PSTKEEVLEELAFDHELPKLLVEHRGLAKLKSTYTDKLPQMINPHTGRVHTSYHQAVTA
FT                   TGRLSSTDPNLQNIPIRNEEGRRIRQAFVARDGYRIIAADYSQIELRIMAHLSGDKGLT
FT                   TAFVEGRDIHRSTASEIFGIPLEDVSAEQRRSAKAINFGLIYGMSAFGLSRQLAISRME
FT                   AKKYMDLYFQRYPNVQTFMHDIQEKAKAQGFVETLFGRRLYLPDIKSGNASRRKGAERV
FT                   AINAPMQGTAADIIKRAMIDIDHVIAGDEDILMIMQVHDELVFEVRSEKVEFYSELIKQ
FT                   KMETAAQLDVPLIVEAGVGANWDEAH"
FT   gene            complement(22496..24280)
FT                   /locus_tag="Asuc_0022"
FT   CDS_pept        complement(22496..24280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0022"
FT                   /product="ABC transporter domain protein"
FT                   /note="PFAM: ABC transporter related; SbmABacA family
FT                   protein; ABC transporter domain protein; SMART: AAA ATPase;
FT                   KEGG: msu:MS0290 ABC-type long-chain fatty acid transport
FT                   system, fused permease and ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73404"
FT                   /db_xref="GOA:A6VKA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKA7"
FT                   /protein_id="ABR73404.1"
FT                   /translation="MNYSEELLTSIFWIFKAIGITAVVFTLVVWILVKTTRWAHQFWLL
FT                   GKDYLSPKRSVKPLIYFIVIVFFNLLSVRLDILFSNWYKAMYDALQKMDENVFWLQMVV
FT                   FSVLAVIHITNILLTYYLTQRFTIQWRMWLNENMVEKWMAKQAYYKSQYVYNQLDNPDQ
FT                   RIQQDVQSYVRSSISFATGVISSVVSIVAFTQILWNLAGPMNIAGVTVPHAMVFLVFIY
FT                   VLVTSIFAFRIGRPLIHLNFLNERLNANYRYSLIRVKEYAESIAFFRGEKMEKNVLYKQ
FT                   FDHVIDNVWKMVYMTLKLSGFNVMMTQISVIFPFIIQAARYFSKQIQLGDLIQTAQSFG
FT                   RVQSALSYFRNVYDDFTGYRAVLDRLTGFHSAVGQATQVSQVVLKDSESAVVFEQLFVK
FT                   KPTGEVLIKDLNLNLPQGSSVLIKGASGSGKTTLLRTIAGLWSFSEGTVYCPQHNALFL
FT                   SQKPYLPQGRLIDALYYPEVAPADVDLDGAADTLRQVQLGHLADKLGQENDWMRMLSLG
FT                   EQQRLSFARLLIHKPMVAFLDEATASMDEGLEDAMYRLLRERLPDTTIISVGHRSTLQP
FT                   HHDKQLIIDPQDQSWQFC"
FT   gene            24449..26107
FT                   /locus_tag="Asuc_0023"
FT   CDS_pept        24449..26107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0023"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: TrkA-C domain
FT                   protein; YidE/YbjL duplication domain protein; KEGG:
FT                   pmu:PM1071 hypothetical HI0035"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73405"
FT                   /db_xref="GOA:A6VKA8"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKA8"
FT                   /protein_id="ABR73405.1"
FT                   /translation="MSDIAVTISVLSLVAVLGLWIGHWKIRGVGLGIGGVLFGGIIISH
FT                   FANQYGLKLDEHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRESGLKLNVLGGLIVVLG
FT                   ALLVVIIHQVTEIPLDAILGIYSGAVTNTPSLGAGQQILNELGMQDITETMGMSYAMAY
FT                   PFGICGILLTMWLIRLFFKINIDKEAENFDRETGKDKETIRKANIRITNANFAGLNLRD
FT                   IPGFEKNGIVCTRLKREQDIFIPQADTQLQVGDILHFLGDPKILHEMELILGESIQVEA
FT                   SAMKGNLRTERVVVTNEKILSKKIRTLAFHQQYGVMISRLNRSGVELIPTANTTLQFGD
FT                   VLHIIGSADVMDKVIEMFGNAQSKLNQVQMLPVFIGIGLGVLLGSIPFSIPGIPVPLKL
FT                   GLAGGPLVVALILARVGTIGKLYWFMPPSANLALREIGIVLFLSVVGFKSGGNFVHTLI
FT                   NGNGLEWMFYGIFITFVPLLITGIIARIYAKLNYLSICGLVAGSMTDPPALAFANSLKE
FT                   NCGASALAYATVYPLVMFLRIISPQLLAILLWRAV"
FT   gene            26199..27521
FT                   /locus_tag="Asuc_0024"
FT   CDS_pept        26199..27521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0024"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   hin:HI0422 ATP-dependent RNA helicase srmB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73406"
FT                   /db_xref="GOA:A6VKA9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKA9"
FT                   /protein_id="ABR73406.1"
FT                   /translation="MSQPTFDDFDLAPELLKALAKKGYDRPTAIQQESIPVAMEEQDLL
FT                   GSAPTGTGKTAAFLLPALQHLLDYPRKKPGAPRILVLTPTRELAMQVAEQAGELAQFTK
FT                   LSIATITGGVAYQNHGEVFNKNQDLVVATPGRLLQYIKEENFDCRSVEILIFDEADRML
FT                   QMGFGQDAEKIAAETRWRKQTLLFSATLEGELLQDFADRILDNPAKIAVEPSRRERKKI
FT                   NQWYYHADSVEHKIKLVARFIAQENVTKGILFVRRREDVRELSETLRKRGIRSTYLEGE
FT                   MAQTQRNNSIDKLKNGIVTVLVATDVAARGIDIDDISHVMNFDLPYSADTYLHRIGRTA
FT                   RAGKKGTAVSFVENHDYRLLGKIKRYTGELLKPRIIEGLEPRTSPPKDGETKTVSKKAK
FT                   VRKKEKLVEKRKAEQKKKVKLRHKDSKNIGKRRKPANSENN"
FT   gene            complement(27582..27830)
FT                   /locus_tag="Asuc_0025"
FT   CDS_pept        complement(27582..27830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0025"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   pha:PSHAa2249 DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73407"
FT                   /db_xref="GOA:A6VKB0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB0"
FT                   /protein_id="ABR73407.1"
FT                   /translation="MGNIRLSVHSFEHCWLRDFLLKRRKELGLSQRALGMKMGVVHSFI
FT                   GKVETGDRRLDIFEFITYCEALELDPIEVIKEIQKLK"
FT   gene            27913..28218
FT                   /locus_tag="Asuc_0026"
FT   CDS_pept        27913..28218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0026"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: pfo:Pfl_3252 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73408"
FT                   /db_xref="InterPro:IPR025731"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB1"
FT                   /protein_id="ABR73408.1"
FT                   /translation="MKKLLMLICMVCSLTACVSEQKRYVATGGSRADGVINLSYQVRYN
FT                   ERAAPNPNQGLRLAQKRCRQWGYQNAERFSGYTRRCNIAKGRKCLSYLITVQYQCF"
FT   sig_peptide     27913..27969
FT                   /locus_tag="Asuc_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.871 at
FT                   residue 19"
FT   gene            complement(28289..29656)
FT                   /locus_tag="Asuc_0027"
FT   CDS_pept        complement(28289..29656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0027"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; Adenylosuccinate lyase domain protein; KEGG:
FT                   msu:MS0297 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73409"
FT                   /db_xref="GOA:A6VKB2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB2"
FT                   /protein_id="ABR73409.1"
FT                   /translation="MQLNALTALSPIDGRYQDKVASLRNIFSEFGLLKFRVTVEVRWLQ
FT                   KLAASAEIQEIKALSKEANDYLDSIVTNFNLTDAERIKEIERITNHDVKAVEYFLKEKS
FT                   TALPELSTVSEFIHFACTSEDINNLSHALMLKTAREEVILPEWKNLIDEITRLANEYKT
FT                   IPLLSRTHGQPASPSTVGKEMANVVYRLRRQFKQLENIEVLGKINGAVGNYNAHLSAYP
FT                   EINWHRFSEEFVTSLGITWNPYTTQIEPHDYIAEFFDCVVRFNTIIIDFDRDLWGYIAL
FT                   NHFKQRTIAGEIGSSTMPHKVNPIDFENSEGNLGLANAVMTHLGQKLPVSRWQRDLTDS
FT                   TVLRNLGVGVGYCLIAYAATRKGISKLEVNEQHLRDELNQNWEVLAEPIQTVMRRYGIE
FT                   KPYEKLKELTRGKRVDEKAMREFIEKLAIPAEEKARLQQLTPATYIGAAIRLVENL"
FT   gene            complement(29670..30284)
FT                   /locus_tag="Asuc_0028"
FT   CDS_pept        complement(29670..30284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0028"
FT                   /product="protein of unknown function DUF489"
FT                   /note="PFAM: protein of unknown function DUF489; KEGG:
FT                   pmu:PM1850 hypothetical HI0638"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73410"
FT                   /db_xref="GOA:A6VKB3"
FT                   /db_xref="InterPro:IPR007451"
FT                   /db_xref="InterPro:IPR035932"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKB3"
FT                   /protein_id="ABR73410.1"
FT                   /translation="MASDYFDIAIALAGVCQAAKLVQQFAHNGEADLNALETSLYSLLQ
FT                   TEPENIAAVYRGSLANIKLGLETLIEQLNAMDTELARYWLGILALSGKLTKSADAKNAL
FT                   ASRMQYLPAQLEHYGLCSDMTFEKMATIYTDIISPLGKKIHVIGSSLYLQQPSMHNRIR
FT                   ACLLAGIRSAILWQQVGGTKWQILFSRRKILKAAKHIYETI"
FT   gene            complement(31129..32112)
FT                   /pseudo
FT                   /locus_tag="Asuc_0029"
FT   gene            32145..33491
FT                   /locus_tag="Asuc_0030"
FT   CDS_pept        32145..33491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0030"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bml:BMA10299_A1532 site-specific recombinase, phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73411"
FT                   /db_xref="GOA:A6VKB4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB4"
FT                   /protein_id="ABR73411.1"
FT                   /translation="MIYQPFDHITPQKNNTYDLPPEQEESDRTLTIKEVASLLNLSYST
FT                   VFAHRLKWGFFQMEGSRVWRVFRRDLDQRRKKKNNVIRLIGLTERKNGGKNKCQSANEE
FT                   KYIGSILQRQTDDALDKCTKTEVRKKAQELHDKIKAELWDLAKLNKTPPRMFEEALLLY
FT                   VEDAKNKKDFDTSRRHAIYWRAVFSGWELKNISGEDINANLPTHSTTHKKALSPSTKNR
FT                   YRTSILRVMSLAYKNGWVDRVPYVPKYVEPKVRVRWITKAQAAALIANLNLAWMKNVCS
FT                   FALLTGARMTEILSLTWDKVDFDRSIAIVSNDVAKSGKARALPLNKIALDLLKNLKQNR
FT                   RNEYVFHRDTDKRIGRIDWHDFHQALNKSGIDNFRFHDLRHTWASWHVQAGTPLYTLKE
FT                   MGGWETLEMVKKYAHLNATHMLEYAENVTFTPQSNDDFSQDNFYNVVNY"
FT   gene            complement(33508..33583)
FT                   /locus_tag="Asuc_R0001"
FT                   /note="tRNA-Trp1"
FT   tRNA            complement(33508..33583)
FT                   /locus_tag="Asuc_R0001"
FT                   /product="tRNA-Trp"
FT   gene            complement(33602..33678)
FT                   /locus_tag="Asuc_R0002"
FT                   /note="tRNA-Asp3"
FT   tRNA            complement(33602..33678)
FT                   /locus_tag="Asuc_R0002"
FT                   /product="tRNA-Asp"
FT   gene            complement(33689..33803)
FT                   /locus_tag="Asuc_R0003"
FT   rRNA            complement(33689..33803)
FT                   /locus_tag="Asuc_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(33855..33969)
FT                   /locus_tag="Asuc_R0004"
FT   rRNA            complement(33855..33969)
FT                   /locus_tag="Asuc_R0004"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(34076..37071)
FT                   /locus_tag="Asuc_R0005"
FT   rRNA            complement(34076..37071)
FT                   /locus_tag="Asuc_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(37365..37440)
FT                   /locus_tag="Asuc_R0006"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(37365..37440)
FT                   /locus_tag="Asuc_R0006"
FT                   /product="tRNA-Ala"
FT   gene            complement(37511..37587)
FT                   /locus_tag="Asuc_R0007"
FT                   /note="tRNA-Ile3"
FT   tRNA            complement(37511..37587)
FT                   /locus_tag="Asuc_R0007"
FT                   /product="tRNA-Ile"
FT   gene            complement(37671..39205)
FT                   /locus_tag="Asuc_R0008"
FT   rRNA            complement(37671..39205)
FT                   /locus_tag="Asuc_R0008"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(39519..40073)
FT                   /locus_tag="Asuc_0031"
FT   CDS_pept        complement(39519..40073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0031"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="TIGRFAM: D,D-heptose 1,7-bisphosphate phosphatase;
FT                   histidinol-phosphate phosphatase family protein; hydrolase,
FT                   HAD-superfamily, subfamily IIIA; PFAM: Polynucleotide
FT                   kinase 3 phosphatase central region; KEGG: msu:MS0435
FT                   histidinol phosphatase and related phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73412"
FT                   /db_xref="GOA:A6VKB5"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB5"
FT                   /protein_id="ABR73412.1"
FT                   /translation="MKKAIFLDRDGTLNIDHGYVHQIDDFHFIDGSIEALQKLKSMGYL
FT                   LVLVTNQSGIARGYFSEAQFLRLTEWMDWSLADRGVDLDGIYYCPHHPQGKGEYKRICD
FT                   CRKPKSGMLNQAIKELNIDPAQSFMVGDKIEDLLAAQGAKVRSKILVKTGKPITPEGEG
FT                   LADYVINSIADLPNLIKQMKK"
FT   gene            40240..41277
FT                   /locus_tag="Asuc_0032"
FT   CDS_pept        40240..41277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0032"
FT                   /product="D-methionine ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: D-methionine ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_1533 D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73413"
FT                   /db_xref="GOA:A6VKB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB6"
FT                   /protein_id="ABR73413.1"
FT                   /translation="MIKLENITKIFDVSGKKFTALDNVSLHIPQGQICGVIGASGAGKS
FT                   TLIRCVNLLEYPTSGSVIIDGNDLTQLSDNQLIHERRKIGMIFQHFNLLSSRTVFDNIA
FT                   LPLELENTPKNVIQKRVSALLELVGLGEKSDVYPANLSGGQKQRVAIARALANDPKVLL
FT                   CDEATSALDPATTQSILKLLKEINRTLGITILLITHEMEVVKRICDSVAVIDHGQLVEQ
FT                   GSVSDIFSNPKTELAQEFISSTFHYHLPEEYLEKMSDTPRSAKSTPIIKFEFTGRSVDA
FT                   PLLSQASRRFDVSLNILISQIDYAGGIKFGFTIAELEGDEDAITQTKIYLMESNVRVEV
FT                   LGYVG"
FT   gene            41267..41956
FT                   /locus_tag="Asuc_0033"
FT   CDS_pept        41267..41956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0033"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: msu:MS0433 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73414"
FT                   /db_xref="GOA:A6VKB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB7"
FT                   /protein_id="ABR73414.1"
FT                   /translation="MWASFINDFNTQMTPEIWDLILVSTWETLYMTFAATFFAILFGLP
FT                   LGIWAFLTKKGYALNNTKINRTLEVIINIGRSVPFIILLLILLPVTKFLVGTTIGTTAA
FT                   IIPLSVAALPFVARLTVNALGDVPSGLTETARAMGTSTWQLVTKFYLPEALPMLIKAFT
FT                   LTFVTLIGYSAMAGAVGGGGLGNTAITFGLYRNMPYVLWVATIIIVFIVIIGEKYGNKL
FT                   ADRFDHR"
FT   gene            41979..42770
FT                   /locus_tag="Asuc_0034"
FT   CDS_pept        41979..42770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0034"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="TIGRFAM: lipoprotein, YaeC family; PFAM: NLPA
FT                   lipoprotein; KEGG: msu:MS0432 lipoprotein, attached to the
FT                   cytoplasmic membrane"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73415"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB8"
FT                   /protein_id="ABR73415.1"
FT                   /translation="MNFKKLLSVLALTSIFALTACKDDSKLKVGVMAGPEHQMAEIAAK
FT                   VAKDKYQLDVELVSFTDYSQPNAALFRKDLDVNAIQHKPYLDEDMAKGGYKDLVIVGNT
FT                   FVYPIAGYSKKIKALSELQDGATVAIPNDPTNQGRSLALLEKQGLIKLKDSSNILSTPL
FT                   DVVENPKNLKFNAVEGALLPRVLDDVDLAVINNNFAGQIGLSPKDGIFVEDKDSPYVNI
FT                   IVAREDNKNAQPVKDFVKAYQSEEVYQEAVKHFKDGVVKGW"
FT   sig_peptide     41979..42047
FT                   /locus_tag="Asuc_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.731 at
FT                   residue 23"
FT   gene            complement(42875..43609)
FT                   /locus_tag="Asuc_0035"
FT   CDS_pept        complement(42875..43609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0035"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   msu:MS1822 uncharacterized ACR"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73416"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKB9"
FT                   /protein_id="ABR73416.1"
FT                   /translation="MTALSPCWQVPQNVHALTTLRNGGVSQAPYTSFNLGDHVGDNPSA
FT                   VKKNRDLLVKQFGLPQFPLFLTQTHSTDVICLPYQGKDLKADAVYTDKPAQVCLVMTAD
FT                   CLPVLFTSQKGNEVAAAHAGWRGLCDGILEETVKRFQCPRDEIIAWFGPAIGATAFQVG
FT                   REVADQFIAQDVQAEQAFVSDPTDKGKYLGNLYQIAEQRLHRMGIKQVSGGEHCTYTEE
FT                   NKFFSFRRDGKTGRMASLIWFD"
FT   gene            complement(43624..44598)
FT                   /locus_tag="Asuc_0036"
FT   CDS_pept        complement(43624..44598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0036"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: msu:MS1821 pseudouridylate synthases, 23S
FT                   RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73417"
FT                   /db_xref="GOA:A6VKC0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKC0"
FT                   /protein_id="ABR73417.1"
FT                   /translation="MAQLTLTAEVQSHQMGQRLDQTLAELFPDYSRSRLKTWIEGNLVR
FT                   VNGNIQNIPRTKVLGGEQIEIRAEVEEETHYEPENLPLDIVYEDDHILVLNKPKNFVVH
FT                   PGAGNPRGTVLNALLYHYPQIAEVPRAGIVHRLDKDTTGLMVVAKTIPAQTQLVRDLQK
FT                   RKITREYEAVAFGVMTKGGKVDEPMARHPTKRTAMAVHPMGKPAVTHYRIMEHFRNYTR
FT                   LRLRLETGRTHQIRVHMAHIAHPLLGDQTYGGRPRPPRNASEHFSEVLRNFQRQALHAI
FT                   MLRLEHPISGGLMEWFAPLPDDFAELIAALKEDYQLHKDELDY"
FT   gene            44694..45506
FT                   /locus_tag="Asuc_0037"
FT   CDS_pept        44694..45506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0037"
FT                   /product="TPR-repeat-containing protein"
FT                   /note="KEGG: msu:MS1820 TPR-repeat-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73418"
FT                   /db_xref="GOA:A6VKC1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKC1"
FT                   /protein_id="ABR73418.1"
FT                   /translation="MRKLKSLSLAALAAFALTACSSNNEVEQASEQELFTKGQAYVQEG
FT                   NYSDATKYLQAVDSRFPGSDYSEQAELNLIYAAYRNQDYTTALVTADRFLQLHPQSQHT
FT                   DYVLYMAALTNMSMGDNFIQDFFGIDRASRESTSMKTAFGNFQTLVQHFPNSPYTPDAI
FT                   TRMAYIKDRLARHELEIAKFYAKRNAWVAVSNRVTGMLQTYPDTNATLQALPLLEKAYH
FT                   EMGLTQLEQKAATLVKANEGKVIKETDKPEEPFLSLPSWLKFGSDDKK"
FT   sig_peptide     44694..44759
FT                   /locus_tag="Asuc_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.480 at
FT                   residue 22"
FT   gene            complement(45631..46893)
FT                   /locus_tag="Asuc_0038"
FT   CDS_pept        complement(45631..46893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0038"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein; KEGG:
FT                   msu:MS1837 transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73419"
FT                   /db_xref="GOA:A6VKC2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKC2"
FT                   /protein_id="ABR73419.1"
FT                   /translation="MHLTELKNTPVSTLVQLGEEQMGLENLARLRKQDIVFAILKQHAK
FT                   SGEDIFGGGVLEILPDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKVEGKIRP
FT                   PKEGERYFALLKVDQVNDDRPEVSRSKILFENLTPLHANSRLRMERGNGSKEDLTARIL
FT                   DLASPIGKGQRGLIVAPPKAGKTVLLQNIAQSITANYPECELIVLLIDERPEEVTEMQR
FT                   TVRGEVIASTFDEPAARHVQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPA
FT                   SGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTG
FT                   NMELHLSRKIAEKRVFPAIDFNRSGTRKEDLLTTPDELQKMWILRKILNPMGEVEAMEF
FT                   LIDKLMVAKTNEAFFEVMKRS"
FT   gene            47081..48322
FT                   /locus_tag="Asuc_0039"
FT   CDS_pept        47081..48322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0039"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   msu:MS1836 superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73420"
FT                   /db_xref="GOA:A6VKC3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKC3"
FT                   /protein_id="ABR73420.1"
FT                   /translation="MTTEHLSQQRFADLPLHPQILAALNDQNFEYCTPIQALSLPLTLQ
FT                   GKDVAGQAQTGTGKTMAFLTATFHHLLTHQPDFITNQPRALILAPTRELAVQIAHDAES
FT                   LAQTTKLRIALAYGGDGYDKQLKTIENGVDILIGTTGRVIDYVKQGIIRFNDIQVVVLD
FT                   EADRMFDLGFIKDIRYLLRKCPAPKSRLTMLFSATLSYKVRELAFEDMNDPEYIEIEPL
FT                   QKTGHRIKEELFYPSNRDKMALLMTLLEEEWPERCIIFANTKHRCEEIWGYLAADGQRV
FT                   GLLTGDVAQKKRLALLKQFTDGELDILVATDVAARGLHIPDVTHVFNYDLPDDREDYVH
FT                   RIGRTGRAGESGMSISFACEQYAMNLPAIEEYIGHHIPVSQYDPDSLINDLPKPYRIKR
FT                   NHTIPHSSRDYKKR"
FT   gene            complement(48471..52730)
FT                   /locus_tag="Asuc_0040"
FT   CDS_pept        complement(48471..52730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0040"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein; KEGG: msu:MS0213
FT                   DNA-directed RNA polymerase beta' subunit/160 kD subunit
FT                   (split gene in archaea and Syn)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73421"
FT                   /db_xref="GOA:A6VKC4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKC4"
FT                   /protein_id="ABR73421.1"
FT                   /translation="MKDLVNFLKAQSKTAEDFDVIKIGLASPDMIRSWSFGEVKKPETI
FT                   NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMG
FT                   HIELASPVAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYIVIEPGMTDLEKGQLLTE
FT                   EQYLDAEERWADEFEAKMGAEAIQSILRDMDLEHECEVLREELQETNSETKRKKITKRL
FT                   KLLEAFIQSGNKPEWMVMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLK
FT                   RLLDLVAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNRRPLKSLADMIKGKQGRFR
FT                   QNLLGKRVDYSGRSVITVGPYLHLHQCGLPKKMALELFRPFIYAKLESRGYATTIKAAK
FT                   KMVEREDVIVWDILAEVIREHPILLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAF
FT                   NADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGIYYMTRD
FT                   KVNGKGEGMLLQDPREAEKAYRTGRAELHSRVKIRITEYVKNAEGEFEPQTNLVDTTVG
FT                   RAILWMIAPKGMPFNLFNQTLGKKAISKLINECYRRLGMKESVMFADQIMYTGFAYAAR
FT                   SGSSVGIDDMVIPEKKYEIIAAAEQEVAEIQEQFQSGLVTVGERYNKVIDIWAAANERV
FT                   AKVMMENLSTEEVINREGNPEKQSSFNSIFMMADSGARGSAAQIRQLAGMRGLMARPDG
FT                   SIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVIVE
FT                   DDCGTHEGIVMSPLIEGGDEKVPLRELVLGRVAAEDVLKPGTEEVLIPRNTLIDEQWCN
FT                   IIDENSVDSIKVRSVVTCDTDFGVCAKCYGRDLARGHLINQGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASAAAKESSVQVKNNGTIRLANVKFVTNNEGKLVLTSRNTELTVIDAF
FT                   GRTKEHYKLPYGTTLNKADGAEVTAGEIVANWDPHTMPVISEVAGFVKFVDIVDGLTVS
FT                   RQTDELTGLSSILVQDVGERATAGKDLRPAIKLVDAQGNDILIEGTDVAAQYFLPGKAI
FT                   VTLDDGAEINVGDPLARIPQESVGTKDITGGLPRVADLFEARKPKEPAILAEISGIVSF
FT                   GKETKGKRRLLITPTDGGETYEEMIPKWRQLNVFEGEMVQRGDLISDGAETPHDILRLR
FT                   GVHAVTEYIVNEVQEVYRLQGVKINDKHIEVIVRQMLRKAIITNAYDSEFLEGEQVEVA
FT                   RIKIVNRKREAEGKPLVEFERELLGITKASLATESFISAASFQETTRVLTEAAVAGKRD
FT                   ELRGLKENVIVGRLIPAGTGFAYHQNRAKNRHNALAAEQAVKFSAADEAEIDAEFNMIA
FT                   DDPTSSLAEMLNMADEE"
FT   gene            complement(52868..56896)
FT                   /locus_tag="Asuc_0041"
FT   CDS_pept        complement(52868..56896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0041"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: msu:MS0212
FT                   DNA-directed RNA polymerase beta subunit/140 kD subunit
FT                   (split gene in Mjan, Mthe, Aful)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73422"
FT                   /db_xref="GOA:A6VKC5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKC5"
FT                   /protein_id="ABR73422.1"
FT                   /translation="MGYSYTEKKRIRKDFGKRSQVLNVPYLLTIQLDSFDKFIQRDPDG
FT                   QQGLEAAFRSVFPIVSNNGSTELQYVSYKLGEPVFDVRECQIRGTTFAAPLRVKLRLVS
FT                   YDKDAAPGTVKDIKEQDVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFARIDRRRKLPATIILRALNYTTEEILD
FT                   LFFDKVVFEIQGDKLLMELVPERLRGETATFDIEAEGKVYVERGRRITARHIKALEKDG
FT                   VKKVEVPTEYIIGKVAAKDYVDLESGEVICAANTEISLELLAKLAQAGYTAIEALFTND
FT                   LDFGPYISETLRVDPSCDRLSALVEIYRMMRPGEPPTKEAAEGLFDNLFFSQERYDLSA
FT                   VGRMKFNRSLGIDSETGSGVLSKEDIVSVMKKLIDIRNGRGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRIGLVRVERAVKERLSLGDLDAVTPQDLINAKPISAAVREFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYARTNDYGFLETPYRKVVNGQVTEEIEYLSAIEEGKYIIAQANANLDDDFRFTDTFVT
FT                   ARGEHGESGLYRPEEIHYMDVSTQQVVSVAAALIPFLEHDDANRALMGANMQRQAVPTL
FT                   RADKPLVGTGMEKPIALDSGVAVVAKRGGTIQYVDASRIVVKVNEDETIPGEAGIDIYN
FT                   LIKYTRSNQNTCINQIPCVNLGEPVGRGEILADGPSTDLGELALGQNIRVAFMPWNGYN
FT                   FEDSMLVSERVVQQDRFTTIHIQELSCVARDTKLGAEEITADIPNVGEAALSKLDESGI
FT                   VYVGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGTSGTVI
FT                   DVQVFTRDGVEKDKRALEIEEMQLKQAKKDLVEELEILEAGLFSRVRNLLVDGGISEKE
FT                   LDTMERAKWLEQTLSSESKQSRLEQLAEQYEELRKDFEHKLEVKRSKIIQGDDLAPGVQ
FT                   KVVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPVEDMPYDENGRPVEIVLNPLGVPSR
FT                   MNIGQILETHLGLAAKGIGEQINIMLKQKQDIEKLRGYIQKAYDLGGGSQVVDLNTFTD
FT                   EEVLRLAENLRKGMPLATPVFDGADESEIKGLLELGGLPTSGQITLYDGRTGEKFERPV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVGGTHYMEPGTPESFNVIMKEIRSLGLNIDLDEA"
FT   gene            complement(57206..57574)
FT                   /locus_tag="Asuc_0042"
FT   CDS_pept        complement(57206..57574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0042"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: hit:NTHI0761 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73423"
FT                   /db_xref="GOA:A6VKC6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKC6"
FT                   /protein_id="ABR73423.1"
FT                   /translation="MSLTNEQLIEAIASKSVSEIVELIAAMEEKFGVSAAVAAAAPAAG
FT                   GAAAAEEKTEFNVVLTEAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKGE
FT                   AEELKKALEEAGAKVEIK"
FT   gene            complement(57632..58123)
FT                   /locus_tag="Asuc_0043"
FT   CDS_pept        complement(57632..58123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0043"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: msu:MS0209
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73424"
FT                   /db_xref="GOA:A6VKC7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKC7"
FT                   /protein_id="ABR73424.1"
FT                   /translation="MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAA
FT                   REAGVSMRVVRNTLLRRAVEGTEFECLTDTFTGPTLIAFSNEHPGAAARLFKDFAKAND
FT                   KFEIKGAAFEGKIQDIDFLATLPTYEEAIARLMGTMKEAAAGKLVRTFAALRDKLQEAA
FT                   "
FT   gene            complement(58416..59105)
FT                   /locus_tag="Asuc_0044"
FT   CDS_pept        complement(58416..59105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0044"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: hit:NTHI0642 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73425"
FT                   /db_xref="GOA:A6VKC8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKC8"
FT                   /protein_id="ABR73425.1"
FT                   /translation="MAKLTKKMKAIKAGVDSTKAYEINEALALLKQFATAKFNESVDVA
FT                   VNLGIDPRKSDQNVRGATVLPHGTGRTVRVAVFTQGANAEAAKEAGADLIGMEDLAEQV
FT                   KKGEMDFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQVRY
FT                   RNDKNGIIHTTIGKASFSEEQLKENLQALLAALAKARPTTAKGIFIKKVSVSTTQGAGV
FT                   QVDQSSL"
FT   gene            complement(59110..59538)
FT                   /locus_tag="Asuc_0045"
FT   CDS_pept        complement(59110..59538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0045"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: hit:NTHI0643 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73426"
FT                   /db_xref="GOA:A6VKC9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKC9"
FT                   /protein_id="ABR73426.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAR
FT                   TESIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTQD
FT                   QIRQIAETKAADMTGATIETKMKSIAGTARSMGLVVEE"
FT   gene            complement(59773..60534)
FT                   /locus_tag="Asuc_0046"
FT   CDS_pept        complement(59773..60534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73427"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD0"
FT                   /protein_id="ABR73427.1"
FT                   /translation="MTSIYTLPCEQELHQKLQALFRDWKNAIGAEHFVEDGFYPYYTKQ
FT                   TVKVLFIGREGLTIDANYIDQIYKEYKVNLSNWLRTENSTYTLNSHPFHSKLFYMAYGF
FT                   QHQFQKYEDIPWANDMRDDFATEKGISFAFMNLSKFSNNSGNFQADWNQINDFIKRTKQ
FT                   VEKSTGRNFFEEEIALLNPDVIITMNFAFPTRELPFIGKSKNGAVDLYELSLADKKIPV
FT                   FDTFHFSAVKSMEANFYQAIAELYNKYQEQN"
FT   gene            complement(60767..61324)
FT                   /locus_tag="Asuc_0047"
FT   CDS_pept        complement(60767..61324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0047"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides Ouzounis Woese) domain protein; KEGG: msu:MS0205
FT                   transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73428"
FT                   /db_xref="GOA:A6VKD1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD1"
FT                   /protein_id="ABR73428.1"
FT                   /translation="MTETAAPKKRWYVLQAFSGFEGRVAATLREYIKLNHMEDQFGEVL
FT                   VPTEEVVENVAGKRRKSERKFFPGYVLVQMEMNDYTWQLVRSVPRVMGFIGGTPDKPLP
FT                   ISQREADAILNRVEQNADKPRPKNVFQPGEEVRVTEGPFADFNGTVEEVDYEKGRLKVS
FT                   VSIFGRATPVELEFSQVEKATG"
FT   gene            complement(61326..61736)
FT                   /locus_tag="Asuc_0048"
FT   CDS_pept        complement(61326..61736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0048"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: msu:MS0204
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73429"
FT                   /db_xref="GOA:A6VKD2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD2"
FT                   /protein_id="ABR73429.1"
FT                   /translation="MALVVEKKKNEVEQTAQKSKGLNGFLWFLVVAFILVASVGNIYFA
FT                   EQYSTPVRVVAMFVLIAIALILAAMTNQGKKALAFFSEARTELRRVTWPTRPEATQTTF
FT                   IVVAVTVVTSLILWGFDSVIVSVLNFLTDLRF"
FT   gene            complement(61897..62784)
FT                   /locus_tag="Asuc_0049"
FT   CDS_pept        complement(61897..62784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0049"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   msu:MS0345 UDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73430"
FT                   /db_xref="GOA:A6VKD3"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD3"
FT                   /protein_id="ABR73430.1"
FT                   /translation="MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVSECVAAG
FT                   IKEIVLVTHSSKNAIENHFDTSYELESMLEKRVKRQLLEEVRSICPKDVTIMHVRQGNA
FT                   KGLGHAVLCGRPLVGNEPFAVVLPDVLLADFTADQKRENLAAMIKRFEETGASQIMVAP
FT                   VEPKDVSSYGVADCNGVEFGGGESAQISRLVEKPSVDKAPSNLAVVGRYVFSAGIWELL
FT                   ERTPVGVGDEIQLTDAIDMLIKKETVEAFHMTGESFDCGDKIGYMEAFVEYGLQHEKLG
FT                   TQFKDYLKKLVKTL"
FT   gene            complement(62868..64232)
FT                   /locus_tag="Asuc_0050"
FT   CDS_pept        complement(62868..64232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0050"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: msu:MS0346 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73431"
FT                   /db_xref="GOA:A6VKD4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD4"
FT                   /protein_id="ABR73431.1"
FT                   /translation="MSKLTCFKAYDIRGRLGDELNADIVYRIGRAFGQFLKPKTIVVGG
FT                   DVRLTSKELKSAVTNGLLDSGVNVIDLGEVGTEEVYFATSFLKADGGIEVTASHNPMDF
FT                   NGLKLVREGSRPISADTGLADIQRLAEENNFPDVVQRGTYKQQSVVGDYVERLLSYVNF
FT                   DNIKPLKLVFNAGNGAAGHALDAIEAQFKARRIPVEFVKVHNNPDGTFPHGIPNPILHD
FT                   NRQDTIDAVLANKADMGIAFDGDFDRCFFFDEKGQFIEGYYVVGLLSQAFTKKYPGAKI
FT                   IYDPRLIWNTEKLVEENGGVAVMSKSGHSFIKEKMREVDAVYGGEMSAHHYFRDFYYCD
FT                   SGMIPWLLVMELVCVSGKTLGQLVNESIDSYPSPGEINSKLTDAKAAIAQVRAAYEKDA
FT                   VSVSEIDGVSIEYPNWRFNLRSSNTEPVVRLNLETRGDKALMKEKTDEVLALLRQ"
FT   gene            complement(64245..64430)
FT                   /locus_tag="Asuc_0051"
FT   CDS_pept        complement(64245..64430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0051"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="PFAM: carbon storage regulator; KEGG: pmu:PM1288
FT                   carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73432"
FT                   /db_xref="GOA:A6VKD5"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKD5"
FT                   /protein_id="ABR73432.1"
FT                   /translation="MLILTRKVGETVLIGDDISITVLNIRGNQVKIGIEAPKDVTVHRE
FT                   EIYERIKLAAEDNNHV"
FT   gene            complement(64507..67131)
FT                   /locus_tag="Asuc_0052"
FT   CDS_pept        complement(64507..67131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0052"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="TIGRFAM: alanyl-tRNA synthetase; PFAM: alanyl-tRNA
FT                   synthetase class IIc; phosphoesterase DHHA1;
FT                   Threonyl/alanyl tRNA synthetase SAD; KEGG: hit:NTHI0978
FT                   alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73433"
FT                   /db_xref="GOA:A6VKD6"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKD6"
FT                   /protein_id="ABR73433.1"
FT                   /translation="MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQ
FT                   FKDVFLGMDKRPYSRATTAQRCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDYFKY
FT                   DAINFAWEFLTSPKWLALPKEKLYVTVYETDDEAYDIWNKEVGVPQEHIIRIGDNKGAP
FT                   YASDNFWAMGDTGPCGPCTEIFYDHGDHIWGGLPGTPEEDGDRYIEIWNIVFMQFNRLA
FT                   DGTMEKLPKPSVDTGMGLERMTAVLQHVNSNYEIDIFQTLIKKVAEIVGTTDLGNKSLR
FT                   VIADHIRSCAYLIADGVIPSNEGRGYVLRRIIRRAVRHGHLLGAKETFFYKLVPTLIEV
FT                   MAEAGKQVKEKQANVEKLLRLEEEQFARTLERGLILLDAELANVKNGVLSGEVAFKLYD
FT                   TYGFPLDLTADVCRERNIAVDENGFDKEMEAQRLRAQSASNFGMDYTSIIRVDGETKFE
FT                   GYTNVESLAKVTALFRDGKAVESVSAGQSAVVILENTPFYAEMGGQIGDSGMLTANGLH
FT                   FDVKDTQKYGQVFGHIGELTQGTLSVGQIVNAQVDAQRRQYTKLNHSATHLLHAALRQV
FT                   LGEHVAQKGSLVSDVGLRFDFVQPEAVTKEQIMEIERLVNFHIRANHPVLTEEMGVAEA
FT                   KSKGAIALFGEKYGETVRVVTMSPFSIELCGGLHVERTGEIGLLKIISEGAVAAGIRRV
FT                   EAVTGEEAINWLFNQQTILAQSADLLKSDIPSLPEKIIQLQDKVKKTEKELQQLKEKAA
FT                   MQAGSDLAKSAVKINGVSVVTHQLDGADAKVLRVMVDDLKNQLGSAVIALGSASGGKVN
FT                   LIAGVTADLTAKVKAGELVNVMAQQVGGKGGGRPDMAMAGGSQPENLSAALIVASDWLK
FT                   TMI"
FT   gene            complement(67295..67720)
FT                   /locus_tag="Asuc_0053"
FT   CDS_pept        complement(67295..67720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0053"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: msu:MS0349
FT                   universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73434"
FT                   /db_xref="GOA:A6VKD7"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD7"
FT                   /protein_id="ABR73434.1"
FT                   /translation="MYKHVLVAVDLSDESDFLLKKAAGIAKRHDAKLSIIHVDVNFSDL
FT                   YTGLIDVNMSSMQDRISSETQQALLQLSEQAGYPVTEKLSGSGDLGQVLSDAIEQYGVD
FT                   LLVTGHHQDFWSKLMSSTRQVMNSITIDMLVVPLRDE"
FT   gene            67958..68743
FT                   /locus_tag="Asuc_0054"
FT   CDS_pept        67958..68743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0054"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: hso:HS_1122 MazG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73435"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD8"
FT                   /protein_id="ABR73435.1"
FT                   /translation="MAYHIQDFVRLIARLRNPNGGCPWDLKQNYQTMIPCLIEESYEVI
FT                   DAIERQDTENLREELGDLLMQVVFLSQLATEEQKFTFDDVVNDVAEKIVRRHPHVFGEQ
FT                   SAGNEQEALAHWNAIKAQEKSRQKETSILDGIPHAFPALLRAEKLQKKCSKVGFDWNDV
FT                   NGVIAKVEEELDEVKQELNRPHLTQTKVNEEMGDLLFAAVNLARHVKTQPEEALRQANH
FT                   KFERRFRTVEQKIRQSGKALKDCSLAELDQLWDEVKSQE"
FT   gene            complement(68865..70034)
FT                   /locus_tag="Asuc_0055"
FT   CDS_pept        complement(68865..70034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0055"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: neu:NE1343
FT                   UDP-glucose/GDP-mannose dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73436"
FT                   /db_xref="GOA:A6VKD9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKD9"
FT                   /protein_id="ABR73436.1"
FT                   /translation="MKITVVGAGYVGLSNAVLLSQKYEVTLFDVAQEKIDCIKHKVSPI
FT                   QDAEISEYLAARSLNLRATADESGIYDEAEYIIVATPTDYDPEANYFNTRSIESVLTAA
FT                   LARNPRAYCIIKSTVPVGFTVKMREKHQTERIIFSPEFLRESKALYDTLYPSRIVVGDT
FT                   GEAARRFAEILRDCSLKPDMPIILINPTEAESVKLFSNAYLALRIAFFNELDSFAATFG
FT                   LDTRHIIDGVSADPRIGTHYNNPSFGYGGYCLPKDTKQLLANYKNVPQNLIGAIVASNR
FT                   TRKDFIAQDVLRRHPGLVGVYRLIMKSGSDNFRNSSIQSIMKRLKKKNIPIIIYEPEYD
FT                   GDEFLGFEIVNDLAEFKRRSDIILANRYHDILFDVAEKVYTRDLTGSDV"
FT   gene            complement(70053..72371)
FT                   /locus_tag="Asuc_0056"
FT   CDS_pept        complement(70053..72371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all5192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73437"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE0"
FT                   /protein_id="ABR73437.1"
FT                   /translation="MLTIADKKIIARDPALPGLSLLLDAESLLNRLKMISRLAQVTKAD
FT                   VQYLRYKPSNSCACTIRLKFADDSYQYYYAKALTEERFLESWNRRSRKKLIREGDPLAP
FT                   LAIKEAYIMLLHPAYDREIYHLKWLISDTARQELCKTCGLTEADDKSWRIDILRYKPER
FT                   RLVAKISRENRPFAIVRTATAKEFGKMLVGSAFGVAHGSISLLGADGERCTLATNWQSG
FT                   RSLCPEEGILPSDEIVRKLAKKLVRIHRSPNRHPVTYSWRDEVNALHGVISTFRHILPE
FT                   HTPWFRQLLERLEQGGSRIPACFSLIHGDFSLDQVVQRKNKAGEIKLYILDWDRSAFGH
FT                   PFFDLATFQARLELQVIEGFIPRWRADDILAVLFETYQKQGETDLRGLFYFTASALLRL
FT                   ATEPFRKRDSNWEDYSLQLLQRAETILAAGDTAYFLKDKRQNSESDNNLAILLNAEQMQ
FT                   TWLLKAHILSEPEQIKSVFLRRYKPGRRALLDYRVINLQTEQEENRYLIGKYRAKGLGK
FT                   RSYGVQQQLRQAGFDDQSKVSVPEVVGALPELNTWFQCRVNGQSIGELLIPTNGRLSFL
FT                   GTSVADAVVALHNSRVEQNLPLSVWTPENEFAVLQDGLQKFLKNRPHFESRIHAILSGC
FT                   KVLISQLNDTAYVTVHRDFYQDQLLERYSKPGYLVLVDLDLVCLGHAALDAGNYVAHIQ
FT                   ELSLRLYDDISALKVHEDAFKQQFLSETNSATFHQVEIYTTLSLARHIYISTLFENRTH
FT                   TTERLLKLCEERLDSHFIN"
FT   gene            complement(72391..74253)
FT                   /locus_tag="Asuc_0057"
FT   CDS_pept        complement(72391..74253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0057"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: ava:Ava_2435
FT                   ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73438"
FT                   /db_xref="GOA:A6VKE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE1"
FT                   /protein_id="ABR73438.1"
FT                   /translation="MKNNAWWEVAYRFKDYIRPERGLIILSLLSLLISTGARLLKPLPL
FT                   AFAVDYILIEVVEYVDVQDGGIGQSSSVNDLKFDSIFNVPLHSIDNKYLLLGCAAMVVI
FT                   IALLMAAGSFFSTVGLALAGSRILAKVRSDLFSHLLRLSMRFHSQAKTGDLTMRLVSDV
FT                   GMLREAVITALMPMLVNVLILVGMLSVMFYLHWKLTLFAVASLPLLWVVTNRSGKKIHE
FT                   VSRAQRKKEGGLASKASEYIASVRTIQSLSLEGETVRSFEGDNNASRQQEVKSKKLTAG
FT                   LERRVDVLMALVTAVVLFQGANTVLDGRMSPGELIVFMSYLNNSFRPVREYAKYTARLA
FT                   KALAAAERIIDLLDETPDIKDSADAKELIGVNGDIRFEHVSFGYHDKDQSFINVLRNMD
FT                   FSIRAGESVAVVGPSGAGKTTITSLLLRLYEPDSGTVRIDGHDIREYTLASMRKQITVV
FT                   PQDNLLFGISIRENIALGALHNIDEVTDNEIIAAAKLANAHDFISALPEGYNTVLSERG
FT                   SSLSGGQRQRIAVARAAISQSPVLILDEPTVGLDRESESHVMNALHNLMQNRTTIMITH
FT                   DLVLASTADRILFVENGVIAEQGSHEDLLANGKNYADWWRMQVN"
FT   gene            complement(74265..75446)
FT                   /locus_tag="Asuc_0058"
FT   CDS_pept        complement(74265..75446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0058"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   syn:sll1724 LPS glycosyltransferase IcsA"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73439"
FT                   /db_xref="GOA:A6VKE2"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE2"
FT                   /protein_id="ABR73439.1"
FT                   /translation="MRVAYICADPGIPVFGTKGASVHVQEVIKGMLAKGLDVTLFAQRL
FT                   GGDVPQALKNIKIRTLNKLPEASAEIRARAALDANTGIERLLASEGPFDVVYERYSLWS
FT                   NAGMNFAKKHRCIGILEVNAPLIEEQKKHRTLPLEAEAQDIAQSVFSDADAMIAVSPGV
FT                   RQYLESFAKAKGRVHVIANGVNLERFASAALENQKRLRNLTALSEITIGFLGTLKPWHG
FT                   LATLVDAWKILRRRNQHIRLLIVGDGPEYAYLYSDIKNAGLTDYVTFTGTVQPEQVPYW
FT                   LAQMDIAVAPYPQLDNFYFSPLKIYEYMASGIPVITTRVGHLEKVVCHGQNGMLVEAEN
FT                   PEQMADCIERLVAEPLRLQQLGIAARQTAEREHSWLSVVERIIRIAESINGQK"
FT   gene            complement(75462..76691)
FT                   /locus_tag="Asuc_0059"
FT   CDS_pept        complement(75462..76691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0059"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ava:Ava_2433 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73440"
FT                   /db_xref="GOA:A6VKE3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE3"
FT                   /protein_id="ABR73440.1"
FT                   /translation="MNNTQQSSPLYIGYVLKRYPRFSETFVVNEILAHERAGTKIDIFA
FT                   LGPVQETHFQDVISQVRAPVYRLTDKQRNAESLWALFRNGFAQLPDFAGKLSKATGSIH
FT                   EVAQAIQIALEIQKNGIQHLHAHFGTQAATVARQAAIFAGIGYTFTAHAKDIYYQYEES
FT                   TELAAKMRDSSATVTVSDYNLAYLREQYGEDASKVVRIYNGMDLNKFPYLPYIRRKPHI
FT                   LAVGRLVAKKGFHILLEALALLKQQKIDMSCTLVGAGILQTKLEEQIKALAIEDVVSMV
FT                   GPMPQQDIIRIMQQANMVVAPCVISDDGDRDGLPTVLLESMALGTPVISTQVAGIPELV
FT                   KDNETGLCVTSQNPQLLADAIKRLLGDRRLCQTLSKNGRALIEREFDEDRNAARLRELF
FT                   RYAIQSSTAA"
FT   gene            complement(76728..77915)
FT                   /locus_tag="Asuc_0060"
FT   CDS_pept        complement(76728..77915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all5196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73441"
FT                   /db_xref="GOA:A6VKE4"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR016683"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE4"
FT                   /protein_id="ABR73441.1"
FT                   /translation="MANSLKTRKNMPRIAFYSHDTMGLGHIRRNMLLAQSVLEAYPKAE
FT                   VLLLSGVRESGAFKLPKGADSVTMPTYLKTVEGEYIPRSLGKDVKRLVDIRKNIIRAAL
FT                   NAFEPDIVVIDNVPRGAMNELDNILPELASRGTYIVLGVRDIIDEPEAVRNQWQKLKNI
FT                   DVIRLYFSAIWVYGDHRLYDFAEEYRLPEDICRKLYYVGYLDQSRRLEVRRTDTAPFDI
FT                   PSPYILCAVGGGQDGFELARAFLRAKLPLHRHGLLITGAFMPEKLRTKLHTMAAERQDL
FT                   TVMDFIPEPLKIMQNAERVISMGGYNTTTEILSFNKPALIVPRIKPRKEQWLRASRLSG
FT                   MGVVDCLHPDALTPEALSGWMQADKTLLNMREYLRFDGLDSVVSEIRTILENKLS"
FT   gene            78106..79248
FT                   /locus_tag="Asuc_0061"
FT   CDS_pept        78106..79248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0061"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: hdu:HD1433
FT                   outer membrane protein P2 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73442"
FT                   /db_xref="GOA:A6VKE5"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE5"
FT                   /protein_id="ABR73442.1"
FT                   /translation="MKKTTLALFTSIFAIPSASAFNLVDNQEYGTKLDFVGSARIMWRN
FT                   TSDKETDVADGSITREHINHAVQNNGSRFGFKLSQSLTNDFYVLGRVEWRFRGTDNNGV
FT                   EARSQHNFDHIYTRQLYAGIGHSQYGELTYGNQTVLTDEVKQTDLPNTLSLSDGLLVSG
FT                   ARRTIQYVYTGNNGYTKGLKIGAFYGNRSPRGNNGLSLEEHRKDIWGGGAIQKFEIDEY
FT                   QELVLSLGTTKERFERANLPVYSRTAYAFGSAYTYDDTTLGLDLERQERKNQDEAGAKR
FT                   TYKEIRTVLYHKITPDWRAYTMYAYKTEKRNDVDSTDRKDKTHQFMLGSEYYLIPKNTG
FT                   PISLKTFLEWQATRTKEYRTGELRQKERNYTTVIGLRAYW"
FT   sig_peptide     78106..78168
FT                   /locus_tag="Asuc_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 21"
FT   gene            complement(79311..80183)
FT                   /locus_tag="Asuc_0062"
FT   CDS_pept        complement(79311..80183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0062"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ecv:APECO1_1695
FT                   2,5-diketo-D-gluconic acid reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73443"
FT                   /db_xref="GOA:A6VKE6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE6"
FT                   /protein_id="ABR73443.1"
FT                   /translation="MRNIKLYNGVEMPKLGFGVYQVAPEQTESVVAEALGAGYRHLDTA
FT                   AAYFNETQVGNGIRQSGVPREEIFLVTKLWLNAASYEGAKAQFERSLNRLQTDYLDLYL
FT                   IHQPYGDVHGAWRAMEELYEAGRIKAIGVSNFHGDRLVDLTEFNRIKPMVNQIEINPFH
FT                   QQIGEVNFMQANGIVAEAWGSFAEGKYDFFNNPVLTEIGKKYGKTAGQTAIRWLYQRNV
FT                   VSLVKTVRPERMKENLAVTDFELSAEDMLQISTLDTGISALATTMPTFFSHRDPNFSKW
FT                   MAAWKAWDI"
FT   gene            complement(80339..81274)
FT                   /locus_tag="Asuc_0063"
FT   CDS_pept        complement(80339..81274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0063"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   shn:Shewana3_2327 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73444"
FT                   /db_xref="GOA:A6VKE7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE7"
FT                   /protein_id="ABR73444.1"
FT                   /translation="MKTVALYLAPNFSLFHFSVPQMVFSTQVDKPLFDLKIVAEMPTVK
FT                   LSDGITVQADGGLELFERADIVIVPAWNDYAEQPSFALQTALQQANGCGVMMVGLCLGA
FT                   YALAYSGLLNGKKAATHWAAESDFSRRFPQVQLDSNALYVQDGNVMTSAGTAAGLDCCL
FT                   AIVREIYGVQTANHLARFFVTPPHREGGQAQFIEQPVPRKTFDENINELLDDIRKNLQA
FT                   VYLIDDIADRLSMSRSTFTRHFRKATGQSFARWLIETRLQRGRELLESSKLPVEQIAEQ
FT                   SGFRSAVSFRQHFIEKHKISPRAYRKAFGD"
FT   gene            81435..82283
FT                   /locus_tag="Asuc_0064"
FT   CDS_pept        81435..82283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_2326 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73445"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE8"
FT                   /protein_id="ABR73445.1"
FT                   /translation="MKIKALSTALLLSLGIATSAQAMEYQHIRNATAKIDYAGTTFLVD
FT                   PYLATKGVYEGFAGTVNFEKRNPLIDMKQSAEDVINGVQAVIVTHTHDDHWDKAAQDKL
FT                   PKDLPIFVQNADDAKIIRGQGFKDVRVMGANTEFNGVKLTRIKGGQHGTDEMYAQPTLA
FT                   EMLGDAMGFIMQADNEKTAYIVGDTIWNQAVDNALADFKPEVVVMNTGYAQMIEPKGGI
FT                   IMGLEDVTKMREVSPEADIVTVHMDAVNHATVSSEDMREFVKVKSLKQVAVPTEGEKLK
FT                   Y"
FT   sig_peptide     81435..81503
FT                   /locus_tag="Asuc_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(82331..82957)
FT                   /locus_tag="Asuc_0065"
FT   CDS_pept        complement(82331..82957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0065"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; KEGG: lwe:lwe0626
FT                   endonuclease III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73446"
FT                   /db_xref="GOA:A6VKE9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKE9"
FT                   /protein_id="ABR73446.1"
FT                   /translation="MKTDEQKLAVLNKLVAHYGEQHWWEDENWVRDGVSMILIQQSTQE
FT                   NVEKALANLAPVMSLQGLRKLSVDELQEQIRPAGFYKQKAAYLQNWLAFFAKYGDEPTA
FT                   YNRFATPELREMLLSIKGVGAETADCMLMYLFQRKTFIADAYALRLFARLGFGEYENYP
FT                   SMRNDFQHLTDHVTLKQCKEWHACIDVHGKRFRKGLVSEESFLLE"
FT   gene            complement(83452..84291)
FT                   /locus_tag="Asuc_0066"
FT   CDS_pept        complement(83452..84291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0066"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="TIGRFAM: S-formylglutathione hydrolase; PFAM:
FT                   putative esterase; KEGG: smu:SMU.118c putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73447"
FT                   /db_xref="GOA:A6VKF0"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF0"
FT                   /protein_id="ABR73447.1"
FT                   /translation="MSDLTLLSRNKMFDGYHERYSHHSKANNCTMTFAVYLPPQAANGE
FT                   KVPVIYVLSGLTCTDENFSTKAGAQQYAAKHGVALVMPDTSPRGENVADDPAYDLGQGA
FT                   GFYLNATQQPWAANYQMYDYVVHELPVLIEANFPVSDKRAICGHSMGGHGALQIGLKNP
FT                   ERYVSISAFAPIVNPMDTPWGQKAFTAYLGEDRSQWQQYDSTYLVSKAKIAVKILIDQG
FT                   LADNFYPEQLQPEKFAAAAKQNGIDVTLNLHEGYDHSYFFIATMAEKHIAFHAEQMK"
FT   gene            complement(84293..85411)
FT                   /locus_tag="Asuc_0067"
FT   CDS_pept        complement(84293..85411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0067"
FT                   /product="Alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /note="TIGRFAM: Alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: smu:SMU.119
FT                   putative alcohol dehydrogenase class III"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73448"
FT                   /db_xref="GOA:A6VKF1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF1"
FT                   /protein_id="ABR73448.1"
FT                   /translation="MEFIKTRAAVAWAPNEPLKIEEIDLMPPQAGEVLVRIVATGVCHT
FT                   DAYTLSGQDSEGVFPCILGHEGAGIVEAVGEGVTDFKVGDHVIPLYTAECGKCKFCLSG
FT                   KTNLCSAVRETQGKGLMPDGTVRFFKDGQPIYHYMGTSTFSEYTVVSQYSLAKIQENAP
FT                   LDEVCLLGCGVTTGIGAVTKTAKVKKGDTVAIFGLGGIGLAAIIGARMAEAGRIIGIDT
FT                   NPAKFEKAKELGATDCINPKDFDKPIHEVIIEMTDGGVDFSFECIGNVDVMRSALECCH
FT                   KGWGESVIIGVAPAGAEIRTRPFQLVTGRVWRGSAFGGVKGRTELPGIIDKFMQGEFKL
FT                   RDFITHTMPLEDINKAFDLMHEGKSIRTVIHY"
FT   gene            complement(85589..86047)
FT                   /locus_tag="Asuc_0068"
FT   CDS_pept        complement(85589..86047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0068"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   msu:MS2114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73449"
FT                   /db_xref="GOA:A6VKF2"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF2"
FT                   /protein_id="ABR73449.1"
FT                   /translation="MYFPYFLLALVAGAALASQAAINSRLAQAVLGQPLISALVSFASG
FT                   TVALLIFCFWKTDLSALRELTSVASWKLLGGVLGAGFVFTTIFLAPKLGITNMLFFVII
FT                   GQLCTAAVIDHFGLFGMAQRTFQFSQIIGLLIIVIGLGFYFFGNKILG"
FT   sig_peptide     complement(85985..86047)
FT                   /locus_tag="Asuc_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 21"
FT   gene            complement(86366..87079)
FT                   /locus_tag="Asuc_0069"
FT   CDS_pept        complement(86366..87079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73450"
FT                   /db_xref="GOA:A6VKF3"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF3"
FT                   /protein_id="ABR73450.1"
FT                   /translation="MDNLFVKFNFAWPWMGLAMAAVLSVLMITTDIFRRDENGHRWFDP
FT                   VWLAWLVVPLCMFHQFEEYAASYNVATDSYDMVREVCRQQGFAPYEHCPIPIVHFPLVN
FT                   VLLAWVAAPIAAMLCKHNPLVGLSLYGFLFADGLIHLIISLVDNQPFLHHPGLITGSLV
FT                   FIPLALWVMLIGVPKFMNCNAMICTIFAGVIGQLCLYAAYSALLNWGVAAMLVTDVIAV
FT                   FIPLVLTALVTRRVI"
FT   gene            complement(87270..87698)
FT                   /locus_tag="Asuc_0070"
FT   CDS_pept        complement(87270..87698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73451"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR041183"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF4"
FT                   /protein_id="ABR73451.1"
FT                   /translation="MKKIVLFLTALFTTMNTLGQLMNIEIQLAKSHEKITASLADNQTA
FT                   RDFYNQLPLIMKLEDYADSEKIGRGIPKKLSIADSPKGYAGNRGDLAYYAPWGNLAVFY
FT                   TDSHVGYANGLVYLGKITSGLETLSKLDGEKVTIKKVE"
FT   sig_peptide     complement(87639..87698)
FT                   /locus_tag="Asuc_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.955 at
FT                   residue 20"
FT   gene            complement(87695..88252)
FT                   /locus_tag="Asuc_0071"
FT   CDS_pept        complement(87695..88252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0071"
FT                   /product="isoleucine patch superfamily acetyltransferase"
FT                   /note="KEGG: msu:MS2128 acetyltransferases (the isoleucine
FT                   patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73452"
FT                   /db_xref="GOA:A6VKF5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF5"
FT                   /protein_id="ABR73452.1"
FT                   /translation="MNPKLNLPINQLIASNSELFVKIHDIVAKNAPLVAALNAGYKTQA
FT                   EIRSILSAMTGNAIDESLHVNLPLYTDFGANIRIGKRVFINTAVMLTDLGGITLEDDVL
FT                   IGPRANIVTVDHPTDPSQRRGVLLKPVVIKKNAWIGAGATILSGVTVGENAIVAAGAVV
FT                   TKDVPSNAIVGGVPAKVLKEIR"
FT   gene            complement(88495..89631)
FT                   /locus_tag="Asuc_0072"
FT   CDS_pept        complement(88495..89631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0072"
FT                   /product="hydrolase of the alpha/beta superfamily"
FT                   /note="KEGG: msu:MS2129 hydrolases of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73453"
FT                   /db_xref="GOA:A6VKF6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF6"
FT                   /protein_id="ABR73453.1"
FT                   /translation="MKFKLKTLTSALIFSSTLLGASAMAALPQNAAAVEVPVQSIQLTQ
FT                   EWDKIFPKSDKVEHRKVTFKNRYGIILVGDLYVPKNAQGKLAAIAVSGPFGAVKEQSSG
FT                   LYAQHMAERGFVTMAFDGSYTGESSGMPRNVPSPEINTEDFSAAVDFLGSLDNVDREKI
FT                   GILGICGWGGFALNAAISDTRVKAVAVSTMYDMTRVNANGYEIKLDPKGQYDRVPAQTA
FT                   EARYKMKEGLNNARWEAMKDGYAALLPANNLDPKKDITAETPKFVAEYANFYRTERGFH
FT                   PRSVNSNPEHSWTTTAFLPFVNMPILQYAAELKAPVLVVHGEKAHSRYFGEDTFKALGS
FT                   KDKELVIVPNASHTDLYDDVAGKIPYDKFEAFFKAKLK"
FT   sig_peptide     complement(89554..89631)
FT                   /locus_tag="Asuc_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.593 at
FT                   residue 26"
FT   gene            89887..91206
FT                   /locus_tag="Asuc_0073"
FT   CDS_pept        89887..91206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0073"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: lca:LSEI_0165 helicase subunit of the
FT                   Holliday junction resolvase related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73454"
FT                   /db_xref="GOA:A6VKF7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF7"
FT                   /protein_id="ABR73454.1"
FT                   /translation="MSTQPSLFENPENQPLAARLRPERLEEFAGQPHLLGEGKVLRRLI
FT                   ENDQISSMIFWGPPGVGKTTLAQIIANSTQAGFIEFSAVTSGIKDIRAIMQQAEQNRRY
FT                   GAKTIVFVDEIHRFNKAQQDAFLPFVEKGSIVLIGATTENPSFEINGALLSRCKVFVLQ
FT                   PLETADIVKLLQRALTAPKGFGHLRVNMQSDMLEVLANFANGDARSALSTLEMVVLNGE
FT                   HQGNAVTVTEETLSQCLSRKTLLYDKKGEEHYNLISALHKSMRNSDADAAVYWLARMLE
FT                   AGEDPLYVARRITRFASEDVGLADPRALEICIAAYQACHFIGMPECSVHLTQAVVYLSL
FT                   APKSNAIDMAYHQARKDALTQLADPVPLHIRNAPTKLMKELDYGKGYEFAHHYEDKLTT
FT                   MQCLPDSLLGREYYRPTEQGLEGRFKNRLAEIKQWKKSHG"
FT   gene            91356..92300
FT                   /locus_tag="Asuc_0074"
FT   CDS_pept        91356..92300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0074"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein; KEGG: msu:MS0026 tellurite resistance
FT                   protein and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73455"
FT                   /db_xref="GOA:A6VKF8"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="InterPro:IPR039264"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF8"
FT                   /protein_id="ABR73455.1"
FT                   /translation="MFLKTPLPVNYFSIVLGLAALGLAWRYGASVALFPAWVGETVIAA
FT                   AGLIWLGLMTAYGYKWVKFPETAQSELTHPITGSFVSLVPITTLLICVGIRPHFSSLST
FT                   VLLVFGIIGQLGFSAYFTARLWQGTHPAEATTPALYLPTVATNFVSTIALGDIGLKDFG
FT                   MIFLGAGIFSWFFIDGAIQQRLRNLTAIPNAVRPALGIQFAPAIVGCAAYLSVNGGEID
FT                   TFAKLLIGYSLLQFLFLARLFPWIAQHGVSLSYWAFSFGLASMAGVGLRIYHGVENQPF
FT                   GWLGYVMFVVGTTFIALLTAGTLWLMVKKIRRT"
FT   sig_peptide     91356..91445
FT                   /locus_tag="Asuc_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.261 at
FT                   residue 30"
FT   gene            complement(92335..92841)
FT                   /locus_tag="Asuc_0075"
FT   CDS_pept        complement(92335..92841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0075"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: msu:MS2211 AcrR
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73456"
FT                   /db_xref="GOA:A6VKF9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKF9"
FT                   /protein_id="ABR73456.1"
FT                   /translation="MKKTVNFVVKESITEALIRLMKKKSFDNISITEITALAGVSRISF
FT                   YRNFESKEDVLIKHLYERAMTSFTALHADTVRERLLGLFSVTDELGDVLDLLYSQGLSH
FT                   LFLRYFAFVIGAKPEQSNEQAFQSAIMMGICFGSLDEWIKRGRQESPEVMVDILLNTIR
FT                   RCLDE"
FT   gene            92974..93177
FT                   /locus_tag="Asuc_0076"
FT   CDS_pept        92974..93177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0076"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: msu:MS2210
FT                   osmotically inducible lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73457"
FT                   /db_xref="GOA:A6VKG0"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG0"
FT                   /protein_id="ABR73457.1"
FT                   /translation="MKKTWLKGLMIVAVATSVSACGLHGQQRDTATGALIGGVAGNLIG
FT                   GNTVSTVAGAALGGVVGSQWNR"
FT   sig_peptide     92974..93051
FT                   /locus_tag="Asuc_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.653 at
FT                   residue 26"
FT   gene            93402..93728
FT                   /locus_tag="Asuc_0077"
FT   CDS_pept        93402..93728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0077"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: msu:MS2209
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73458"
FT                   /db_xref="GOA:A6VKG1"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG1"
FT                   /protein_id="ABR73458.1"
FT                   /translation="MKSIIAKGLFVALLSTSVSAHALSRSQHDTAVGAVLGGVAGAVIG
FT                   NDITSTVAGAALGGVVGSQWNAKDRHRHRHYDRDRRHYRSDRHKVRHHDRRPSRHYRHH
FT                   RRHD"
FT   sig_peptide     93402..93470
FT                   /locus_tag="Asuc_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 23"
FT   gene            93914..94819
FT                   /locus_tag="Asuc_0078"
FT   CDS_pept        93914..94819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0078"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: msu:MS2130 LysR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73459"
FT                   /db_xref="GOA:A6VKG2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG2"
FT                   /protein_id="ABR73459.1"
FT                   /translation="MSNKLDSLKYFCLAAETLNFREAASRLAISPSVITRVINELENEL
FT                   GEQLFKRNTRNIRLTSFGEQFLPKAQQLLTDSENLFRMGKTPNDDLAGIVRITVPAWRE
FT                   NDLIIRELLNALDDHPEIVLDWREDMGKLDMIEDRIDIGLRIGAEPDQDFVVRKIADVG
FT                   DILVTSPKLLETVGTPRNFEDFQRRFPFAQPINPNTGRAWNLPLNENVALIPRNIAFHS
FT                   VDNYSALQAILIGKCAGLVSDFMAKPLLADGQLVRLFPEIEIDKWQLFLYRPYQAITPA
FT                   RVLKVFDLMTAILRNIFNPE"
FT   gene            complement(94844..96010)
FT                   /locus_tag="Asuc_0079"
FT   CDS_pept        complement(94844..96010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0079"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bfs:BF2930 putative antibiotic resistance transport
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73460"
FT                   /db_xref="GOA:A6VKG3"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG3"
FT                   /protein_id="ABR73460.1"
FT                   /translation="MTKSNSKFFLVLLLGVLSAFGPFVVDLYLPSLPQLTAFFATTPPM
FT                   TQLTLTTAMIGLAGGQLLIGPVSDKFGRKKPLILSLLVYIASTLAIVFSPDIETMIVLR
FT                   VIQGLSSAGSVVISRAVATDLYRGREMTRFFGLLMTINGMAPIISPILGSLLLEYISWK
FT                   GIFVFLTLIGVAVTLFCFNLKESLRPEARLTGSVLSTFKTFSVIARNRRFMSYVGIESF
FT                   LFGAMFAYIAASPFILQSFYGLSAFVFSLCFGANGFALVLGSNLGSRLSNKAALKSGVI
FT                   GFWFATIYTIAVLLVQPHWFWVEAGFFVMLLMTGGPLPAISALAMESERQYAGSASALL
FT                   GCMPFLLGGVVSPLVGIGNIFYATAVVVALCGLLAVAIYFSVKSAVEK"
FT   sig_peptide     complement(95936..96010)
FT                   /locus_tag="Asuc_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.902 at
FT                   residue 25"
FT   gene            96380..97270
FT                   /locus_tag="Asuc_0080"
FT   CDS_pept        96380..97270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0080"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cvi:CV2939 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73461"
FT                   /db_xref="GOA:A6VKG4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG4"
FT                   /protein_id="ABR73461.1"
FT                   /translation="MDRITAIQVFLAVTETGSFTQAAARLDISKPMISRYVNLMEDWLN
FT                   ARLLQRTTRKVSLTEAGEQAVVFCRQIINLQQEMEQELAAQSGELRGGLRLTASNAFGS
FT                   AHLVQAINAFMMCHPKLNIQLLLSDTPINLVEERIDLAVRITNSPDPNLVARKLAACHS
FT                   VLAATPAYLAQAGEPATPDQLANHRYLAHANINRKSWKFKQNGREIQIELTSRFATNDT
FT                   LALLHAVQGHGGIAMLPRYLISEQLKNGTLKPVLTDWQLPEFDIYALYPSRHKLPLAVR
FT                   SLIDFLAQWFAVKDW"
FT   gene            complement(97353..98294)
FT                   /locus_tag="Asuc_0081"
FT   CDS_pept        complement(97353..98294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0081"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: msu:MS1612 periplasmic
FT                   sugar-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73462"
FT                   /db_xref="GOA:A6VKG5"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:5DTE"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG5"
FT                   /protein_id="ABR73462.1"
FT                   /translation="MASKLLKNIFKFSALLGALPTLAFAADKPQIALLMKTLSNEYFIS
FT                   MRQGAEETAKQKDIDLIVQVAEKEDSTEQLVGLVENMIAKKVDAIIVTPNDSIAFIPAF
FT                   QKAEKAGIPIIDLDVRLDAKAAEAAGLKFNYVGVDNFNGGYLEAKNLAEAIGKKGNVAI
FT                   LEGIPGVDNGEQRKGGALKAFAEYPDIKIVASQSANWETEQALNVTTNILTANPNINGI
FT                   FAANDNMAIGAVTAVENAGLAGKVLVSGYDGIPLAIEYVKQGKMQNTIDQLPKKQVAIA
FT                   IEHALKQINKQEIPSVYYVDPVVVDKEQSKNY"
FT   sig_peptide     complement(98217..98294)
FT                   /locus_tag="Asuc_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            98454..99941
FT                   /locus_tag="Asuc_0082"
FT   CDS_pept        98454..99941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0082"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: msu:MS1611 ABC-type sugar (aldose) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73463"
FT                   /db_xref="GOA:A6VKG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG6"
FT                   /protein_id="ABR73463.1"
FT                   /translation="MNDHSILTLKNISKSFFGVTVLEDIDLDIRCGEVLCLIGENGAGK
FT                   STLCKIIAGIYRSDNGEMLYQGEPYSPTTVKEAQEAGIGFIHQELMLVPKLSVMENIFL
FT                   GTEKSSRFGRMNWTEMRTETQHIIDELELDIKPDDLIADLSIAQQQMVEIAKAVFSEYK
FT                   IIIFDEPTSSISRKNTEVLFRIIHQLKTKGVAMIYISHRLEEFKYIADRVTVLRDGRIT
FT                   GNLRYEETSPEEIVRLMVGRKVDFSRYRRNTVFTQEKLRVENIRSKHISPISFQVNKGE
FT                   ILGFAGLVGAGRTEVLRAIYGADESSGKIYIDQREIVIHSPEDAVKNKIGFITEDRKSQ
FT                   GLVLGMSIRENITLPILRRFWNGWRLDKNQEREVVEANRRKLHIVSKDQEQQTKTLSGG
FT                   NQQKVILARWLESGVDILFFDEPTRGIDIGAKSEIYDLMRQFTENGGTIVMVSSDLPEL
FT                   ITISDRVIVMRNGEKVKEITNRDEITEENLMHAMIGI"
FT   gene            99958..100986
FT                   /locus_tag="Asuc_0083"
FT   CDS_pept        99958..100986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0083"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: msu:MS1610
FT                   ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73464"
FT                   /db_xref="GOA:A6VKG7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG7"
FT                   /protein_id="ABR73464.1"
FT                   /translation="MFSLKKVISKLGIGLVLLFMIIGMSFTSEAFLSTNNIFNILLQVS
FT                   VICVISVGMTYVILTGGIDLSVGSIVALSAVCLGLFTHWGVAWLGENPSQGALWGVMVL
FT                   SIAGAVLVGALCGYVNGAIIVYGKVTSFITTLGMMGIARGLALTLSNGKTIYNFPEQLR
FT                   FFGNGRLAVTESFSIPIPVIIALIVVLISFYVLTQTVFGRQIYALGGNREAVRLSGINV
FT                   NKLEIRTYVINGALAAVGAVILVGRLNAAQPIAGTGYELDAIAATVIGGTSLMGGVGSV
FT                   VSTSIGALIMGVLQNGLTLLNVTSYLQRLIIGMVIILAVFLDQLRRGEVSAGRLRRIFF
FT                   RE"
FT   sig_peptide     99958..100050
FT                   /locus_tag="Asuc_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.833 at
FT                   residue 31"
FT   gene            100990..102444
FT                   /locus_tag="Asuc_0084"
FT   CDS_pept        100990..102444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0084"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: msu:MS1609
FT                   XylB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73465"
FT                   /db_xref="GOA:A6VKG8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG8"
FT                   /protein_id="ABR73465.1"
FT                   /translation="MNYYLGIDCGGTFIKAALFDENGNIQACERENVTVVSKQSGYAER
FT                   DMDELWQMCTKVIRRTLKSSKIRPHLIKSVGISAQGKGAFLLDKHNRPLGRAILSSDQR
FT                   AQAIVKRWQAEGLEEKVYPLSRQGLWTGHPVAILRWLKENEPARYRHIGNLLMSHDYLR
FT                   FCLTGNLYCEESNISESNLYNMITGKYDPRLAQLLGIEEITEKLPPVIKANQIAGYVTE
FT                   QAAQACGLAVGTPVVGGVFDVTAMTLCLTDNQPGKLNVVLGTWSIVTGISDSLDDRLDS
FT                   RFAHGRYVEAGKFLIQEASPTSAGNLEWFVKQWNLDYQQINQMIAPLPPAQSTVVFLPF
FT                   LYGTNAKLGMTAGFYGMQAHHTQAHLLQAVYEGVLFSLMTHLERMYRRFPQIQTLRVTG
FT                   GPAKSAVWLQMLADLTGKILEVPEVEEIGCLGAALMAAEGVGANGSALKRHQAIRVIRP
FT                   NPANFDAYRNKYRQYQKLVELLAQMT"
FT   gene            complement(102598..104274)
FT                   /locus_tag="Asuc_0085"
FT   CDS_pept        complement(102598..104274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0085"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIC subunit;
FT                   PFAM: phosphotransferase system EIIC; phosphotransferase
FT                   system PTS fructose-specific IIB subunit; KEGG: msu:MS2178
FT                   phosphotransferase system, fructose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73466"
FT                   /db_xref="GOA:A6VKG9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKG9"
FT                   /protein_id="ABR73466.1"
FT                   /translation="MNIFLTQSQLGNAKAFLLKQVITAAAQAQNHQITDNAEQADLAII
FT                   FGKTLPNLTALQGKKVYLAEPEQALTAPEQTVQRALTEATDYVAPQQSGVSAVAAGGSK
FT                   NIVAITACPTGVAHTFLSAEAIEAYGKKMGWNVRVETRGQVGVGNPITPEEAAAADLVF
FT                   VAADIDVDLSKFKGKPMYRTSTGLALKKTEQEFTKAFADAKIYEGGETKTAADNSAQGE
FT                   KKGVYQHLMTGVSHMLPMVVAGGLLIAISFMFGPNAFKDPSIAGGLPTALMEIGGGAAF
FT                   KLMIAVFAGYVAYSIADRPGLAVGLIGGMLATNANAGILGGILAGFLAGYTVKFLNDII
FT                   KLPASMTSLKPILILPLLGSAIVGLAMVYFLNPPVAAVMASLTDWLNGLGSTNGLLFGA
FT                   ILGGMMCIDMGGPVNKAAYVFGTGLLASQVNTPMAAIMAGGMVPPLGMAIATWIARNKF
FT                   NAGQRNAGNAAFVLGLCFISEGALPFVAADPIRVIVSSVIGGALAGAISLSFAIELPAP
FT                   HGGLFVVPLVSQPLMYLGAIAAGALVTGVIYAVIRPKQTQE"
FT   gene            complement(104279..105220)
FT                   /locus_tag="Asuc_0086"
FT   CDS_pept        complement(104279..105220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0086"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="PFAM: PfkB domain protein; KEGG: msu:MS2179
FT                   fructose-1-phosphate kinase and related
FT                   fructose-6-phosphate kinase (PfkB)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73467"
FT                   /db_xref="GOA:A6VKH0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKH0"
FT                   /protein_id="ABR73467.1"
FT                   /translation="MAKVATITLNAAYDLVGRLKRIELGEVNTVETLGLFPAGKGINVA
FT                   KVLNDLGVSVAVGGFLGKDNVGDFERLFASVGLEDKFQRVAGKTRINVKITETEADVTD
FT                   LNFLGYHISAADWQKFVADSLAYCQAFDIVAVCGSLPRGVTPELFADWLRQLHQAGVKV
FT                   VLDSSNAALTAGLTAHPWLVKPNHRELEAWIGHSLNSLEEIVQAAKKLQTQGIANVIIS
FT                   MGAEGSLWLSEQGVVRAQPPKCENVVSTVGAGDSMVAGLIYGVVNGLSQQDTLAFASAV
FT                   SAFAVSQSNVGVSDRALLEPILANVKITTIEG"
FT   gene            complement(105223..106725)
FT                   /locus_tag="Asuc_0087"
FT   CDS_pept        complement(105223..106725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0087"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; phosphoenolpyruvate-dependent
FT                   sugar phosphotransferase system EIIA 2; KEGG: msu:MS2180
FT                   phosphotransferase system mannitol/fructose-specific IIA
FT                   domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73468"
FT                   /db_xref="GOA:A6VKH1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR016258"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKH1"
FT                   /protein_id="ABR73468.1"
FT                   /translation="MFNLPENNIHLAAQATDKQQAIEMAAAALEQGGYVESGYLQGMLG
FT                   REQQTSTFLGNGIAIPHGTLETRGLVKNTGVAVFQFPQGIEWGEGNKAYVVIGIAARSD
FT                   EHLSLLRQLTHVLGDEDTAAKLATLDDVKKFRAILMGEAEDFVVKAETISLDVDTTSLL
FT                   TLTAINAGKLQEQSVVENAFVSEVISSPALPLGKGLWLTDSVAGNVKNGLAFSRARKAF
FT                   EYNGKTVRAVLTVSSKDDAVNETLARLLDTNVQEQLLTGSREQIVAALNGTELVVNTVP
FT                   AQAGGTVIGTFTLRNEHGLHARPSTVLVNTLKAFGAKITVENLTRGGLAVNAKSAMKLV
FT                   GIGATKNHRLRFVAQGDDAEQAMEALAKAFSEGLGEGVSAVPPAEPDTIEVVSADSTAN
FT                   VPEKNEAKSADGAEGIFVLNNEHGLHARPSAVLVNEVKKYNASVAVQNLDRNTQLVSAK
FT                   SLMKIVALGATKGHRLRFVATGEEAQQAIDGIGAIIAAGLGE"
FT   gene            complement(106802..107314)
FT                   /locus_tag="Asuc_0088"
FT   CDS_pept        complement(106802..107314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73469"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKH2"
FT                   /protein_id="ABR73469.1"
FT                   /translation="MFKQFSLAALIAMTAACSSISDYVPFMGNSKPVINLEQDQIDQKS
FT                   YAVAYASTVQTYKGQINDSYDVNNFASGVNDWNRNRILVPVEQVRAKLSAGIDSNVHAY
FT                   YSGVVFASDLQNNFSRLSKDCWSKIDRPSMTQGIYDAMLDLKKGKSRSENDEYISKGSE
FT                   QLLGVCK"
FT   sig_peptide     complement(107249..107314)
FT                   /locus_tag="Asuc_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.637 at
FT                   residue 22"
FT   gene            107448..107783
FT                   /locus_tag="Asuc_0089"
FT   CDS_pept        107448..107783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0089"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: msu:MS2183
FT                   rhodanese-related sulfurtransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73470"
FT                   /db_xref="GOA:A6VKH3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKH3"
FT                   /protein_id="ABR73470.1"
FT                   /translation="MAFTEITPERAWDMIQTENAVLLDVRDAERFSYSRAQGAFHLTNQ
FT                   SYGEFQDTYDFDHPVIVSCYHGISSRSIAAFLAEQGYDNVYSVIGGFEGWQRAGLPMET
FT                   AYGVKPI"
FT   gene            complement(107762..108100)
FT                   /locus_tag="Asuc_0090"
FT   CDS_pept        complement(107762..108100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73471"
FT                   /db_xref="GOA:A6VKH4"
FT                   /db_xref="InterPro:IPR035333"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKH4"
FT                   /protein_id="ABR73471.1"
FT                   /translation="MFLTIIKKQNTMEKENSGFSLFIWALAGFCSPVLLWPLALLLSPA
FT                   ILENPALSHPVAMASVFWFYPVVFVLTARVLFKMNRRNPAKAKPALLISAVVFWGVLLA
FT                   IGYIGLTP"
FT   sig_peptide     complement(107993..108100)
FT                   /locus_tag="Asuc_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.738 at
FT                   residue 36"
FT   gene            108121..108996
FT                   /locus_tag="Asuc_0091"
FT   CDS_pept        108121..108996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0091"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: pmu:PM1438 Glp
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73472"
FT                   /db_xref="GOA:A6VKH5"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKH5"
FT                   /protein_id="ABR73472.1"
FT                   /translation="MQRLFGTEIHSLAWGFRDYVRARYRVELILRAEADSYGVKILNVY
FT                   LPDNSPHIHLIQQEAERYLANPFAAEYHQASWTDGDIQTVETIAPAFSWLRTLIRWRQI
FT                   KFTVFLTALCIAIYLFEIVGYDQSIMLFAHYPAEFGEERQFWRYFSHTLVHLSPLHILF
FT                   NLCWWWIFAGAIERHLGTFTLITLYCLSGIISGVAQNYASGPAFFGLSGVVYAVMGFVF
FT                   SADKFGKTQGTLLPQGFFSMLVVGILFGFVSPLIGVQMGNAAHISGLITGLICGFLYTK
FT                   TRQSHEIPLK"
FT   gene            109027..109785
FT                   /locus_tag="Asuc_0092"
FT   CDS_pept        109027..109785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0092"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; regulatory protein DeoR; KEGG:
FT                   msu:MS2186 transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73473"
FT                   /db_xref="GOA:A6VKH6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKH6"
FT                   /protein_id="ABR73473.1"
FT                   /translation="MKQSIRHNKIVEFVMQKGYVSTEELVTLLDVSPQTIRRDLNELAE
FT                   NNRIRRHHGGAASPSSSENSDYLDRKQFFSQEKNRIAAEVAKIIPNGASLFIDIGTTPE
FT                   AVANALLNHKNLRVVTNNLNAAHILMQNETFNITIAGGSLRQDGGIIGSATISFISQFR
FT                   LDFGIIGISSIDQDGSLLDYDFHEVQVKRTMIESSRIALLVADHSKFSRTAMVRLGEIN
FT                   EIDYFFTDTLLPVSVQEKLDPAKVNVKICR"
FT   gene            109907..110533
FT                   /pseudo
FT                   /locus_tag="Asuc_0093"
FT   gene            complement(110602..111786)
FT                   /locus_tag="Asuc_0094"
FT   CDS_pept        complement(110602..111786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0094"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: msu:MS2187
FT                   GTPases - translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73474"
FT                   /db_xref="GOA:A6VKH7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKH7"
FT                   /protein_id="ABR73474.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHYGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLTQYDF
FT                   PGDDTPIIRGSALKALEGEAEWEEKILELANALDSYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGDEVEIVGIKDTTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFVSEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNVKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVASVIK"
FT   gene            complement(111891..111966)
FT                   /locus_tag="Asuc_R0009"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(111891..111966)
FT                   /locus_tag="Asuc_R0009"
FT                   /product="tRNA-Thr"
FT   gene            complement(111971..112045)
FT                   /locus_tag="Asuc_R0010"
FT                   /note="tRNA-Gly4"
FT   tRNA            complement(111971..112045)
FT                   /locus_tag="Asuc_R0010"
FT                   /product="tRNA-Gly"
FT   gene            complement(112082..112166)
FT                   /locus_tag="Asuc_R0011"
FT                   /note="tRNA-Tyr1"
FT   tRNA            complement(112082..112166)
FT                   /locus_tag="Asuc_R0011"
FT                   /product="tRNA-Tyr"
FT   gene            complement(112194..112269)
FT                   /locus_tag="Asuc_R0012"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(112194..112269)
FT                   /locus_tag="Asuc_R0012"
FT                   /product="tRNA-Thr"
FT   gene            112470..113423
FT                   /locus_tag="Asuc_0095"
FT   CDS_pept        112470..113423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0095"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: msu:MS2188
FT                   panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73475"
FT                   /db_xref="GOA:A6VKH8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKH8"
FT                   /protein_id="ABR73475.1"
FT                   /translation="MNAKIVNTLNQPPIAGPFLVFNRLQWAELRKSVPLTLTEQDLKPL
FT                   LGINEELSLDEVSTIYLPLVRLINYYIEENLRRQTVLNRFLGGQHPKVPYIISIAGSVA
FT                   VGKSTSARILQSLLANWPQARKVDLITTDGFLYPLADLQEKNLLQKKGFPVSYDTPKLI
FT                   QFLADIKSGKPHVKAPIYSHLTYDIIPNRFNLVNQPDILILEGLNVLQTGNKAKTFVSD
FT                   FVDFSVYVDADEALLREWYIRRFLKFRQSAFNNPHSYFKHYASLSEQDAINTATNIWDT
FT                   INGLNLKQNILPTRERANLILHKGADHAVQEVKLRK"
FT   gene            complement(113571..115682)
FT                   /locus_tag="Asuc_0096"
FT   CDS_pept        complement(113571..115682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0096"
FT                   /product="Non-specific protein-tyrosine kinase"
FT                   /EC_number="2.7.10.2"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   msu:MS1486 uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73476"
FT                   /db_xref="GOA:A6VKH9"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKH9"
FT                   /protein_id="ABR73476.1"
FT                   /translation="MGKKQNDVIDLTKLLSLFWDQKRIIIFSTLLCAGLGLIYSLLAPS
FT                   VYMATASVQVEEKYTGGALQGISSIFEQESTAGTEIAVIKSRAIVSKAVEDLNLTTEVS
FT                   PVYSIPFFSKAIEKLTGEESEITVARFVPKQEVSQEYTLIVGSNENEYVIVDEQEQTVL
FT                   SGVVGEKYDNNNMEIQVTHLKGASGKRFSLKKLEKSDVLELVENLQQAVMANEKGKQTG
FT                   VVELSLKGENPEYIQNVLESITQSYLEHSAARNSAEATSSLAFLEKRLPEVRDRLTKSE
FT                   NALNEYRQKRASIDLELEAKSVLDTLVQLDADLNALTIKESDISQRFTKRHPNYVALLE
FT                   QRKVLLNEKARLTKQLESLPETQKDTVRLTRNFEVDQQIYTQLSNKIQELDVVKAGAAG
FT                   NVRILDQAQTLPKPVAPRKLIILVLTAIIGFLLGSGAVLLKSILQKGVVTVSEISETGL
FT                   VTYASVPFSKKQSALSRAKGGNKAGIGLLSERQTDDFSIESLRSLRTGLNHMLSEANNR
FT                   IVLLSGVSKGVGRHFVSSNLANLLAKANKRVLLIDADLRRSHLHYVLSVENRMGVTELL
FT                   TQDIPFEQGVQNISDHFGVITCGSPTDAPSELLSSARWQQLLDWAAQHYDAVIVTAPSI
FT                   LSVTDAAIVGQHADITLLIGRFEKTTVHEIEACRERFGNAGVTINGFILNGVKPRAVNR
FT                   DDYFSSAYA"
FT   gene            complement(115865..117031)
FT                   /locus_tag="Asuc_0097"
FT   CDS_pept        complement(115865..117031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0097"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   msu:MS1487 periplasmic protein involved in polysaccharide
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73477"
FT                   /db_xref="GOA:A6VKI0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR040716"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI0"
FT                   /protein_id="ABR73477.1"
FT                   /translation="MNKLTKSLFLAGLGLSLSSCSVFLPDSHKSPISKRPAQVVGENVD
FT                   LAKAIDAYLITPQLLKTLKPMNASAQSNLNLDRELSNYQYRVGVGDVLNVTVWDHPELT
FT                   TPAGSYRSSAEAGNQVHANGTMFYPYAGNIKVAGLTVGQIRSRLTKALSNYIAEPQVEV
FT                   NVASFQSQKAYVTGEVKSPGQQFITNVPLTLLDAINKAGGLADNANWHNVTLTRNGRDE
FT                   VISVEALIQRGDLTQNRLLQNGDIVHIPRNDTMKIFVVGEVVQSQLLTIGRNGMTLTEA
FT                   LSASGGIDKLSSDATGIFVIRGQRGKHEMVQDNNGEKIEKVANIYQLDVTNPTAYILGT
FT                   EFYLQPHDVVYVTTAPVSRWNRVISQVVPTISGFNDLTEGVLRIRTWP"
FT   sig_peptide     complement(116966..117031)
FT                   /locus_tag="Asuc_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.659 at
FT                   residue 22"
FT   gene            complement(117052..118977)
FT                   /locus_tag="Asuc_0098"
FT   CDS_pept        complement(117052..118977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0098"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; KEGG: msu:MS1488 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73478"
FT                   /db_xref="GOA:A6VKI1"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI1"
FT                   /protein_id="ABR73478.1"
FT                   /translation="MKSFIASLVIASRWIKLCGLMLLDFMVFPVLLWMCYALRLLDLSA
FT                   EMVPNLYLGEFWISLFAVACLFVCSVYHFVIRTFNETLIVRLFIATIMTVSGLLLLGYF
FT                   TDILIPASVAFMFGFMMFLWVWLSRSAIRLTVRYILNPRVISKRIAIYGAGIGGQQVVQ
FT                   TLLRSDEHLPLFFIDDDKNLRNRRVGGLKIYSAKAALDALEQYEIDEILIALPSISRAR
FT                   KNEIVEFLSQSHRRIMELPSLTKLVDGQINISDIKEVDIVDLLGREPVDPVPELFSKNI
FT                   QGKVVMVTGAGGSIGSELCRQIIRNQPKALLLFEISEYALYAIEQDLKNIIREESLSET
FT                   DILPLLGNVQNKQRLVEIMKAFNVETLYHAAAYKHVPMVEYNVVEGVQNNIFGTYNTAK
FT                   AAIEANVDSFVLISTDKAVRPTNVMGTTKRIAELCLQALAQEQGNAHHTLFSMVRFGNV
FT                   LGSSGSVIPLFKKQIAQGGPITVTDKRIIRYFMTIPEAAQLVIQAGAMAKGGDVFILDM
FT                   GEPVKIVDLARNLIKLSGLTIKDEDNPDGDIEIRFTGLRPGEKLYEELLIGGDNVEQTY
FT                   HERIMTAKEDFLPPDKLKELIARLEDACNRNDCEQVRHLLLNAPTGYHPVSELADFVWN
FT                   KQHSDD"
FT   gene            complement(118992..120173)
FT                   /locus_tag="Asuc_0099"
FT   CDS_pept        complement(118992..120173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0099"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   msu:MS1489 WecE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73479"
FT                   /db_xref="GOA:A6VKI2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI2"
FT                   /protein_id="ABR73479.1"
FT                   /translation="MLNTAFEPWPSFTQEEADAVSRVLLSNRVNYWTGTECREFEKEFA
FT                   AYVGTKYAIALTNGTVALDLALNALGIGAGDDVIVTSRTFLASASSIVTAGANPVFADV
FT                   EPDSQVISRRTIEAVLTPNTKAIICVHLAGWMCDMDPIMDLAKEKGMYVIEDCAQAHGA
FT                   QYKGKSAGSIGHIAAWSFCQDKIMTTGGEGGMVTTNDKDLWNKMWSYKDHGKDFDTVYN
FT                   KQHPPGFRWLHNSFGTNWRMMEMQAVIGRIQLTRMADWTAKRIHNMERILDAFGDSSYF
FT                   SVFRPTRDYVHAAYKCYVQVNPQTLPEGWSRDRIMQVINEQGVPCYSGSCSEVYLEKAF
FT                   DNTPWRPAQRLPNAKLLGETSLMFLVHPTLSEESLDKTCAAITQVIKALSENK"
FT   gene            complement(120207..120851)
FT                   /locus_tag="Asuc_0100"
FT   CDS_pept        complement(120207..120851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0100"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: msu:MS1490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73480"
FT                   /db_xref="GOA:A6VKI3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI3"
FT                   /protein_id="ABR73480.1"
FT                   /translation="MKNKALVLDLDDTLYAEIDFLYSAYHHIAFRLAPEQEEMLFNRLV
FT                   ERYHRGENAFQYLTERYDVDLATLLEWYRFHIPDIHLFPHVEEQLNLFKSDWRFALVTD
FT                   GRSVTQRNKVKALGLEPLLDCMVISEEVGSEKPSLNNYRLVEDALQCKDYIYIGDNPKK
FT                   DFVTPNKLGWKTICLRDRGTNIHKQDFEIPHEFRPHFYMSDWSDLPTILNF"
FT   gene            complement(120841..121806)
FT                   /locus_tag="Asuc_0101"
FT   CDS_pept        complement(120841..121806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0101"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   msu:MS1491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73481"
FT                   /db_xref="GOA:A6VKI4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI4"
FT                   /protein_id="ABR73481.1"
FT                   /translation="MNILITSAGQRVSLVQAFKKELSRLVSGGKVLTVDLNPELAPACY
FT                   VADGHFQVPRVTDANYIPTLLEICAANNVKLIVPTIDTELLILSEHLQRFKEKGITISV
FT                   SDAALIRKCRDKRLTNELFVAQGIAVPKQFKKGQFEYPVFVKPYNGSLSKGIFVAEKEE
FT                   DISPEQLENPELMFMQYISPEEYDEYTVDCYFDKDSVLKSAVPRKRIFVRAGEINKGVT
FT                   KKNAIVTQLSQKLSYLPGARGCLTVQVFYRESDESILGIEINPRFGGGYPLSYLAGANY
FT                   PRWLIQEYLFNQAVPAFDAWEADLLMLRYDAEVLAHHYEK"
FT   gene            complement(121803..122402)
FT                   /locus_tag="Asuc_0102"
FT   CDS_pept        complement(121803..122402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0102"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: msu:MS1492 WcaJ
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73482"
FT                   /db_xref="GOA:A6VKI5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI5"
FT                   /protein_id="ABR73482.1"
FT                   /translation="MIKRLFDIVIASVALILFSPLYLLVAYKVRRNLGSPVLFKQIRPG
FT                   LHGKPFEMIKFRTMKDGVDQNGNILPDAERLTPFGKMLRATSLDELPELWNVLKGDMSL
FT                   VGPRPLLMDYLALYNERQAKRHDVKPGITGYAQVNGRNAISWEQKFELDAWYVEHQSFW
FT                   LDLKIIAKTIQKVIAKDDINAADDATMPKFEGNKKS"
FT   sig_peptide     complement(122325..122402)
FT                   /locus_tag="Asuc_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.451 at
FT                   residue 26"
FT   gene            complement(122399..123685)
FT                   /locus_tag="Asuc_0103"
FT   CDS_pept        complement(122399..123685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0103"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: msu:MS1493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73483"
FT                   /db_xref="GOA:A6VKI6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI6"
FT                   /protein_id="ABR73483.1"
FT                   /translation="MNIRIVSIFKLLLFFALAAVILSPALSNLVGLPRLDSTLSFAFFF
FT                   LSLATLFLRETEKDFLKLILPLYVLFFFVLISLLNSFSSEKAVDSFFFGAVIFLFHYTF
FT                   LAFNRDDGEKGIRYLVLGLSLIVLAGFFIEALLGFQLVSGNEELTVTDKAFKGFFFNTN
FT                   DQAVIMISLAVLVGFFFIIRENGWKVKLTGYALLLIIGLAIVVSASRSVLLSYLIMMML
FT                   ILFLNASVYFKAVYLFFACVIALFVFNLSWLQELFIMLAKIDWLERPIERFSLVIFSMA
FT                   DDKSVGYRTEIYTAFLDNFKILWLGYGPRDYIGYFDQIKLSFPLGYTNPHSFFIEVYLA
FT                   FGIFAFFAFLYFILYSVYYVLTDYLLAWKERIFILFIFVNFCWIVWVPSSVLRLPLVWY
FT                   PLFLVLVYAVLVRNGTFTDPKLVSSRRVS"
FT   sig_peptide     complement(123602..123685)
FT                   /locus_tag="Asuc_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.758 at
FT                   residue 28"
FT   gene            complement(123687..124868)
FT                   /locus_tag="Asuc_0104"
FT   CDS_pept        complement(123687..124868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0104"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: msu:MS1494
FT                   RfaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73484"
FT                   /db_xref="GOA:A6VKI7"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI7"
FT                   /protein_id="ABR73484.1"
FT                   /translation="MQDKKHILIVAPYVTFPHEMGMNRFIYLAKMLSAEFDVTLVTSKY
FT                   CHFLKKHRERTPELGNVKVILLDEPGYRKNVSLQRLISHRRFCRNFETLLKSYDRQIDA
FT                   VYSAYPLIRTNYILGRYKQSKNFKLIIDVQDVWPEAIAGPIAFFSTQIGKMLMKPITQY
FT                   ADKTYSYADALVAVSETYLQRADVNRLPARLKSAVYIGGDFLFTKSNGKKATDKLVATY
FT                   LGTMAGSYDLETVVRAAPLCSKKVKIQFIGTGPHEASLQALNRQLGGHVTFLGVHPYKE
FT                   AMRILADSDVALNAIKASSEGSITNKLSDYICCALPILSCQKHPEVEKLLALGGGIQYT
FT                   AGDHRELAAKLDKLAEDQAVLDKMSQTNLSLAKEKFLRERSYKEIEKLIKNII"
FT   gene            complement(124858..126165)
FT                   /locus_tag="Asuc_0105"
FT   CDS_pept        complement(124858..126165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0105"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: msu:MS1495 RfbX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73485"
FT                   /db_xref="GOA:A6VKI8"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI8"
FT                   /protein_id="ABR73485.1"
FT                   /translation="MVRLISTVFIRQILVGILQVITLIVIARGLGTEQMGQYTLAILLP
FT                   TLFSQIITFGLQSINIYAIGRKMVNENQALYANLFFLSGLSVLTSLILSVVVHYFGRYF
FT                   FNEVPVSLLYLSLASLLPQTFFTVLPSLIQAVQNFKWFNILCVAQPLVIFLVSMVAILL
FT                   SNNVSSILTAYVLSHWISFFILLGIILKLIKVETYSLRRFCSEFIGYGLKSHLSNIITL
FT                   LNYRSSLLILGYFTTPVVVGIYSVGMQLAEKLWLPSQAVSTVLLPRLSNKLGEGSDEKE
FT                   VAKLTLDSARLTFIVTLVIGLAFACLSSVVVNILFGAEYKKSVYVILLLLPGILAWTPS
FT                   RILANDLAARGFAELNLKNSYWVFGINTVLSLCLVPLWGLIGASVATTVAYTMDLVLRL
FT                   MAFNRVTQSQAFLHILPKPSDFGTMVNFIKGLKNAR"
FT   gene            complement(126170..127327)
FT                   /locus_tag="Asuc_0106"
FT   CDS_pept        complement(126170..127327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0106"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: msu:MS1496
FT                   RfaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73486"
FT                   /db_xref="GOA:A6VKI9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKI9"
FT                   /protein_id="ABR73486.1"
FT                   /translation="MHILILPSWYPLHDNDLNGSFFREQAHALANAGVKVGVIAPQFRS
FT                   LRLGKTAVLGRYDQEVWLDGEIPTYFQHGVFWFPRVPYLDLKRWVNAGLALFDRYVKER
FT                   GMPDILHVHSLLHAGPLALEIHKKYRIPYCVTEHSSVFGRELVKDWEWERLKQSEAAAS
FT                   ELLAVSKSLADLLQQKLNGKAWTVFPNLLDDLFTQSSMDSSARKYQLCAVAFLHAKKGF
FT                   DVLIKAFATVVKTYPQLKLVIGGDGPERAKLESLIKTLDLDNNVTLLGALSRKEVCQLM
FT                   RESLCFVLSSYIETFGVVVIEALSQGTPVVSTLCGGPESILTEGDGLFVKPGDEKEMAK
FT                   GILEFLANQDKFDNAQIRQRCIDTYSKKPFVHKLTAVYQDILDKK"
FT   gene            complement(127327..128430)
FT                   /locus_tag="Asuc_0107"
FT   CDS_pept        complement(127327..128430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0107"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: msu:MS1497
FT                   RfaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73487"
FT                   /db_xref="GOA:A6VKJ0"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ0"
FT                   /protein_id="ABR73487.1"
FT                   /translation="MSQAKLRILLVSDMGHIGGTEIATLIAATELNPLAESVTVFGKTG
FT                   PLFEHIDKLGIQQINADCHTKNPLKLLNYVYQLVKTVNDNQIDVIHAQMARPLLFIWLA
FT                   KKFFKNKRVKIFWTSRGLDHETYQKVVPFFVKMGVRGLGNCKLERQKLIRYGYPETQTS
FT                   YIYNAYRLTPTAKPMKSLNKSQFVIGTLSALREGRSVELFLDLAKYCLTYYPERQFRFV
FT                   IGGDGPHRGVLEKIAGDLGLEQQVEFLGNVSDVMTFMDGVDVFVSPLVVDGDSGAGLSN
FT                   SIVEAMIMKVPVCAFRAAGIEEIVINGNTGHLIEARDIPAMAEAVCQTVDNKTETESCV
FT                   NNAYDLIIRECDPKKYAQKLLKLYKEL"
FT   gene            complement(128441..129517)
FT                   /locus_tag="Asuc_0108"
FT   CDS_pept        complement(128441..129517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0108"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   KEGG: msu:MS1498 WecE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73488"
FT                   /db_xref="GOA:A6VKJ1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ1"
FT                   /protein_id="ABR73488.1"
FT                   /translation="MEFIDLKAQQQRIKAQIDAGIQNVLTHGKYILGPEVAELEEKLAA
FT                   YVGAKYCITCANGTDALQIAQMALGIGAGDEVITPGFTYIATAETVALLGAKPVYVDVD
FT                   PKTYNIDPAKLEAAITARTKAIIPVSLYGQCADFDAVNAVAQKYNLPVIEDAAQSFGAS
FT                   YKNRKSCNLTTIACTSFFPSKPLGCYGDGGAIFTNDDELAKVIRQVARHGQDRRYHHIR
FT                   VGVNSRLDTLQAAILLPKLAILDDEIAARQRVAENYTRLFNQAGIHTTPFIEAHNQSAW
FT                   AQYTIQVDNRTDVQEKLKTSGIPTAVHYPIPLNKQPAVADSGVRLPVGDSIAERVMSLP
FT                   MHPYLTPEEQQKIVQSLG"
FT   gene            complement(129531..130106)
FT                   /locus_tag="Asuc_0109"
FT   CDS_pept        complement(129531..130106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0109"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: msu:MS1499 WbbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73489"
FT                   /db_xref="GOA:A6VKJ2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ2"
FT                   /protein_id="ABR73489.1"
FT                   /translation="MNYYQHSSAIVDEGAEIGDGSRVWHFAHVCGGARIGKEVSLGQNV
FT                   FVGNKVRIGDRCKIQNNVSVYDNVYLEEGVFCGPSMVFTNVYNPRSLIERKSEYKDTLV
FT                   KKGATLGANSTIVCGVTVGAYAFIGAGAVINRDVPDYALMVGVPAKQIGWMSEYGEQLD
FT                   LPLSGQAETRCPHTGEVYRLDGNTVKKL"
FT   gene            complement(130315..131265)
FT                   /locus_tag="Asuc_0110"
FT   CDS_pept        complement(130315..131265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0110"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: msu:MS1500 MviM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73490"
FT                   /db_xref="GOA:A6VKJ3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ3"
FT                   /protein_id="ABR73490.1"
FT                   /translation="MKRFALIGAGGYIAPRHLRAIKDTGNTLVVAMDVNDSVGIMDSHF
FT                   PDAEFFTEFEQFEAFVEDQKLKGEKLDYVAICSPNYLHAPHMKFALKNGINVICEKPLV
FT                   LNSTDLDILSEYEQKYGAKVNSILQLRLHPSIIALREKVESAPADKVFDVDLTYLTSRG
FT                   KWYMKSWKAEDQKSGGVATNIGVHFYDMLHFIFGDVVKNEVHYRDEKTVSGYLEYKRAR
FT                   VRWFLSIDANNLPANAVQGEKLTYRSITIENEELEFSGGFTDLHTQSYQRILEGKGYGL
FT                   EENRTAIETVEHIRHADVVANPANPHPFLTKLLQK"
FT   gene            complement(131284..132579)
FT                   /locus_tag="Asuc_0111"
FT   CDS_pept        complement(131284..132579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0111"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: msu:MS1501
FT                   WecC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73491"
FT                   /db_xref="GOA:A6VKJ4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ4"
FT                   /protein_id="ABR73491.1"
FT                   /translation="MNLDSYKVGVVGLGYVGLPLAVEFGKQRETIGFDISPNRVKELAE
FT                   GKDRTLEVSSEALKSATHLSYTSDLERLKRCNFFIVTVPTPIDDVNRPDLTPLQKASES
FT                   IGKVLKKGDIVVYESTVYPGATEEVCVPILERVSGLKFNQDFFAGYSPERINPGDKVNT
FT                   LTKIKKITSGSTPEVADIVDQMYGSIITAGTHKAASIKVAEAAKVIENTQRDLNIALVN
FT                   ELSIIFERVGIDTVDVLEAAGSKWNFLPFRPGLVGGHCIGVDPYYLTHKAEEVGYNPQV
FT                   ILAGRRINDNMAHYVAQTTVKLMLNHNIDVAKAKVGILGVTFKENCPDIRNSKVVDVIH
FT                   ELRNWGADVVVADPWADPAEVKHEYGLDLSVIDENHPVDALIVAVGHKEFRELNPEILR
FT                   TYMNSSNPVLVDVKSLFDRDALSQQGISVFRL"
FT   gene            133361..133912
FT                   /locus_tag="Asuc_0112"
FT   CDS_pept        133361..133912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0112"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase; KEGG: msu:MS2201 N-formylmethionyl-tRNA
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73492"
FT                   /db_xref="GOA:A6VKJ5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ5"
FT                   /protein_id="ABR73492.1"
FT                   /translation="MPDFLTFMERDFMALLNVLIYPDERLKTVAAPVTEFNDELQTFID
FT                   DMFDTMYQEEGIGLAATQVDVHKRVITIDISGEKNEQLVLINPELLDSEGETGIEEGCL
FT                   SLPGFRGFVPRKEKITVKALNRYGEEFTLHADGLLAICIQHEMDHLNGIVFADYLSPLK
FT                   RNRMKEKLVKYQRQLAKQRA"
FT   gene            134391..135344
FT                   /locus_tag="Asuc_0113"
FT   CDS_pept        134391..135344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0113"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: msu:MS2202
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73493"
FT                   /db_xref="GOA:A6VKJ6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKJ6"
FT                   /protein_id="ABR73493.1"
FT                   /translation="MKNLNIIFAGTPDFAAQHLQALLASNHNVIAVYTQPDKPAGRGKK
FT                   LQASPVKQLAQQHNLPVYQPKSLRNEEAQSELAALNADVMVVVAYGLILPKAVLEAPRL
FT                   GCLNVHGSILPRWRGAAPIQRAIWAGDKQTGVTVMQMNEGLDTGDMLHKVYCEITPQET
FT                   SATLYQKLAQLAPSALIEVLDHLEDGSFQPQVQDDSQSCYADKLTKEEAKLDWTLPAAQ
FT                   LERNIRAFNPAPTAFLTLNLNGNEERIKIYQADVLPHQEKAAGTVLACDKKGVQIATAD
FT                   GVLNITRLQPSGKKPMSVQDFLNGRADWFQAGNVLS"
FT   gene            135413..136801
FT                   /locus_tag="Asuc_0114"
FT   CDS_pept        135413..136801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0114"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: msu:MS2203 tRNA and rRNA
FT                   cytosine-C5-methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73494"
FT                   /db_xref="GOA:A6VKJ7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ7"
FT                   /protein_id="ABR73494.1"
FT                   /translation="MTKTSRKTTALSGKNNAPKGLTGKNLSVRAAAAQIILQVLDQGKS
FT                   LSALIPETQLKLKPQDLPLLQEICFGICRVLPRLEWIIRLLMDKPLKGKTRIVHCLLLV
FT                   GLYQILYTRIPQHAAINETVNAAKELKSDNFRGLLNGVLRRFLREQESVLATVDKHWQT
FT                   NHPEWLVNKLKKIYPNWRDIIDANNRKPPMWLRVNRIHGSTENYRQLLAENDMTACTDE
FT                   NPHALRLESPMPVQRLPRFAEGWVTVQDVHAQWSGILLEPQNGELILDACAAPGGKTTH
FT                   ILEQAPQAKVVAVDVEENRLKRITENLARLNQQAIVICGDAARPETWLEQAAQQISGRK
FT                   SAVQFDRILLDAPCSASGVIRRHPDIKWLRQEQDIAPLVDIQYQILTALWATLKPNGVL
FT                   LYATCSVLPEENGRQIARFLAEHTDAQLMPLPFSPPQEIGHQFLPTENGGDGFYYAKLR
FT                   KTAQ"
FT   gene            136957..138969
FT                   /locus_tag="Asuc_0115"
FT   CDS_pept        136957..138969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0115"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   oligopeptide transporter, OPT family; PFAM: Oligopeptide
FT                   transporter OPT superfamily protein; KEGG: hso:HS_0311
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73495"
FT                   /db_xref="GOA:A6VKJ8"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ8"
FT                   /protein_id="ABR73495.1"
FT                   /translation="MNQPTLKELTFRGMLLGALITVVFTASNVYLGLKVGLTFASSIPA
FT                   AVISMAVLKFFKGSNILENNMVQTQASSAGTQSSVIFVLPAMLMMGYWQGFPFWQTLLV
FT                   CMAGGILGVIFTVPLRHVMVVKSDLPYPEGVAAAEILKAGNDDSHNGESESGIKEIAAG
FT                   GLLAAIVGFCTNGLRVIADGASLWFKGGNAVFQVPMGFSFALLGAGYLVGMIGGIAILL
FT                   GIFFAWGVAVPYFTAADPMPADAEMIGYAMNIWKTKVRFIGVGTIGIAAIWTLLILLKP
FT                   MLQGMSQSFRALGDKNLQKSDRTSQDLSPKAMVLITLVSVALIVFAMYNFVHPVSLSAE
FT                   AALLLIAVCTALAVVIGFFVAAACGYMAGLVGSSSSPISGIGIISVVITAIVLMAIGNS
FT                   LGLTAHQDGQRFLTALTIFTGSIVMTTAAISNDNLQDLKTGQLVQATPWRQQVALIIGC
FT                   IVGAFVIAPVLEILFNAYGFSGAMPREGMDATQALSAPQATLMMTIANGIFSHNLEWSY
FT                   IFTGIALGIALIIVDALLKKSSDGRLALPVLAVGMGIYLPPVVNAPIIVGAALAWFINR
FT                   HIENHAERHGKNVHEIKKKADRYGTLFAAGLIVGESLIGVLLAFIIAGSVTSGGSDAPL
FT                   ALALNDWDTVGQVLGLIVFVAGIGIYALRVLRAKR"
FT   sig_peptide     136957..137052
FT                   /locus_tag="Asuc_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.666) with cleavage site probability 0.329 at
FT                   residue 32"
FT   gene            complement(139095..140891)
FT                   /locus_tag="Asuc_0116"
FT   CDS_pept        complement(139095..140891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0116"
FT                   /product="kmt1"
FT                   /note="KEGG: pmu:PM1361 kmt1"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73496"
FT                   /db_xref="GOA:A6VKJ9"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKJ9"
FT                   /protein_id="ABR73496.1"
FT                   /translation="MMKRNSFRAIVFLIFSFVGAYFAHQIERDFGRIDVYTVSFITEEN
FT                   HPMVAKLYRPISAIKDTPKPGLLALHGYQSDKEATNTFGALELAKRGFVVLAIDHFGHG
FT                   YSTALPAANKNMSGANNGYQYLKSLPFVDKERLGIFGHSTGALNAIGVAKLNPDHKAVN
FT                   GQSSNGGDPSLHNYLVTQGLYEEIGGYREKSFPVKELVKNEARLKAFNLPINGQLQWNH
FT                   TYGDFADGSARRAALVNGTHLGVMIAEQTNKEAILWFNQTLQNGVQDADWIDPDRQTYW
FT                   YKEFAGLFALFSALVSALFLANGLLRNSYFCAVTQTPSKLTALSQGKWWAFALVNVVMT
FT                   MILYPLFTQWGGANEPIASIIPFMPLEMGNGIILWLVVSAMINYLFFLLWKRNTKVSLR
FT                   EFGVLTNNQGVTTPQIVIRHFILAVILIIYLYGITSFVHTFWGVELRFLWPLLKPLTAE
FT                   RFMLFPVYWLLILLFFFSFNGLIATVQMRMKQAESFAITLLSWTVKTNFFAVSGLILLW
FT                   LFHFVPDFMQIGPGFDIVGLPQFGGRWMMMLAVIIPQFIVFIFLNHWCYLKTGYVYLGV
FT                   FLTSMLMAWIIVGGQVIGRFLG"
FT   sig_peptide     complement(140820..140891)
FT                   /locus_tag="Asuc_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.796 at
FT                   residue 24"
FT   gene            complement(140919..141605)
FT                   /locus_tag="Asuc_0117"
FT   CDS_pept        complement(140919..141605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0117"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: hin:HI1016
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73497"
FT                   /db_xref="GOA:A6VKK0"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK0"
FT                   /protein_id="ABR73497.1"
FT                   /translation="MFIYLSHKLDPNDLAWPGEPMVEVVRCTDVSEETPFSSFITKLPN
FT                   HCGTHMDAPRHFVKEGLSINELAMEYFCHKDIALLDIPKGEAEGITREDLESYADILAK
FT                   VSFAFLRTGFEKYRTENPLIYQNEGPYIAVTAGQYLSDNFPNLKGVGIDFLSIGSPSSR
FT                   IPDTENPKNCHQAILGYHTGRFTTVIEDMHLAELPKGAKIKQFINAPLRITGLDSSQVT
FT                   CIVELE"
FT   gene            complement(141617..142957)
FT                   /locus_tag="Asuc_0118"
FT   CDS_pept        complement(141617..142957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0118"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   pmu:PM1358 hypothetical T. maritima"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73498"
FT                   /db_xref="GOA:A6VKK1"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041172"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK1"
FT                   /protein_id="ABR73498.1"
FT                   /translation="MLKKSLVLLSLFGTLPVHAEDVPMQAQFVQTTLLAEITAQGQKIN
FT                   AVALEYEDNVLSGSDLRKTFQISTALEGKEPQPRTILRAYVNDKPEISSQAKTGKFVII
FT                   ELDDQDKNADLYSLKVENDQPMKFRGKDKDGNIVDVEKKQINRVPQYYGEKLVYHIEQT
FT                   GYLKLTNGKTLAKAQLTQSAVAGKVKTLWLDEFTAKSVFLTDKANFLNYRIFTPHFEQG
FT                   KAYPLTIFLHGSGQVGSDNLAHLLSGKGAISTLQYERGIVLAPQYQSVFDPFDDSAKGQ
FT                   NGGIHWQTDNRRDLVFNMIDDTLAQYPQIDKNRIYLVGLSRGAEGALKLLLSRPHFFAG
FT                   ALLMSGREAFTHEWIDGNATKENISPIKDIPMWFFHSKEDKISPVTGSRINVDLLKTLN
FT                   APHVKYTEFTTEQAGDNGITNSNAHNTWDAVFNSPEVMQWLLQQKRQ"
FT   sig_peptide     complement(142898..142957)
FT                   /locus_tag="Asuc_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(143015..144367)
FT                   /locus_tag="Asuc_0119"
FT   CDS_pept        complement(143015..144367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0119"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: msu:MS1977
FT                   H+/gluconate symporter and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73499"
FT                   /db_xref="GOA:A6VKK2"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK2"
FT                   /protein_id="ABR73499.1"
FT                   /translation="MSNGSLILIGIVSVVALLTLMIRGKVHPFLALGAVSIAVALSAGI
FT                   PMGEVIPTLVKGMGGTLGGVALIVGLGAMLGKIIEKSNGADVLAGWLLDKFGSKRAPFA
FT                   LAMTGFIFGIPVFVDVGFIVLIPIIFSVARRLGGNMLVYALPIGLSMLTVHVLMPPHPG
FT                   VVAGAQVLNADIGLVLGLGFIAALPAVLLGQNFIPLFTKNNFVNIPASSDLLEYQKLRS
FT                   QKENGLPSFGTVLTMIVFPLVLIMLGTVTATTLPKESVIRSFFSMVGASPFALMLAVCL
FT                   SSYVLGIKRGWSKEQLEEILNSALAPIAGIILITGAGGMFGKVLDASGVGKALADVLSG
FT                   TGLPVILLAFILAALLRAAQGSATVAVITTATILAPMITVSGYTDVQAALVTAAIGAGS
FT                   MTLSHVNDSLFWVWTKFFGISISQGLKTWSILTTIYGTIAFLIVSLMWMFV"
FT   gene            complement(144529..145305)
FT                   /locus_tag="Asuc_0120"
FT   CDS_pept        complement(144529..145305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0120"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: msu:MS1978 Hfi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73500"
FT                   /db_xref="GOA:A6VKK3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK3"
FT                   /protein_id="ABR73500.1"
FT                   /translation="MPKFAANLTMMFKEVPFLDRFEAAARAGFKYVEYLWPYDYPAEEL
FT                   KAKLDQYGLKQVLFNSLPGDIAAGEWGVSAIPGREEESHRHIDLALEYALVLKCPTVLI
FT                   MGGVVPPGQNRAKYKQTFIDNLRYASEKFKAHGINIVLESLSPQVKENYLMRTQDDALE
FT                   IIDLVDRDNVFLQLDYYHAQNVEGNLARLTDRVKNVLYHVQIASVPDRHEPDEGEINYP
FT                   FIFNKLDEIGYQGYVGCEYNPRGDTAAGLNWFQAYK"
FT   gene            complement(145308..145940)
FT                   /locus_tag="Asuc_0121"
FT   CDS_pept        complement(145308..145940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0121"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: msu:MS1979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73501"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK4"
FT                   /protein_id="ABR73501.1"
FT                   /translation="MTDLEQKALMVRLGRSFYERGYTVGGAGNLSVRLDDNRVLVTPTG
FT                   SSLGRLTAECLSVLDMDGNVLEGNKPSKESVFHLAMYRKNPACKAIVHLHSTYLTALSC
FT                   LEGLDPNNAMRAFTPYYVMRAGKMQVIPYYRPGSPKIAEALSERALTGKAFLLANHGVV
FT                   VTGADLLDAADNTEELEETAKLFFILQGQKIRYLTDEEVKDLENRGK"
FT   gene            complement(145937..147181)
FT                   /locus_tag="Asuc_0122"
FT   CDS_pept        complement(145937..147181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0122"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   hin:HI1011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73502"
FT                   /db_xref="GOA:A6VKK5"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKK5"
FT                   /protein_id="ABR73502.1"
FT                   /translation="MMLGVIADDFTGASDIASFLVENGLSAVQMNGVPKQPLNSRVDAI
FT                   VISLKSRSNPANEAVEQSLNAYNWLQENGCTQFYFKYCSTFDSTAKGNIGPVTDALLEA
FT                   LNEDFTVITPALPVNGRTIFNGYLFVGEQLLSESGMKNHPITPMTDANLMRLMDAQAKG
FT                   KTGLVAYADVIQGAARVKERFAELKAQGYRYAVVDAADNSQLEVLAEAVAGLKLVTGGS
FT                   GLGAYIAARLSGGKKGTNAFTPTKGKTVVLSGSCSVMTNKQVEKYCEKAPHFQLDAAQA
FT                   INNPNYAEELYQWVTANLDAPLAPMVYATVPPEALKAIQNEFGADKASHAIENTFAQLA
FT                   AKLKRYGVTNFINAGGETSSIVVQQLGFSGFHIGKQIAPGVPWLKAVEEDIYLALKSGN
FT                   FGKEDFFEYAQGMFV"
FT   gene            complement(147181..148083)
FT                   /locus_tag="Asuc_0123"
FT   CDS_pept        complement(147181..148083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0123"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: hin:HI1010 3-hydroxyisobutyrate
FT                   dehydrogenase,putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73503"
FT                   /db_xref="GOA:A6VKK6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK6"
FT                   /protein_id="ABR73503.1"
FT                   /translation="MNKSYSVAVIGLGSMGMGAAMSCVNAGLTTYGIDLNPAALEKLQA
FT                   AGAKAVATDGHDFAQELDAVVVLVVNAAQADSALFGENGIAKKLKAGTAVMVSSTMAAS
FT                   DAKAISQKLTELGLVMLDAPVSGGAAKALKGEMTVMASGPKQAFDKLQPVLDATAAKVY
FT                   NIGEEIGLGATVKIVHQLLAGVHIAAGAEAMALASKAGIPLDVMYDVVTNAAGNSWMFE
FT                   NRMKHVVDGDYTPLSMVDIFVKDLGLVNDTAKSLHFPLHLASTAYSMFTEASNAGYGKE
FT                   DDSAVIKIFSGVNLPKKGA"
FT   sig_peptide     complement(148003..148083)
FT                   /locus_tag="Asuc_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.666 at
FT                   residue 27"
FT   gene            148268..149026
FT                   /locus_tag="Asuc_0124"
FT   CDS_pept        148268..149026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0124"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; regulatory protein DeoR; KEGG:
FT                   pmu:PM1367 glycerol-3 phosphate regulon, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73504"
FT                   /db_xref="GOA:A6VKK7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK7"
FT                   /protein_id="ABR73504.1"
FT                   /translation="MIPVERLRIELELIRKHGVISISALMEKLNVSHMTIRRDIQKLES
FT                   EGKVISVSGGVQLLERLTVELPHDDKSRLSHEQKEKIGKAAANLIPENCVVYLDAGTTT
FT                   LEIAKYITEREDLLLVTNDFVIANYLMVNGKCRLIHIGGTVNKANRSSVGELAAQALRQ
FT                   LSIDLAFISTSSWNLAGLTTPDEDKISVKRAIIQASRRKVLVSDSSKYGKVATFSLFPL
FT                   TTFNRIICDKGLVINAQEKIHKMDVELSLV"
FT   gene            149169..151145
FT                   /locus_tag="Asuc_0125"
FT   CDS_pept        149169..151145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0125"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /note="TIGRFAM: 2',3'-cyclic-nucleotide
FT                   2'-phosphodiesterase; PFAM: metallophosphoesterase;
FT                   5'-Nucleotidase domain protein; KEGG: msu:MS0064
FT                   5'-nucleotidase/2', 3'-cyclic phosphodiesterase and related
FT                   esterases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73505"
FT                   /db_xref="GOA:A6VKK8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK8"
FT                   /protein_id="ABR73505.1"
FT                   /translation="MDRRKFIQLGAGAFLVLGTDRYGWAAAGNNRQVELRIIATTDVHC
FT                   FLTNFDYYRDAPTDRFGFTRAATLIEQARREVTNSILVDNGDLIQGNPIADYQAAEGAK
FT                   QGKPHPAILVNNEMRYNVGTLGNHEFNYGLEYLNRVIKQAQYPTINSNIVRKGTDEPMF
FT                   QPYAVQEKEVLDQAGNRQKIRIGYLGFVPPQIMLWDKANLAGKVQVRDIVRTARKYIPI
FT                   LKKNGADIIVALAHTGPFDGPYRAGMENAAFHLATVKGIDAIVFGHSHGLFPSKEFEKS
FT                   PHVDIAKGTIRNIPAGMAGYWANHISVIDLTLAKRRGKWTVVNGSSALRPIYDEQTKTP
FT                   TVKNHPKITALLQPVHEATLRFVSQPIGRSSDNMYSYLALVQDDPTIQIVNRAQKAYAE
FT                   KIMKNLPKLAKLPVLSASAPFKVGGRKNDPLGFTEVSKGHLTFRNASDLYLYPNMLVVV
FT                   KVTGAELKEWLECSAGMFNQIDAASEETQYLLNWDGFRTYNYDVIDGVEYQFDITRPAR
FT                   YDGECNLINPNSHRVVELKFKGKPVNPKANFLIVTNNYRAYGNKFPGTGDDHIVFASPN
FT                   ENRQVVADYISSESKAKGEVSPKVDKNWRIAPIRSDGKLDIRFETSPTDKAMEFIQTNA
FT                   RHPMTFVGIDEIGFAVYQIDLSR"
FT   gene            complement(151333..152091)
FT                   /locus_tag="Asuc_0126"
FT   CDS_pept        complement(151333..152091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0126"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; regulatory protein
FT                   DeoR; KEGG: hso:HS_0922 transcriptional regulator, DeoR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73506"
FT                   /db_xref="GOA:A6VKK9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKK9"
FT                   /protein_id="ABR73506.1"
FT                   /translation="MILQERQETIMRYLKSHNMATVEQLVKVTHSSPATIRRDLIKLDQ
FT                   QGSIIRTHGGVALNQFIPFQPTTNEKQYRQIVEKEHIAEYASSLIKAGDSVVLDAGTTT
FT                   LCIAKRITHLPLRVITTDLHISLLLSEYKQIEVIMTGGRIDTSSQSCIGAQSLAFLQTI
FT                   NPDFAFVSCNSWSWEKGITAPTEEKAALKKSLLQNAVNRILVADSSKYGKYSLFCATNL
FT                   TDLTRIITDSNLDAEIQQQLSDKRFELAIV"
FT   gene            complement(152249..152701)
FT                   /locus_tag="Asuc_0127"
FT   CDS_pept        complement(152249..152701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0127"
FT                   /product="PTS system, glucose subfamily, IIA subunit"
FT                   /note="TIGRFAM: PTS system, glucose subfamily, IIA subunit;
FT                   PFAM: sugar-specific permease EIIA 1 domain; KEGG:
FT                   msu:MS1408 NagE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73507"
FT                   /db_xref="GOA:A6VKL0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL0"
FT                   /protein_id="ABR73507.1"
FT                   /translation="MSTDFIIPMSGKLVSLEQVPDETFCQKKLGDGFAVILQGEVVVSP
FT                   ISGVVIAAFPTGHAFIIRREDGLEVLIHIGLNSAAKSEAFRMQIEKYQEIERGDVLVYI
FT                   DRQKLGDTEADLVSPIVFANPGIRINLLKSEQDVLVGDPDAVSVSL"
FT   gene            complement(152713..154068)
FT                   /locus_tag="Asuc_0128"
FT   CDS_pept        complement(152713..154068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0128"
FT                   /product="sugar (Glycoside-Pentoside-Hexuronide)
FT                   transporter"
FT                   /note="TIGRFAM: sugar (Glycoside-Pentoside-Hexuronide)
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   KEGG: msu:MS1409 MelB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73508"
FT                   /db_xref="GOA:A6VKL1"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL1"
FT                   /protein_id="ABR73508.1"
FT                   /translation="MNRQNKWLKRIGYGFGDFGCNLVFSTMASYLMFFYTDVFGIEAAV
FT                   VGTMMLSTRLLDAVTDVLMGLVVDRTHTRWGSGRPYFVIGAIPFAIFTTLTFYVPDFGT
FT                   AGKIIWAYCTYIMLSLAYTVVNIPLNTIVPRLTSDINERNILVASRMICALLGTTVVMG
FT                   ITQPLVDFFGGGDYKQGYFITMTVYGVLAMLIFFFTFTQTEEVVPPTVVRSEKSSVWDD
FT                   FRGLTSQSWILVLVNFFYFGLFVVRNTSVIYYFTYNLNSTGWLTFVGFFGILSGLPILL
FT                   LLPRLQKIFPQRTLIIACCALYLVGDAIAYIGKDSLFLQLTSLAVTGLGMYGIFGVTFA
FT                   IQPDVIDYSEYEKNRSIPGMIASMQGFFVKFGMGVAGLSIGWILEAGGYQPNVAQTDSA
FT                   LFSIEVCYIWIPVIICLSIVALMSFYKLDGLRSEMSRVLDLRRKQMEYADKF"
FT   gene            complement(154164..155762)
FT                   /locus_tag="Asuc_0129"
FT   CDS_pept        complement(154164..155762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0129"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: msu:MS1411
FT                   XylB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73509"
FT                   /db_xref="GOA:A6VKL2"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL2"
FT                   /protein_id="ABR73509.1"
FT                   /translation="MNADAKVTVQNGQAYLGIELGSTRIKSVLIDEQGNILAKGSFEWE
FT                   NHFTDGIWTYPLDEVWAGIAQSYQDMSNAVKSKYGIRLTRLAAIGISAMMHGYLPFDAQ
FT                   DNQLAEFRTWRNNTTAVAADELTERLQYNIPQRWSVAHLYQAVLNQEEHVKNIAYITTL
FT                   AGYVHWQLTGEKVLGVGDASGMFPIDSGIKNYDENMVNIFNELVADRNFNWTLNQILPK
FT                   VLVAGEPAGVLSEKGAKLLDPAGYLQAGCPLCPPEGDAGTGMMATNSIKVKTGNVSAGT
FT                   SAFAMVVLEKPLSKVYRDLDMVTTPDGEPVAMAHSQNCSSDLNAWFHLFSEVLRTFRAD
FT                   ITTDHLYDSLFTKALEASPDGGGLLSYCFYSGEHGVDLLTGCPLFLHSAKSEFNLANFI
FT                   LVQLYTAFGAMKLGMDTLTKQEKVKVEKIFAHGGLFKSKGVAQHVLASALDVPVAVLDT
FT                   AGEGGAWGIALLAAYTRQADRPLADFLEQTVFAGAVDNVLAPDPVWVGGYEKFIQRYKD
FT                   GLSVEREAAKFANPV"
FT   gene            complement(155843..156622)
FT                   /locus_tag="Asuc_0130"
FT   CDS_pept        complement(155843..156622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0130"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: msu:MS1412 FabG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73510"
FT                   /db_xref="GOA:A6VKL3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL3"
FT                   /protein_id="ABR73510.1"
FT                   /translation="MGILEKMKLNGKTAFVTGGARGIGKSVATAFAEAGANIAIADFDI
FT                   AEAEKTAAEIAQATGVKAIAVKTDVTQPESVNQLIDTVKKEFGKLDIAFCNAGICLNVP
FT                   AAEMSYEQWLKVINVNLNGVFLTAQAAGKLMIEQGSGGSIINTASMSAHIVNVPQPQCA
FT                   YNASKAGVIQLTKSLAIEWAQHNIRVNSLSPGYIGTELTLNSKELQPLIKTWNDMAPLH
FT                   RLGKPEELQAICVYLAGDTSSFTTGSDFIVDGAFTCF"
FT   gene            156799..157917
FT                   /locus_tag="Asuc_0131"
FT   CDS_pept        156799..157917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0131"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: msu:MS1413 NagC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73511"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL4"
FT                   /protein_id="ABR73511.1"
FT                   /translation="MSRVTAQDVKQSNYLNIYRLFFHHELLSKPQIARLLKLSLPTVVN
FT                   NVSALEAEGKIQENGMCAPQGGRPATAYRLVDDAAVSIGVEIQSKSIKCAVINLKGDIS
FT                   TVNYFMVNFENSLNYIQSLCHTINGFIADQGYNDSRILGVGISFQGIANKDGQTILYGK
FT                   ILPYDHLSVATLQPYFAYPVILLHDVKCAANAELWHAKQHIHNAVYISVSEHLGGALIL
FT                   NNQIDQGKQGYSGALEHFRINDNGNPCYCGQIGCLETYCSLTALLQSGESLEHFFLKLR
FT                   TDDQPTYARWLRFLTYFAKALNYVYLLLERDIILGGEIAPYLRDEDLSLLSRLVENHAP
FT                   FPLSGQFIRIAALQQNAALIGAGLPFIRKYIP"
FT   gene            158130..160565
FT                   /locus_tag="Asuc_0132"
FT   CDS_pept        158130..160565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0132"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: msu:MS2249 DNA gyrase (topoisomerase II) B
FT                   subunit; TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase
FT                   subunit B domain protein; ATP-binding region ATPase domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; SMART: DNA topoisomerase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73512"
FT                   /db_xref="GOA:A6VKL5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL5"
FT                   /protein_id="ABR73512.1"
FT                   /translation="MSENTAENYGAGSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVF
FT                   EVVDNAIDEALAGYCKDIIVTIHEDNSISVQDDGRGIPVDIHPEEGVSAAEVIMTVLHA
FT                   GGKFDDNSYKVSGGLHGVGVSVVNALSDKLQLTIRRQGHVHEQFYHLGEPQAPLKIIGD
FT                   SEKTGTTVHFWPSSAIFTKTVFEYDILKKRLRELSFLNSGVSIKLFDERDGKNDHFHYE
FT                   GGIQAFVEFLNQNKTPIHQKPFYFTMEKEGIGVEVALQWNDSYNENIYCFTNNIPQRDG
FT                   GTHLAGFRGALTRTLNAYMDKSGLNKKGKSDKDKVDTSGDDAREGLVAVISVKVPDPKF
FT                   SSQTKDKLVSSEVKGAVESAMNERLQEYLEENPNDAKIIATKIVEAARAREAARKAREM
FT                   TRRKGVLDIAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKI
FT                   LNVEKARFDKMLSSQEVGTLITALGCGIGRDEYNPEKLRYHKIIIMTDADVDGSHIRTL
FT                   LLTFFYRQMPELIERGYVYIAQPPLYKVKKGKQEQYLKDDESMTQYELAIALEDAALYV
FT                   NENAPAMNGLMLENLVSEFNGVQQMIARLHRRYPEILLKSLIYYPELTTSILEDQSAVE
FT                   NWANSLVKILEEQDTDSNHYRIRTQFNGERNMYDIVLTVRAHGIDTNYLLDFNFAHSNE
FT                   YARVVNLGKKIDGLLEDTAYIQRGETKKPISGFEEGINWLVAQSRRGLTVQRYKGLGEM
FT                   NPEQLWETTMDPEARHMLQVTIKDAVEADQLFTTLMGDEVEPRRDFIETNALRANLDI"
FT   gene            complement(160885..161760)
FT                   /locus_tag="Asuc_0133"
FT   CDS_pept        complement(160885..161760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0133"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: lpp:lpp2473
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73513"
FT                   /db_xref="GOA:A6VKL6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL6"
FT                   /protein_id="ABR73513.1"
FT                   /translation="MKFKTVLACALLMSSFAFAQEPVRYFGQSEQGYRASQPYGVNEKA
FT                   GHYAQSADAEIWYEIYGKGEPVVVLHGGMVGSVAEMGEFIDELAKTKQVIAISTRGHGK
FT                   SFAGGNQSYPQKAEDVLAVLNAAKVQGKVSLLGFSDGGYTALFFGANYPERTAKIVAIG
FT                   AGEWKKGFVQGTRNPNMTFQDLEKLDRTFWAQQAGIRPEPAKTADWFDSLNETYNHTGV
FT                   EADVFQKIMAPTLFVVGEKDTNAPLDTVLSAYKMTKNAQLSVIPNANHPVFAENFQAVW
FT                   TAVKPFLDTK"
FT   sig_peptide     complement(161701..161760)
FT                   /locus_tag="Asuc_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(161772..162002)
FT                   /locus_tag="Asuc_0134"
FT   CDS_pept        complement(161772..162002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0134"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   aba:Acid345_2511 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73514"
FT                   /db_xref="GOA:A6VKL7"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL7"
FT                   /protein_id="ABR73514.1"
FT                   /translation="MPHISIKCYPKGLNAQELQRFADDLTAFVSERLHTPEEWITIDYQ
FT                   EMPADEWKEKVYDAEVKPNGKHFLRRPHYEL"
FT   gene            complement(162024..162596)
FT                   /locus_tag="Asuc_0135"
FT   CDS_pept        complement(162024..162596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0135"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; KEGG: llm:llmg_0880 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73515"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL8"
FT                   /protein_id="ABR73515.1"
FT                   /translation="MTTISIFGKGNMGKVLAERFTQAGNQVTTVGRNENAKLGEIVIFA
FT                   VPFAAVDDIINQYRNQLADKIVIDITNPVDFATMDDLVVPPDSSAAAVIAQKLPASAVI
FT                   KAFNTNLAANIGSGKVADLAQTTVLLAGDCEQSKAKVTEVLNGSGLAVKDAGSLKRARE
FT                   LEALGFLQITLAVREQIGWTGGFALFA"
FT   gene            162712..163590
FT                   /locus_tag="Asuc_0136"
FT   CDS_pept        162712..163590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0136"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pau:PA14_01500 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73516"
FT                   /db_xref="GOA:A6VKL9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKL9"
FT                   /protein_id="ABR73516.1"
FT                   /translation="MENTKRLLIFNEVIKKGSMSRAAESLGMTASAVSQHLQNLEAYYG
FT                   LKLLNRNTRRLELTESGRILWQQASKLADVMTETHEKMTALKAKPSGMVRLSLPTGLVR
FT                   TKEIRALLKTVEQNLPDIQLVLLAEDTMAQLQHSTADIAIRAGDISDSPDNVVYRLAEW
FT                   SLCIAASPDYLTRTPINQPADLLTAHWLNHSDFILLNAFEALNLPKCLPEHRTECPNAS
FT                   ASAYYLASEGMGLTFILSGELQVFAENHRLQQVLPNTTLPGKRISAVVANAAQSAKNVA
FT                   VLNILKEVFRN"
FT   gene            complement(163587..164063)
FT                   /locus_tag="Asuc_0137"
FT   CDS_pept        complement(163587..164063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0137"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   hit:NTHI0927 conserved hypothetical tRNA/rRNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73517"
FT                   /db_xref="GOA:A6VKM0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM0"
FT                   /protein_id="ABR73517.1"
FT                   /translation="MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLR
FT                   RSGLDYHEFAEIKRHKTFERFIESEKPKRLFALTTKGGPAHSEVRFESGDFLMFGPETR
FT                   GIPMSILDNMPMERKIRIPMTANSRSMNLSNSVAVAVYEAWRQLGYQGAVNLTR"
FT   gene            complement(164136..164348)
FT                   /locus_tag="Asuc_0138"
FT   CDS_pept        complement(164136..164348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0138"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   pmu:PM1568 hypothetical H. pylori"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73518"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM1"
FT                   /protein_id="ABR73518.1"
FT                   /translation="MFPEFRDLITKLKTEDAHFARLFERHNELDHKVKNIEDHIEMGTP
FT                   SEVEMLKKEKLQLKDAMYAILKKAS"
FT   gene            complement(164456..164860)
FT                   /locus_tag="Asuc_0139"
FT   CDS_pept        complement(164456..164860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0139"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: pmu:PM1569 tyrosine phosphatase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73519"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM2"
FT                   /protein_id="ABR73519.1"
FT                   /translation="MRHKAKLAGLSDFIETDSAGTSGWHDGKDMHCGTADMLDLHKIGS
FT                   TGFVSRKADVADWEHFDYIVAMDHQNLRDLQALFGKKSDKLFGIAELVPELQYDHIPDP
FT                   WYTHNFQETYQLLDVCCDALLAKIRREHKL"
FT   gene            complement(165022..166071)
FT                   /locus_tag="Asuc_0140"
FT   CDS_pept        complement(165022..166071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0140"
FT                   /product="L-asparaginase, type II"
FT                   /note="TIGRFAM: L-asparaginase, type II; PFAM:
FT                   Asparaginase/glutaminase; KEGG: hin:HI0745 L-asparaginase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73520"
FT                   /db_xref="GOA:A6VKM3"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM3"
FT                   /protein_id="ABR73520.1"
FT                   /translation="MQMKQLTLATLLAFSAFSASAADLPNLTVLATGGTIAGSGESEVS
FT                   SAYQAGQLNIDTLLNAVPEIKSLANVKGEQVVKIGSQDMSDDIWLKLARTINGQCGGTD
FT                   GFVITHGTDTMEETAYFLDMTVKCEKPVVMVGAMRPATEKSADGPLNLYNAVVVAKDKK
FT                   SSGRGVLVAMNDEVLGARDVTKTSTTSVQTFRSPNFGTLGYVHNSKVDYERSPESKHTI
FT                   DTPFNVDHLEKLPKVGIVYAYANMPTEPLKALLDAGYEGIVVAGVGNGNMNKANLDLLA
FT                   EAAKNGVTVVRSSRVPTGYTTRDAEVDDSQYGFIASGTLNPQKARVLLQLALTRTKDAV
FT                   QIQQYFEDF"
FT   sig_peptide     complement(166006..166071)
FT                   /locus_tag="Asuc_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(166106..167533)
FT                   /locus_tag="Asuc_0141"
FT   CDS_pept        complement(166106..167533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0141"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: hdu:HD0564 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73521"
FT                   /db_xref="GOA:A6VKM4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM4"
FT                   /protein_id="ABR73521.1"
FT                   /translation="MKNVRVEVDLLGEREVSNDVYWGIHTLRAVENFNISDHCISDVPE
FT                   FVRGMVMVKKATAMANGELGAIPKKVSKAIVQACDEILLNGRCMDQFPSDVYQGGAGTS
FT                   VNMNTNEVVANLALEILGHQKGEYDIIDPMDHVNASQSTNDAYPTGFRIAVYNSIMHLI
FT                   EKIEYLQQGFDKKAEEFANVLKMGRTQLQDAVPMTVGQEFKAFAILLEEEAKNLKDTAE
FT                   LLLEVNLGATAIGTGLNTPEGYRELAVKCLSEVTGLPCVGSENLIEATSDCGSYVMVHG
FT                   ALKRSAVKISKVCNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCF
FT                   KVIGNDTTVTFAAEAGQLQLNVMEPVIGQAMFESIDILANACVNLRDKCIDGITVNKEI
FT                   CENYVFNSIGIVTYLNPFIGHHNGDIVGKICAQTGRSVRDVVLEKGLLTEAQLDDILSV
FT                   ENLMKPTYKAARFTDEE"
FT   gene            167817..169139
FT                   /locus_tag="Asuc_0142"
FT   CDS_pept        167817..169139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0142"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; KEGG: msu:MS2216 anaerobic C4-dicarboxylate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73522"
FT                   /db_xref="GOA:A6VKM5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM5"
FT                   /protein_id="ABR73522.1"
FT                   /translation="MTAMFIIQFAIVLLCILMGARVGGIGLGVFGGLGLAILSFGFGLK
FT                   PAGLPIDVMFMIMAVVAAAASMQAAGGLDYMIKIATNILRRNPKYITFMAPAVTWTFTV
FT                   LAGTGHVAYSVLPVIAEVSRHNGIRPERPLSMAVIASQFAIVASPIAAAVVAVVAYLEP
FT                   QGITLGNVLSVTIPATVLGLGLACIFVNKMGKELKDDPEYQKRLQDPEYVKSIHADSNP
FT                   EEVEITAGAKVSVSLFLLGALLVVLMGAIPSLRPVFDGKPMGMAHTIEIVMLSIGALII
FT                   FFCKPDGTAITKGSVFHAGMRAVIAIFGIAWLGDTLMQAHMSEVKEMVSELVNTAPWAF
FT                   AFALFALSVLVNSQGATVATLFPLGIGLGIPAPVLIGVFVAVNGYFFIPNYGPIIASID
FT                   FDTTGTTRIGKYIFNHSFMIPGLLSMFFSICLGLLFANLFI"
FT   gene            169242..170132
FT                   /locus_tag="Asuc_0143"
FT   CDS_pept        169242..170132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0143"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   msu:MS0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73523"
FT                   /db_xref="GOA:A6VKM6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM6"
FT                   /protein_id="ABR73523.1"
FT                   /translation="MDIIYQVVHKMKKRTFFLIITLLFGGGTMFLTKNLTLYQTPEVLF
FT                   RHPQGQPFEKEKDKNITRWQCYRNPLAEPVAKREFRLLSWNIHKGADNGWRRDLLNLVQ
FT                   DKQFVFLQEATTLQHIPQTLPRFKTMLHTLAFQFRHQQSGVLNLSDLSAERYCINAQPE
FT                   PWLRLPKVMAAMQFAVENRSLLIVNVHLVNFEWKTTAYQYQLETLKQLVAQHHGAVVLT
FT                   GDFNAWSKNRNAQLQALIRSLGLTAVHFSPDERIKAFGYPLDNIFIRGVTVHSAQSTAL
FT                   RSSDHNPVELHFSLE"
FT   gene            170165..171649
FT                   /locus_tag="Asuc_0144"
FT   CDS_pept        170165..171649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0144"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   par:Psyc_1551 possible phospholipase D,
FT                   transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73524"
FT                   /db_xref="GOA:A6VKM7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM7"
FT                   /protein_id="ABR73524.1"
FT                   /translation="MSFSLTWSEVLLALHFTVVVACAVRVLYRQRNTGSAFAWLVILLA
FT                   FPMVGIIAYLLVGETRIGRRRLARTTEMIRFYQNFASDYLTDEQHFSADKELPESHQGI
FT                   EKMVKKATGLAANQHNRMQLLTSTDDIINAMIADIQQAKLSCLLAFYIIEPEGRIDALL
FT                   QAVLDAAKRGVRCVILADAIGSSRFFRSRWHNKLQTAGVFVEASLPIGLLRTLYTRNDL
FT                   RNHRKILVVDYYIGYTGSFNLIDPRYFKKDSGVGEWVDVMMRCTGAVVLEMAAVLYADI
FT                   AVESEENLQLVQHYLLRYEQTDMERIPAAAGDITAQVIPSAPEQDESIIYETILCAIHA
FT                   ATKRIVITTPYFVPNEPLLIALTTAARRGVDVTLILPEKVDSFMVRYASRAYFPLLLKH
FT                   GIKIAQFKAGLLHAKTLVIDDDFSLFGTVNMDMRSFFLNLEISLAIYNRDMTTQIAALQ
FT                   QQYLADSRYINEMDRLFRQKWWGLVENIVRLVSPLL"
FT   gene            complement(171720..173123)
FT                   /locus_tag="Asuc_0145"
FT   CDS_pept        complement(171720..173123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0145"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="PFAM: Glucuronate isomerase; KEGG: msu:MS0544
FT                   glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73525"
FT                   /db_xref="GOA:A6VKM8"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKM8"
FT                   /protein_id="ABR73525.1"
FT                   /translation="MKQFMDEDFLLSNDVARTLYFDYAKDQPIFDYHCHLPPKEIAENR
FT                   LFKDLTEIWLAGDHYKWRAMRSAGFDENVITGNASAYEKYQAWAKTVPLCIGNPIYHWT
FT                   HLELRRPFGITDTLFGPQSADKIWQECNELLQQPEFSARGIMRRMNVKFSGTTDDPIDS
FT                   LEYHKAIAEDNAFDIEVAPSWRPDKAVKIELDQFNDYLEQLERVSDTDINSFDALKKAL
FT                   LKRLEHFDQHGCKSADHGMEIVRFAPIPDEKELDRILRLRRSNQALTELQINQYSTALL
FT                   VWLGTEYCKRNWAMQMHIGALRNNNTRMFKLLGADAGFDSIADRTFAEPLSRLLDTMDQ
FT                   NDELPKTILYCLNPRDNEMIATMIGNFQTGGVAGKIQFGSGWWFNDQKDGMERQLQQLS
FT                   QLGLLSQFVGMLTDSRSFLSYTRHEYFRRILCEMVGKWVVNGEAPNDMNLLGNMVKNIC
FT                   YNNAKSYFK"
FT   gene            complement(173431..174417)
FT                   /locus_tag="Asuc_0146"
FT   CDS_pept        complement(173431..174417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0146"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: msu:MS0542 DctP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73526"
FT                   /db_xref="GOA:A6VKM9"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKM9"
FT                   /protein_id="ABR73526.1"
FT                   /translation="MFMKKNVLTLAISGLVAATMSLSVSAKTTLKLSHNNDKTHPVHIS
FT                   MQAMADEVKKATDGEVVVRIYPNSQLGNQRESMELIQSGSLDMAKTNASELEAFEPVYG
FT                   AFNVPYLFKDTEHYYKVLKDPEIGGKILDSTKGKGFVGLTYYDAGSRSFYAKKPIKTPA
FT                   DLKGLKVRVQPSPSALEMMKLMGASATPLAFGELYTALQQGVVDAAENNPTALTLMRHG
FT                   EVAKFYSEDEHTIIPDVLLISEKSWAKLTPEQQKIVKDAADNSMMSHKDLWAKATEEEI
FT                   QKAKDTMGVEFVKVEKQPFVDAVKPMHDKALADPVIGPMVQKIDAAR"
FT   sig_peptide     complement(174337..174417)
FT                   /locus_tag="Asuc_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            174656..175147
FT                   /locus_tag="Asuc_0147"
FT   CDS_pept        174656..175147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0147"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: msu:MS0541 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73527"
FT                   /db_xref="GOA:A6VKN0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN0"
FT                   /protein_id="ABR73527.1"
FT                   /translation="MTRLISLLDRILAAFCIVLCAALVVSVVWQVFSRYVLNDPSTVTD
FT                   ELARFLFIWVGLVGAAYGLGKKKHLAIDLLLMKLEKSPKKQAFLQLVINTISIFFIVVI
FT                   MCYGGMKLVLDTIAAGQVSPVLGIQMGLVYLALPVSGFFMLVFLVRDFIADIRQFSGQN
FT                   "
FT   sig_peptide     174656..174739
FT                   /locus_tag="Asuc_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.443 at
FT                   residue 28"
FT   gene            175159..176460
FT                   /locus_tag="Asuc_0148"
FT   CDS_pept        175159..176460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0148"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: msu:MS0540 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73528"
FT                   /db_xref="GOA:A6VKN1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN1"
FT                   /protein_id="ABR73528.1"
FT                   /translation="MEWTTILTLAGSFFFFLAIGVPISFAIGVSSLLTILLALPMESAI
FT                   TVISQKMASGLDSFSLLAIPFFILAGNIMNRGGIALRLIEFAKVLGGRLPGSLAHVNVL
FT                   ANMMFGSISGSAVAAAAAVGGTMAPLQKKEGYDPAFSAAVNITSSPTGLLIPPSNTFIV
FT                   YSLISGGTSIGALFLAGYIPGILMGLGIMSIAYFIAKKNKYPVSPKPTFKEVTHRTLDA
FT                   LPSLGLVVVIIGGIIAGIFTATEASAIAVVYTLILSMIIYKEISLKELPRIILDAMTTT
FT                   SIVLLLIGASMGMSWAMANADIPYTISDALLSVSDNPIVILLIINLTLLIVGTFMDMTP
FT                   ALLIFTPIFLPIVTELGMDPVHFGILMAFNLSIGICTPPVGSTLFVGCSVAGVKIDKVI
FT                   RPLLPFYAMLILTLFLVTFVPQLSLWLPQTLLGY"
FT   sig_peptide     175159..175239
FT                   /locus_tag="Asuc_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.683 at
FT                   residue 27"
FT   gene            176471..178861
FT                   /locus_tag="Asuc_0149"
FT   CDS_pept        176471..178861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0149"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   msu:MS0539 alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73529"
FT                   /db_xref="GOA:A6VKN2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN2"
FT                   /protein_id="ABR73529.1"
FT                   /translation="MKTLKSAQFLRQEGNRVDIQCERDYIMHIFVLEQDVIRVAFTHKN
FT                   AFKLDRTWAIAPNQEDVPFEGRDRISTAGFSLPNYQLNFTNDVIEVATDLLKIRINQPL
FT                   ALEWFYKKEDEWLPLMQERKTGAYQFGVSNDKIAHFIARSLDENCYGLGEKAGDLNRKG
FT                   RRFEMRNLDAMGYNAEKTDPLYKHIPFYITRKNDVSYGIYYDNLAQCWFDLGNELDNYH
FT                   TAYKSYRAEDGDMDYYVILGPSTLDVTKKYTALTGGTIFGPRWGLGYSGSTMSYTDADD
FT                   AQEQLKKFVDLCKQHDIPCDSFQLSSGYTSINGKRYVFNWNYDKIPEPLKMSAHFREAG
FT                   MHLAANIKPCMLQDHPRYKEAETLGLFIKDSETGLPERSVFWDDEGSHLDFTNPATVKW
FT                   WKDNVKEQLLERGIGSTWNDNNEYEIWDEQAKCAGFGKEIPINLIRALHPLLMMRSSYE
FT                   AQKEFAPNERPYLISRSGCAGMNRYVQTWSGDNRTGWNTLRYNIRMGLGMSLSGLYNVG
FT                   HDVGGFAGDKPEPELFVRWVQNGIFHPRFTIHSWNDDKTVNEPWMYPEVTNIIRDTIKL
FT                   RYRLMPYIYNIFWQSHKQLEPMLRPTFLDHENDANTYAETDDYLFGRELLVASVVEKGQ
FT                   RNREVYLPQNHAGWYDFYHHTYYEPGQKINVDAPLERIPLFVKAGTVIPMSERTAYSKP
FT                   EADTARQLAVYPLKQDGELQCSIFDDDGLTYQYQKGEYLQLNITLGSTQDTVYMDIRKQ
FT                   GNWKPAYQALKLTLPANETRTFLVNGNEFRPGTELSLENIREI"
FT   gene            178864..179619
FT                   /locus_tag="Asuc_0150"
FT   CDS_pept        178864..179619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0150"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: msu:MS0538 FadR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73530"
FT                   /db_xref="GOA:A6VKN3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN3"
FT                   /protein_id="ABR73530.1"
FT                   /translation="MAENAELRSYKKIGSILKQELIDGLYQIGERLPPERDLAEKMNVS
FT                   RTVVREAIIMLELENLVEVRKGSGVYVINMPLTSEEHPDESYEDVGPFELLQARQLLES
FT                   GIAEFAAIQATRNDILRLKQILNKERMTLAEDDKDYTADEEFHCAIAEITQNEVLIKLQ
FT                   KELWKYRTNSSMWQGLHAHITDQEYRKFWLQDHENILNGIQRKNPALAKKAMWQHLENV
FT                   KQTLFELSDIEDPNFDGFLFNVNPVVVGL"
FT   gene            179645..180829
FT                   /locus_tag="Asuc_0151"
FT   CDS_pept        179645..180829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0151"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="TIGRFAM: mannonate dehydratase; PFAM: Mannonate
FT                   dehydratase; KEGG: msu:MS0537 D-mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73531"
FT                   /db_xref="GOA:A6VKN4"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN4"
FT                   /protein_id="ABR73531.1"
FT                   /translation="MEQTWRWYGPNDPVSLADIRQAGATGIVNALHHIPNGQVWSIEEI
FT                   EKRKAIIEAAGLTWSVVESVPVHEEIKTQTGDYKTWIENYKQTLRNLAQCGIDTVCYNF
FT                   MPVLDWTRTDLAYELPDGSKALRFDQIAFAAFELHILKRPGAEQAYTEEEQKAAKAYFD
FT                   NMTEADIKQLTANIIAGLPGAEEGYTLEEFQGQLDRYKDISPEKFRTHLAYFLNEVIPV
FT                   AQEVGIKMAVHPDDPPRPILGLPRIVSTIEDMQWYVDTCDLPANGFTMCTGSYGVRADN
FT                   DLVKMTERFGDRIYFAHLRSTCREDNPLTFHEAAHLQGDVDMFNVVKALLTEEYRRKAD
FT                   GDTRLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEFRGLEMGLKKVFFEK"
FT   gene            complement(181006..181644)
FT                   /locus_tag="Asuc_0152"
FT   CDS_pept        complement(181006..181644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0152"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: msu:MS0546
FT                   2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73532"
FT                   /db_xref="GOA:A6VKN5"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN5"
FT                   /protein_id="ABR73532.1"
FT                   /translation="MAYSTEQIIEKLSRLKVVPVIAVDEAKDIIPLVQTLSDNGLPVAE
FT                   ITFRSAAGEEAIRLTRQHFPDVLIAAGTVLTPAQAVAAKNAGADCIVTPGFNPNIVRLC
FT                   QALDLPVTPGVNNPMAIEAALELGVKAVKFFPAEASGGVNMIKALLGPYANLQIMPTGG
FT                   ISPSNIKDYLAVPNVVACGGSWFVDKALIKSQNWDEIGRLVREAVELVS"
FT   gene            complement(181674..182612)
FT                   /locus_tag="Asuc_0153"
FT   CDS_pept        complement(181674..182612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0153"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: msu:MS0545 sugar
FT                   kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73533"
FT                   /db_xref="GOA:A6VKN6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN6"
FT                   /protein_id="ABR73533.1"
FT                   /translation="MKKLALIGECMIELNGEPFGTMRQTYGGDTLNTATYVARVSSPER
FT                   IQVCYVSALGTDKLSQGMIDRWQGDGIQTDWVLRDKNRSAGLYLIQLDKQGERTFLYWR
FT                   NQSAARYLLQHPDYPQVLSALKSADMIYLSGISLAILPENDRTLLIAQLRELKKAGVEI
FT                   AFDSNFRPKLWDSLAQAQACYRALLPLVDVALVTFDDEEMLWSDTDEQATITRLSAFDI
FT                   PKIIVKQGSLGATICENGTQTFVPTIPVENVTDTTSAGDSFNAGFLAGYLQGKPLTVCC
FT                   EQGNRLAGIVIQHKGAIIDPAATEALRAAFN"
FT   gene            complement(182624..184111)
FT                   /locus_tag="Asuc_0154"
FT   CDS_pept        complement(182624..184111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0154"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG: msu:MS0530
FT                   altronate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73534"
FT                   /db_xref="GOA:A6VKN7"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN7"
FT                   /protein_id="ABR73534.1"
FT                   /translation="MKQFIKIQRQDNVAVALQDLSAGTLLDVDGQQIELKSDIGRGHKF
FT                   ALNAIAENQDVIKYGYPIGHALCDIATGEHIHTHNVKTNLKDINDYKYSPESTALSAQM
FT                   PDREVRIYRRKNGGIGIRNELWIVPTVGCVVGIANLIKKRFMQLNDLSDIDGVFTFNHS
FT                   YGCSQLGDDHQNTKTMLQNMVKHPNAGAVLVIGLGCENNQVGAFKESLGEHDENRVKFM
FT                   VSQHYDDEVEQGVELLQQLYQAMRQDRRESGKLSEVKFGLECGGSDGFSGITANPMLGR
FT                   FSDYVISHGGTTVLTEVPEMFGAERILMSHCKDKNIFQKTVDMVNDFKKYFIEHNQPIY
FT                   ENPSPGNKAGGITTLEDKSLGCTQKAGHSQVVDVLKYGERLKVQGLNLLSAPGNDAVAT
FT                   SALAGAGCHMVLFSTGRGTPYGGFVPTMKIATNSELAHKKKHWIDFDAGRLVYDVGMDE
FT                   LLNDFINLVVETVNGKPTKNEINEFRELAIFKSGVTL"
FT   gene            complement(184125..185582)
FT                   /locus_tag="Asuc_0155"
FT   CDS_pept        complement(184125..185582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0155"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: msu:MS0529
FT                   mannitol-1-phosphate/altronate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73535"
FT                   /db_xref="GOA:A6VKN8"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN8"
FT                   /protein_id="ABR73535.1"
FT                   /translation="MKQLNRTNHPGRQYPTKIIQFGEGNFLRAFIDWQIDILNEKTDLN
FT                   AGVTIVRPINTDFPPSLNTQDGLYTTIIRGLDENGNKVKETRIIRSVNNEINIYQSYDE
FT                   YLQLAHNLDIKFIFSNTTEAGISYHSGDKFDDRPQVSYPAKLTRLLYERFTAANGDKDK
FT                   GFILLPCELIDYNGEQLKELVFKYAEEWQLSAAFLEWLEAANTFCSTLVDRIVTGYPRV
FT                   EAAQLEAELGYNDTFLDTAEHFYLFVIQGPQSLAQLLRLDQADLNVLIVDDIKPYKERK
FT                   VAILNGAHTALVPVAYLAGVNTVGEAMNDAELCRFVQHTMDKEIIPVLSLPKDELQQFA
FT                   DAVIKRFQNPFIQHQLLSISLNSMTKYRTRNLPQLITYAEKFGKLPPHLTFALAALIAF
FT                   YRGERDGQAIPLQDDEHWLTNFKTWWQEADAGEISLFQLVHRVLKQAEHWERDLTAIPQ
FT                   LTETVTRQLESILDKGMRQALREYCAD"
FT   gene            complement(185604..186896)
FT                   /locus_tag="Asuc_0156"
FT   CDS_pept        complement(185604..186896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0156"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: C4-dicarboxylate anaerobic carrier; TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   KEGG: msu:MS0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73536"
FT                   /db_xref="GOA:A6VKN9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN9"
FT                   /protein_id="ABR73536.1"
FT                   /translation="MDVIIPISILLFLFVIGTPVAFCIFCSTLIYFLMSNLPMVMLIQR
FT                   LAGGLESVTLLAIPFFIMAGVFMNHTGISERLLKFCEVLTGHMSGGLAQVNVALSTLMG
FT                   GLSGSNIADAAMNSKLLVPQMVARGYSASFSAAVTAAGSLITPIIPPGIAMIIYGYVNN
FT                   VSIGRLFLAGIVPGTLLCIMMMVLVSIISKKRGYLPIREKRASCKEIIVSAKDAVLALL
FT                   LPIIIIGGIRMGIFTPTEAGAVAVIYALILGMFIYRNMDLKKLWLATRESALGAANVLL
FT                   IICVAVAFSKFLTWERVPQTLASWMTTVVDSPITFLMLVNVALLILGMFLEGNAIMIVL
FT                   APLLAPIAHSFGIDPIHFGIVFIFNGAIGTITPPLGTVMFTTCSITEVPIEKFIKDVLP
FT                   FWGLLILELILLTYIPTITTWLPNLVYGVAQ"
FT   gene            complement(186899..187390)
FT                   /locus_tag="Asuc_0157"
FT   CDS_pept        complement(186899..187390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0157"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: msu:MS0527 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73537"
FT                   /db_xref="GOA:A6VKP0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP0"
FT                   /protein_id="ABR73537.1"
FT                   /translation="MSKPTIKKKFWLSDIDEILASFFLALIVLLSGYGVVMRYFLNTPS
FT                   AWVEEICVVFFIWFTFLASSALCKNNELIRIDYLLTKIPNKIANFIDGVIQPLIMIFCL
FT                   GFMIYWGFKLLPMSKMRFTPALQISYVYIYAIIPISALFMLYYELRKIAYYFKLSNKGD
FT                   "
FT   gene            complement(187444..188430)
FT                   /locus_tag="Asuc_0158"
FT   CDS_pept        complement(187444..188430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0158"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: msu:MS0526 DctP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73538"
FT                   /db_xref="GOA:A6VKP1"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:4O8M"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP1"
FT                   /protein_id="ABR73538.1"
FT                   /translation="MKLLSKSIKAILSVGLLGLAINAQAETEIMVAYGNQPGEPIDKAM
FT                   HFWADKVKEKSNGDIVFKLFPSSQLGSETEVLEQAKFGANIITISDYGALMDIVPDLGV
FT                   INAPYISQSFEKKSKLLHSDWFKDLSDKLDQHDIHIIVPDVIYGTRHLLTKKPVTKPSD
FT                   LKGMKVRVQHSRLFLQTINAMGGVPTPMSLSDVYPGLSEGIIDGLENPTVVLFGGKFFE
FT                   VAKNLNLTAHTKHMSPFVAGTAFWNNLTPEQQKIIVDASREMVTYGGGLIEQAENEALE
FT                   NLKKAGVTVNDVDLPAFEASVADVISTGFPEWSPNLYKNVQEKLSQF"
FT   sig_peptide     complement(188353..188430)
FT                   /locus_tag="Asuc_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            complement(188565..189569)
FT                   /locus_tag="Asuc_0159"
FT   CDS_pept        complement(188565..189569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0159"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   msu:MS0525 Tdh protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73539"
FT                   /db_xref="GOA:A6VKP2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP2"
FT                   /protein_id="ABR73539.1"
FT                   /translation="MKSLVCKEPFKLVLEEREKPQPKENEVQLKIAAIGICGTDIHAYA
FT                   GNQPFFEYPRVLGHEASGVITDLGKNVDKFKVGQRVALIPYVSCGKCGACLSGKTNCCE
FT                   KISVIGVHQDGAFSEYLVAPAQNILPVSDNVNDVTAALIEPYAISAHAVRRAQINVGDD
FT                   VLVVGAGPIGLGAAAIAHADGANVVIADTSEERRKHIQANIPVPTLDPINEKVEDYFNG
FT                   RLPEIVIDATGNQRAMNNAVNLIRHGGRIVFVGLHKGSIEFSDPDFHKKETTLMGSRNA
FT                   TLEDFEKVQRLMAEGKIAANMMLTHTFKYDGLADIYEEEITKNKSLIKSVILY"
FT   gene            189717..190628
FT                   /locus_tag="Asuc_0160"
FT   CDS_pept        189717..190628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0160"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; KEGG: msu:MS0524 GntR
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73540"
FT                   /db_xref="GOA:A6VKP3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP3"
FT                   /protein_id="ABR73540.1"
FT                   /translation="MSRDLNLRQDIINRLIDDISSELLESPLPSLSTLAGLYNVSRTTI
FT                   RHAVHYLTEQNILNKTNDKLIVIQKPTEDLKITYIKIKKLENNQLQKLEKYFSYAVQQK
FT                   IIKPGDDFTELELAKKANVDIFTVREYLIQFSRFNLISHITAGKWKLTKLTQHYADKLF
FT                   ELREMLECHALNCFMNLPKDDIRWKKMKFLLQEHRALRDNIIEKYPDFSLLDQQLHSLI
FT                   LSAADNPFINDFINLISVVFHFHYQWDNKDLRTRNILAVEEHLAILVKIVSQDDLGAIT
FT                   ELKRHLRTAKKGLMNSINRMNE"
FT   gene            complement(190677..191186)
FT                   /locus_tag="Asuc_0161"
FT   CDS_pept        complement(190677..191186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0161"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   msu:MS2289 sortase and related acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73541"
FT                   /db_xref="GOA:A6VKP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP4"
FT                   /protein_id="ABR73541.1"
FT                   /translation="MKIRTAKEQDLPQIVAIYNQAIPSRRITADLQPVTEQARRPWFEA
FT                   HLNSSRHPIWVLESAVEKNKILGWCSFSPFYDRAAFDQTVEISVYLDQSAKGRGYGSQA
FT                   IRFLQAQMTALDVHTLMAYVIEENHISRKMFEKLGFRRWGRYPHIANMGDSLQTFLIYG
FT                   YQKTAE"
FT   gene            complement(191189..192874)
FT                   /locus_tag="Asuc_0162"
FT   CDS_pept        complement(191189..192874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0162"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase dimerisation and phosphoacceptor region; KEGG:
FT                   msu:MS2288 sensory transduction histidine kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73542"
FT                   /db_xref="GOA:A6VKP5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP5"
FT                   /protein_id="ABR73542.1"
FT                   /translation="MNVKKSVTTRIARYLITVIIFAGIITTFALGIMVSNRSDAEQINV
FT                   SGSLRYQSYRILYNLKNHPDLLYQDLREYRKSLHSLSLSQIDTQFLAPKELKNAYHDLI
FT                   ADWGKMEKNALVKDVKSYDANLENYVLQVDRFVFALQRFAERKLIITSVVIVVSMLLII
FT                   ALVACITAFVKKQVAAPLQQLTRASVQIQMRNFQHIPLDTNRPDELGDLAKAFTQMSSE
FT                   LSKIYSNLEERIAEKTQKLTQTNRTLSMLYHCSQALSGSDTDNEHLRAVMKNVMLAEHL
FT                   RALELVLIADDTRIMLGEPSESLSWQSADVGADSNRIGELRWQAGLPCPDPRILENIGQ
FT                   MLGRALYFSQTQRQQQQLLLMEERSIIARELHDSLAQVLAYLQIQLTLLKHHLNKDEPN
FT                   AKNKSLAIIRDFEQALTGGYTQLRELLATFRLTVQEANLKLALEQVIDSLRNQTSIHMN
FT                   VTCNLPSHVFNAQQLVHALQIVREAVLNAIKHSKANLIEVIAHTNEDGEQEIIIRDDGV
FT                   GIASLDEPEGHYGLRIMEERSRQLNAKLTIKNRPTGGTEVCILL"
FT   sig_peptide     complement(192752..192874)
FT                   /locus_tag="Asuc_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.757 at
FT                   residue 41"
FT   gene            complement(192989..193555)
FT                   /locus_tag="Asuc_0163"
FT   CDS_pept        complement(192989..193555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0163"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: msu:MS0670
FT                   starvation-inducible DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73543"
FT                   /db_xref="GOA:A6VKP6"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP6"
FT                   /protein_id="ABR73543.1"
FT                   /translation="MSDKMNYPVLTLTEKSKSLTADVNKNAAHTVPGLDVKTGHSIADA
FT                   LQTRLQGLNELQLILKHAHWNVVGPQFIAVHEMLDDQVDEVRDFVDEIAERIAALGVAP
FT                   NGLPGNLVAIRQTPEYPLGRAGAQDHLRILDKYYAHNIESHRFVLEHFGELDPISEDLL
FT                   VAQTRALEKLHWFIRAHLDNGNGNL"
FT   gene            193799..194089
FT                   /locus_tag="Asuc_0164"
FT   CDS_pept        193799..194089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0164"
FT                   /product="conserved hypothetical protein 743"
FT                   /note="PFAM: conserved hypothetical protein 743; KEGG:
FT                   hdu:HD1892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73544"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP7"
FT                   /protein_id="ABR73544.1"
FT                   /translation="MKNDKPVECVGCNTFDVGSILDNSDLKADFDKVYPTRAEAEAALA
FT                   KLTQKARDTETEPCQIQSEINEAEGGFRLKAGFVFSCQAEAVIFQLGTRSV"
FT   gene            194220..195455
FT                   /locus_tag="Asuc_0165"
FT   CDS_pept        194220..195455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0165"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG: nme:NMB0982
FT                   chloride channel protein-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73545"
FT                   /db_xref="GOA:A6VKP8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP8"
FT                   /protein_id="ABR73545.1"
FT                   /translation="MTKLNLRFYLSLVYIGIISGLIGTALTHILHGIQHIAFDYGLNGE
FT                   NMSFREGVLQSSAERRWLALTFCGIVVGIGWYSVHRYGKKLLSVKQGLDNPQQGVPFFK
FT                   TVGHALLQIITVGLGSPLGREVAPREMSVAFGSAWVRKAGLNDTDAKLILACASGAGLT
FT                   AVYNVPLASTIFILETMVLSISTRSLGAALVTVVLSTCVSRFFLGDLVQYDKVTPFAIN
FT                   TELLIFSAIIGMLIPFVVQGFRRSTQHVPFLQRTDKRIIPVAVLLFSLIGFISIYQPEI
FT                   LGNGKPGNQLTFGEMINWSESLQLMALKWLAVLFALAAGAYGGLITPSMMLGSTFAYSL
FT                   AIGWNALFPQLSLEGAAIIGACVFLGIMQKMPFTSIVFLLELTRSNAEVLMPLTLAMGA
FT                   AIATDRLIAKWK"
FT   sig_peptide     194220..194303
FT                   /locus_tag="Asuc_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.646 at
FT                   residue 28"
FT   gene            complement(195576..196991)
FT                   /locus_tag="Asuc_0166"
FT   CDS_pept        complement(195576..196991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0166"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: hit:NTHI1036 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73546"
FT                   /db_xref="GOA:A6VKP9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKP9"
FT                   /protein_id="ABR73546.1"
FT                   /translation="MANAAIERVFKLIEENDVKFVLLRFTNIKGKEHGVSLPVSAVDED
FT                   FFEDGKMFDGSSVEGWKAINKADMLLMPIAETAVVDPFAQIPTLSIRCSIYDPNTMQSY
FT                   DRDPRSIAMRAEEYMRSTGIADHVFFGPEPEFFLFDDVRFSTEMNNVSFKIDDIEAGWN
FT                   TNRKYEDGNNAYRPLVKGGYCAVAPNDTAHDIRSEMCLLMEEMGLVIEAHHHEVATAGQ
FT                   NEIATKFNSLTLKADETQIYKYIVQNVAAEHGKTACFMPKPFAGDNGSGMHCNMSLSKD
FT                   DKNIFQGGKYAGLSETALYYIGGIIKHAKALNAFTNPTTNSYKRLVPGFEAPVLLAYSA
FT                   SNRSASIRIPAVTSPKAIRVEARFPDPAANPYLAFAALLMAGLDGVVNKIHPGDAMDKN
FT                   LYDLPPEELKEIPAVATSLEDALASLETDFEFLTKGGVFTKDFIEAFIDIKRKEVARVN
FT                   MTPHPVEYEMYYA"
FT   gene            197434..199284
FT                   /locus_tag="Asuc_0167"
FT   CDS_pept        197434..199284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0167"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: msu:MS0263 predicted membrane
FT                   GTPase involved in stress response"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73547"
FT                   /db_xref="GOA:A6VKQ0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ0"
FT                   /protein_id="ABR73547.1"
FT                   /translation="MAELDIHKLRNIAIIAHVDHGKTTLVDKLLQQSGTLEAARNGDAD
FT                   ERVMDSNDLEKERGITILAKNTAINWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLV
FT                   VDAFDGPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQ
FT                   LDFPIIYASALNGVAGLEHEELAEDMTPLFEAIVEYVEPPKVELNAPFQMQISQLDYNN
FT                   YVGVIGIGRIKRGTVKPNQSVTIIDSFGKTRNGKIGQVLGHLGLQRYEEDLAQAGDIVA
FT                   ITGLGELNISDTICDINAVEALPALSVDEPTVTMFFCVNTSPFCGQEGKFVTSRQILER
FT                   LNKELVHNVALRVEETPNPDEFRVSGRGELHLSVLIENMRREGYELAVSRPKVIYKEEN
FT                   GHKQEPFEQVTIDIEEQHQGAVMEALGIRKGEVRDMSPDGKGRTRLEYVIPSRGLIGFR
FT                   NEFMTMTSGTGLLYSSFSHYDDIKPGEIGQRQNGVLISNATGKALAYALWGLQERGKLM
FT                   VEHGQEVYEGQIIGIHSRSNDLTVNCLQGKKLTNMRASGKDDAIQLTTPLKLTLEQAIE
FT                   FIDGDELVEVTPQSIRIRKKLLTETDRKRANRTTTSTSTR"
FT   gene            complement(199598..201019)
FT                   /locus_tag="Asuc_0168"
FT   CDS_pept        complement(199598..201019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73548"
FT                   /db_xref="GOA:A6VKQ1"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ1"
FT                   /protein_id="ABR73548.1"
FT                   /translation="MRRKLDKMTLAVLIGNRGFFPSYLVGDARRDAQKIFAELDINTIM
FT                   LTEEQTNYGGIETYSDAKIAAQLLKDHKDEINGIVVLLPNFGDEKAMSEAIRQSGLNVP
FT                   ILVQAEDDELHKMGLATRRDSFCGKISLCNNLRQFGIPFTLTTQHTCALTSDIFKQDLK
FT                   SFEAICRVVTAIRGCRIGAIGARPAGFNTVRYSEKLLERLGITVEPIDLSEIFARVNNL
FT                   TDNDLRIEEKLTLLKNNADASRISEDKLLMMSKLFVVISEWIISNDIDTTAIQCWTSLQ
FT                   NTLGINVCSIMSVMSGQLMPSACEVDVMGALSMYALSIASMKPASIADWNNNFGNDRDK
FT                   CVMFHCGNYATDELINPFMATADIIGTTVGCENTCGAINGRMKAGPLTYCRISTDEFTG
FT                   KVKAYVGEGKFVDDDLDTVGCRAVIQVKGLEDLLAYICNNGFEHHVAMNHSSTAKVLNE
FT                   AFNKYLGVESYYHNK"
FT   gene            complement(201042..202514)
FT                   /locus_tag="Asuc_0169"
FT   CDS_pept        complement(201042..202514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0169"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: yen:YE0824
FT                   glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73549"
FT                   /db_xref="GOA:A6VKQ2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042016"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ2"
FT                   /protein_id="ABR73549.1"
FT                   /translation="MSTPFIIAIDEGTTNAKAIAVSMNGEMLAKGSVPLKLAHPQPSWA
FT                   EQDPMEIWNAVESAVEICVSSLAKEDIKGVAISNQRESVLIWERATGKPLTPLVSWQCR
FT                   RTESLCQEIAQQPAATKLKEMTGSVLDPLFPASKIKWLLSHLENGFERAQRGELCVGTV
FT                   DVWLVWKLTNGKSFVTDHSNASRYQLFNLHTASWDDELLSLFGVPKACLPDIMPSSGLR
FT                   GETENCRSLPNGVPILSQAGDSHAALYGQCGFNDGVVKATYGTGSSLMTKTNVIPTEDF
FT                   GVSTTVAWYDDKLDFALEGNITHTGSALAFAAQILGIDSVNTLSELAQSIDNNQGVYFV
FT                   PALAGLGAPYWDTQARGIICGLTDAVTPATIARAAMESVAYQVADLFFAMEKTLGKKLE
FT                   TLSVDGGPTKNKWLMQFQADLLQRPIICGEIAEVSAFGAAFLAGKALGWWKNDKQLNAL
FT                   PRKVEIIQPNPATEVMKNNYGAWQSAVKKARI"
FT   gene            complement(202530..203465)
FT                   /locus_tag="Asuc_0170"
FT   CDS_pept        complement(202530..203465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0170"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: eca:ECA1951 putative transketolase
FT                   C-terminal section"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73550"
FT                   /db_xref="GOA:A6VKQ3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKQ3"
FT                   /protein_id="ABR73550.1"
FT                   /translation="MSNAEHLANIMVERFISAVKNGVDLVPVVADSTSTAKIAPFIKEF
FT                   PDRLVNVGIAEQSLVGCAAGLALGGKVAVTCNAAPFLISRANEQVKVDVCYNNTNVKLF
FT                   GLNSGASYGPLASTHHSIDDIGVMRGFGNIQIFAPSSPNECRQIIDYAINYVGPVYIRL
FT                   DGKELPEIHNDDYEFVPGQIDVLRKGGKIALVAMGSTVYEIVDAAVKLAEKGIEVTVVN
FT                   VPSIRPCDTEALFNAIKDCKYVISVEEHNINGGVGSLVAEVIAEHGAPITLKRRGIADG
FT                   GYALAGDRKSMRKHHGIDADSIVDLALSLN"
FT   gene            complement(203458..204288)
FT                   /locus_tag="Asuc_0171"
FT   CDS_pept        complement(203458..204288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0171"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG: yen:YE0822
FT                   putative N-terminal region of transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73551"
FT                   /db_xref="GOA:A6VKQ4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKQ4"
FT                   /protein_id="ABR73551.1"
FT                   /translation="MNPYNLSYDELEKKAKAIRRKIVVLNANSPAGGHTGADLSQVEIL
FT                   TSLYFRVLNNDPKDLINPERDIYIQSKGHGAGGYYCCLAEAGYIPEDWLPTYQHSDSKL
FT                   PGHPVKHKTPGVELNTGALGHGLPVAVGLAIAAKKSGSKRKIYVLTGDGELGEGSNWEA
FT                   ALTAAQYKLDNLIIINDKNKLQLAGFTKDILCTDPLDKKWEAFGMEVHECQGNDIRSVV
FT                   DTLESIQPNGKPHVVIANTTKGAGISFIEGRPEWHHKVPKGDEVELALEELKDE"
FT   gene            complement(204470..205507)
FT                   /locus_tag="Asuc_0172"
FT   CDS_pept        complement(204470..205507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0172"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: eca:ECA1949
FT                   putative sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73552"
FT                   /db_xref="GOA:A6VKQ5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ5"
FT                   /protein_id="ABR73552.1"
FT                   /translation="MSKSVSSGNLTLLLLKLRTFIALIIILAFFTFTVDGFLNPSSLII
FT                   MIKHISINALLALGITFVIITAGIDLSIGAILGLCGMVAGYLISKGIVLPMFGIAIFPS
FT                   VWVIVPLVLLLGAILGGINGYIITRYNVAPFICTLGTMYIIRGAAMLTSNGETFPGLSG
FT                   NPQLGNTGFDIIGAGSLFGVPYSIWLMFIVAGLIAYTAKKLPFGRHVYAIGDNERAAEL
FT                   SGIKVNNTKVWVYVISGLCAALAGIVVTSQLVASHPATGNAFEMNAIAAVVLGGTSLAG
FT                   GRGTVGGTLIGAFVIGILADGLVMMGVSEFWQMVIKGIVIIVAVVIDQMQNKLQYKVAV
FT                   ASQKS"
FT   sig_peptide     complement(205397..205507)
FT                   /locus_tag="Asuc_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.718 at
FT                   residue 37"
FT   gene            complement(205528..207051)
FT                   /locus_tag="Asuc_0173"
FT   CDS_pept        complement(205528..207051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0173"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yen:YE0820 putative sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73553"
FT                   /db_xref="GOA:A6VKQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ6"
FT                   /protein_id="ABR73553.1"
FT                   /translation="MSIETKDVVMRAENISMIFPGTKALDNVSYNVYRGAVNVIIGENG
FT                   AGKSTLMKILAGVQQPTLGDLYINGEKVHITDTRSAAAHGIGMVHQELNLSENLSVAEN
FT                   IFLGRELQSGLLPIDNNAQYEASKELLKRLKQDIDPNEIVSNLKVGQKQLIEIAKALAG
FT                   KIDILILDEPTSALSKTEVQILFDVIRELTAQGVSIIYISHRLEELMEIGTYITILRDG
FT                   KFQSEAAVKDIDVPWIVREMLGSDPVTDFLPENREFGAKILEAENITCINESENKVVND
FT                   VSFSLRAGEIVGIYGLMGAGRTELFECLLGQAEYSGRFSLNGIIINENISTTNRIKMGL
FT                   GLVPEDRKRSGIFPVTSVGNNLTVSSLWKRLKKQFVISKEDEEKAIQSTIKELSIKVSS
FT                   PEVEIQALSGGNQQKVVIGRSLLTEPKVLLLDEPTRGIDIGAKADVFEMMVKLSQQGIG
FT                   ILFSTSDLKEIMAVSDRILVMSNGKLTADVKRSETNEAALVLASAKGFQ"
FT   gene            complement(207063..207659)
FT                   /locus_tag="Asuc_0174"
FT   CDS_pept        complement(207063..207659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0174"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: yen:YE0819 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73554"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ7"
FT                   /protein_id="ABR73554.1"
FT                   /translation="MFSCQHLKSSLLIVLTSLAVAGCEVVELDSAGKPIIPMSAEEAAS
FT                   LANMDPKDVVTKMWTDIVQDAQKAPISLESLENKKENDKSYFVRFSGVVEQVEVKSKFI
FT                   TVSVNTGNEIIPIQVGSMIKGNAIRDASSLLSFDQFKNQIQYSKLAKELNKSAVQNLVK
FT                   LDDSSVGKKVDVLSALTIKGDNIQNVVPLDIKIVE"
FT   sig_peptide     complement(207591..207659)
FT                   /locus_tag="Asuc_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.603 at
FT                   residue 23"
FT   gene            complement(207716..208648)
FT                   /locus_tag="Asuc_0175"
FT   CDS_pept        complement(207716..208648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0175"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: yps:YPTB0812 ABC
FT                   transporter, periplasmic sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73555"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ8"
FT                   /protein_id="ABR73555.1"
FT                   /translation="MKLLKASLVALSLAASTFVYADNGLIAIITPSHDNPFFKAEADGA
FT                   KQKAEELGYTTLVASHDDDANKQDQLISTAVSRKAKAIILDNAGSDVTVGALEKAKAAG
FT                   VPAFLIDREINKTGVAVSQIVSNNYQGAQLSAEKFVELMGEKGQYVELLGRESDTNASV
FT                   RSQGFHEIIDEYPEMKMVAQQTANWSQTEGFSRMESILQANPNIKGVISGNDTMALGAE
FT                   AALKAAGRTDVIVVGFDGSDYVRDSILAGGNIKATALQPAWDQAQEAVVQADKYIRTGS
FT                   TGKEEKQLMDCILIDSSNAKKLNKFSLSK"
FT   sig_peptide     complement(208583..208648)
FT                   /locus_tag="Asuc_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(208793..209746)
FT                   /locus_tag="Asuc_0176"
FT   CDS_pept        complement(208793..209746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0176"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: putative sugar-binding domain protein; KEGG:
FT                   eca:ECA1954 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73556"
FT                   /db_xref="GOA:A6VKQ9"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKQ9"
FT                   /protein_id="ABR73556.1"
FT                   /translation="MAMLDEKRLLAKIAKLYYDEKMKQTDIAKSLNLSQSFISRSLTKC
FT                   IAEGIVQINVIPPPNIFLDLEQILQKRFALSQVIIVDSDEHDNEEQIQRAIGSAAAYYL
FT                   QVTSQPNQLIGISAWSDTIRAMVDTMMPLNIKAKGVVQLLGGVGINGNVQANLSTYTLA
FT                   QKLNCPAYLLPSQNISSTDEVSYKNELLKNPEVAQVIELFDTIDCAIIGIGRLEPSASL
FT                   KKSGIYYNSCMKEKLKSKGAVGDICLHYFNNDGTPVLSNMEDPAIGIDLEKLKKCPKVI
FT                   ALAGGIEKAEAIKAALIGGYIDILVIDKLTAQLLLQ"
FT   gene            complement(209847..210491)
FT                   /locus_tag="Asuc_0177"
FT   CDS_pept        complement(209847..210491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0177"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: msu:MS0172 3, 4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73557"
FT                   /db_xref="GOA:A6VKR0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR0"
FT                   /protein_id="ABR73557.1"
FT                   /translation="MNQSLLSSFGTSEERVIKAIEAFKQGNGVLVLDNEDRENEGDLIF
FT                   PAETITPEQMAILIRYGSGITCLCITDELCKQLDLPPMVQCNTSVNKTAFTVTIEAASG
FT                   VSTGVSASDRVTTIKAAISVGAKPEDLHRPGHVFPLCAVEGGVLARGGHTEAAVDLARL
FT                   SGYREAGVICEITNDDGTMARTPELVEFVKKFGYAIVTIEDIIGYRKKYDC"
FT   gene            complement(210975..212486)
FT                   /locus_tag="Asuc_0178"
FT   CDS_pept        complement(210975..212486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0178"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="TIGRFAM: aminoacyl-histidine dipeptidase; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   hso:HS_0004 Xaa-His dipeptidase (aminoacyl-histidine
FT                   dipeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73558"
FT                   /db_xref="GOA:A6VKR1"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR1"
FT                   /protein_id="ABR73558.1"
FT                   /translation="MLSFCNKVRSKIRKFYKKGRNMSEIQTLQPARLWQWFDKICAIPH
FT                   PSYHEDALAEFIVNWAKGKNLFAERDEAGNVLIRKAATQGMENRPSVALQAHLDMVPQA
FT                   NESTRHDFLKDPILPRIEGDWVYAAGTTLGADNGIGMASSLAVLDSDDLAHPELEVLLT
FT                   MTEEAGMEGALGLRAGWLRAKMMVNTDTEESGEIYIGCAGGENADFSLPVNTQPNKFPH
FT                   CFEVAIKGLRGGHSGCDIHTGRGNAIKLLGVFLTALSYATQDFAIVDIRGGSVRNAIPR
FT                   EAFVTLALDDADALNRVAENFKAHLKAELTEDPNAQVLLNKVALPQQTFDTASSQTVTH
FT                   VLNALPNGVVKFSDTVKDVVETSLSIGVLNMKNGALHGTILLRSLIEHGTDEVKAELVA
FT                   LAQQSGGDVAYSGYYPGWEPHPDSDMLTLTKQAYAQVIGEEPKVKVIHAGLECGLLKKI
FT                   YPELDVVSIGPTIRNAHSPDECVHIPAVQTYWSVLTQVLAGIKEK"
FT   gene            212545..213003
FT                   /locus_tag="Asuc_0179"
FT   CDS_pept        212545..213003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0179"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: msu:MS2117
FT                   adenine/guanine phosphoribosyltransferases and related
FT                   PRPP-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73559"
FT                   /db_xref="GOA:A6VKR2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKR2"
FT                   /protein_id="ABR73559.1"
FT                   /translation="MSEKYVVTWDMFQMHSRKLAERLLPASQWKGIIAVSRGGLFPAAV
FT                   LSRELGIRHVETVCIASYDHDRQGELRVIHAAETDGEGFIVVDDLVDTGNTAKEIRNMY
FT                   PKAKFVTVFAKPAGAPLVDDYVIDIPQDTWIEQPWDLGLGFVPPIARK"
FT   gene            213061..213765
FT                   /locus_tag="Asuc_0180"
FT   CDS_pept        213061..213765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0180"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: msu:MS1341 molybdate
FT                   transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73560"
FT                   /db_xref="GOA:A6VKR3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR3"
FT                   /protein_id="ABR73560.1"
FT                   /translation="MIEYITLSQAEIDAVRLSLKVAFWAILCSLPPAIATAWLLARCRF
FT                   WGKSVLNSIIHLPLVLPPVVIGYLLLTTMGRNGVIGKFLLDWFGFSFSFSWYGAALASA
FT                   IVTFPLVVRAIRLAIESIDVKLEQAARTLGASAWRTFFTVTLPLASPGILAGVILGFAR
FT                   SLGEFGATITFVSNIPEVTRTIPLAMYSFIETPNAEGAAARLCLIAIVISLVSLLMSEW
FT                   LAKRTQSKLGRE"
FT   gene            213765..214460
FT                   /locus_tag="Asuc_0181"
FT   CDS_pept        213765..214460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0181"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   pmu:PM0742 molybdenum transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73561"
FT                   /db_xref="GOA:A6VKR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR4"
FT                   /protein_id="ABR73561.1"
FT                   /translation="MLEINVKKTLGELQLEANLQIPAQGVTAVFGLSGSGKTSLINMVS
FT                   GLLTPDYGFVRLNGKTLTDTARHINLAPNERHIGYVFQDARLFPHYTVKGNLCYGMKKK
FT                   SAVNFQQVLDLLGIASLLKRYPATLSGGEKQRVAIGRALLTAPEILLMDEPLSALDLPR
FT                   KQELLAYLQTLSREIRIPILYVTHSPEEIKALAQRVILMDNGKVTAYGDTQTVLSDPRL
FT                   ARWRAENNT"
FT   gene            complement(214525..216240)
FT                   /locus_tag="Asuc_0182"
FT   CDS_pept        complement(214525..216240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0182"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: hin:HI0729 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73562"
FT                   /db_xref="GOA:A6VKR5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKR5"
FT                   /protein_id="ABR73562.1"
FT                   /translation="MRTSQYLFSTLKETPNDAQVVSHQLMLRAGMIRSMASGLYNWLPT
FT                   GVKVLKKVENIIREEMNKGGAIEVLMPVVQSAELWQESGRWEQYGPELLRFSDRGNRDF
FT                   VLGPTHEEVITDLVRREVSSYKQLPLNLYQIQTKFRDEVRPRFGVMRSREFVMKDAYSF
FT                   HTTQESLQQTYEVMYQVYTNIFTRLGLDFRAVQADTGSIGGSASHEFQVLASSGEDDVV
FT                   FSTESDFAANIELAEAIAVGERQAPGKAMELVDTPNAKTIAELVEQFNLPIEKTVKTLI
FT                   VKGATEDAPLVALIIRGDHELNEIKAQKHPLVADPLEFADETEIKAKIGAGVGSLGPVN
FT                   LNIPAIIDRSVALMSDFGAGANIDGKHYFNINWERDAAMPEAFDLRNVAEGDPSPDGKG
FT                   TLQIKRGIEVGHIFQLGKKYSEAMNATVQGEDGKPLVMTMGCYGIGVTRVVAAAIEQHH
FT                   DERGIIWPTDEIAPFTVAIVPMNMHKSESVRAFAEELYQTLKAQGVDVIFDDRKERPGV
FT                   MFADMELIGVPHMVVIGEKNLDKGEIEYKNRRNGEKQMIAKDRLLAFLAENVKA"
FT   gene            216637..218094
FT                   /locus_tag="Asuc_0183"
FT   CDS_pept        216637..218094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0183"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: hit:NTHI0027
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73563"
FT                   /db_xref="GOA:A6VKR6"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR6"
FT                   /protein_id="ABR73563.1"
FT                   /translation="MDKKLIHYAIILAFPILTYIFPAPEGLSLIGWHVLGVYIGTIIAL
FT                   ILKPFPAPPILLAAVAISAIMIGNTPAETVNGTKVALKQSVVLDGYKSGTTWLVFAAFA
FT                   MSAAFVQTGLGRRIAYKMIGAFGSTTLRLGYVNALLDLLISPAMPSTTARGGGIMAPIM
FT                   QSIAVSLGSEPFKSPRRVGHYLLLNTYMVVKTTGYITLTGMAPNAVALELMRPILHIDV
FT                   NWTQWFIAACVPGFIALLLMPFVVYVLYKPELKEVDNKEIARKGLEEMGPMKTKEKILA
FT                   VLFISAILGWVFSGVLHIAEFTVAISAMALIILTSVLTWEDMLKNRGGWTTLTWYGGLL
FT                   GIAATLKQANFFEWLSVTMSTLIPASENSPLMITVFILILSVAVRYLFASGAAYVASMV
FT                   PVFSAVGIAAGADPLFLALGLLFSNSYGSMVTHYGSAPAAVIYGLGYHDLKSFWITGGV
FT                   CAVITLLIHVTIGFGWWSILENMNFFG"
FT   gene            218202..219272
FT                   /locus_tag="Asuc_0184"
FT   CDS_pept        218202..219272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0184"
FT                   /product="protein of unknown function DUF453"
FT                   /note="PFAM: protein of unknown function DUF453; KEGG:
FT                   pol:Bpro_4551 protein of unknown function DUF453"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73564"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR7"
FT                   /protein_id="ABR73564.1"
FT                   /translation="MKRIPCMIIRGGTSKGLYFLKQDLPADIGERDKFLMTVMGSGDAT
FT                   QINGLGGATSVTSKVAIVSKSDKEGVDLDYLFAQVGIDKKVVDTAPSCGNILSGIVCFA
FT                   SEKGLIELQDGITTVVVNNVNTNSIIEVSAETPNKQLKFDGTAEVSGVPGSGSPVNLNF
FT                   SQIEGAKTGKIFPTGNKQDNINGYNVTCIDVAMPMVLFNAADLGLTGKESKAELDADKA
FT                   LFDIIEPIRRKAGEMMGLGDVSEKVIPKMGILSAPAGKGNITSRYFVPDKCHASHAVTG
FT                   SICVSAASKIEGTVASALYKDTGSVVTIEHPSGFISVDIVCEPDGNSYKFTRAALVRTA
FT                   RPLMIGEVFYDETLLK"
FT   gene            complement(219437..222043)
FT                   /locus_tag="Asuc_0185"
FT   CDS_pept        complement(219437..222043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0185"
FT                   /product="aconitate hydratase 2"
FT                   /note="PFAM: aconitate hydratase domain protein; aconitate
FT                   hydratase 2; KEGG: pmu:PM0204 aconitate hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73565"
FT                   /db_xref="GOA:A6VKR8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR8"
FT                   /protein_id="ABR73565.1"
FT                   /translation="MSNFLAQYQSHVDERAALGIVPKPLDAEQTGQLVELLKNPVVGRE
FT                   SELLSLFENRIPAGVDDAAKVKAEFLTEIVNGRESSPLISPEHAVELLGTMSGGYNVQP
FT                   LIDLLDNARFAPLAVKALSFTLLIFDNFNAVAEKAKQGNTFAEQVLQSWADAEWFTSRP
FT                   KLADKITLTVFKVLGETNTDDLSPAQEAWCRSDIPLHANAMLKMPREGIEPDQPGSVGP
FT                   LKQLAALKSKGFPLVYVGDVVGTGSSRKSATNSVLWHMGDDIPFIPNKRTGGFVFGGKI
FT                   APIFFNTAEDSGALPLELDVTALNMGDVIDVYPYERKICKHGCQEVLATFNYKTEGLLD
FT                   EVRAGGRIPLIIGRSLTAKARAELGLPESDVFVKAPEMPDTGKGFTLAQKMVGKACGVD
FT                   GVRAGQYCEPFMASVGSQDTTGTMTRDELKDLACLKFSAPLVMQSFCHTAPYPKPSDVV
FT                   THKTLPEFITSRGGIALRPGDGVIHSWLNRMLLPFTVGTGGDSHTRFPIGISFPAGSGL
FT                   VAFAAATGIMPLDMPESVLVRFTGSMQKGITLRDLVHAIPYFAIKQGLLTVEKENKKNV
FT                   FSGRILEIEGLETLTAEQAFELADATAERSAAACTVKLNESSIAEYLRSNIVLLKSMIA
FT                   DGYSDAKALENRVKAMEEWLANPEMLEADADAEYAAVLDINMDEIKEPILCVPNDPDDA
FT                   RLLSEVQGNKIDEVFIGSCMTNIGHFRAAGKLLGELNGELNTRLWLAPPTKMDAAKLSE
FT                   EGYYNIYGRTGARTEMPGCSLCMGNQARVRPNSSVVSTSTRNFPNRLGQGAQVYLASAE
FT                   LAAVAAILGRLPTSEEYFNAVADLNSRKDEVYRYLNFDRLPSYIEKAGQVIFQTGA"
FT   gene            222162..222905
FT                   /locus_tag="Asuc_0186"
FT   CDS_pept        222162..222905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0186"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   pcr:Pcryo_1823 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73566"
FT                   /db_xref="GOA:A6VKR9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKR9"
FT                   /protein_id="ABR73566.1"
FT                   /translation="MLQSYDINYAQASRMPRYIQIKYRLQQFLAEENWLFDKAIPSEQE
FT                   LANEYGVSIGTIRKAVEGLVEEGVLIKHQGKGTFLKHPAFIKSSMIRFYPSRDEKGEVS
FT                   TPTGIVKTVKRIAPNQEINKILDLPPDAPLIYLERVRMDGDTVILSDKIWLSEERFGSF
FT                   LDLSLAQFPSLLYPFYFEHCGQMVISAKEQMNFLLNYSDPYLTDNREKAVVRIRRTAKG
FT                   LDGSIIEYRETYGLAENYYYETTIT"
FT   gene            complement(223172..223789)
FT                   /locus_tag="Asuc_0187"
FT   CDS_pept        complement(223172..223789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0187"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   msu:MS2085 glutathione-S-transferases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73567"
FT                   /db_xref="GOA:A6VKS0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS0"
FT                   /protein_id="ABR73567.1"
FT                   /translation="MKLYYLKGACSLVPHIALEWIGKPFEAVEVSHEQIKSPEYLALNP
FT                   QGVVPLLQDGDFVLSQNVAILSYLDALYPDAKLFGSVTVQDKAKAMKWLAFCNADLHKA
FT                   FGPVFRPPVYAQGDDELLTRIRQTAGRQILDLLAIADDCLAKQIFLGERISVADAYLYV
FT                   ELRWCKGLGLDYGHLRNLEAFYRRVSENVGVQAALKAQGLPV"
FT   gene            complement(223802..225049)
FT                   /locus_tag="Asuc_0188"
FT   CDS_pept        complement(223802..225049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0188"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: msu:MS2084
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73568"
FT                   /db_xref="GOA:A6VKS1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS1"
FT                   /protein_id="ABR73568.1"
FT                   /translation="MDFFHYKNHKLYAEDCEITQLAEQFGTPLYVYSKATLERHWHAFD
FT                   DAFGDYPHLICFAVKSNSNIAVLQTMARLGSGFDIVSQGELERVLAAGGDPGKVVFSGV
FT                   AKTETEITRALEVGIRCFNVESIPELYRINEVAGKLGKIAPISLRVNPDVDAHTHPYIS
FT                   TGLKENKFGVSVDQAREVYRRAAELPHIAVTGMDCHIGSQLTELQPFLDAADRLVVLME
FT                   QLKQDGVQLKHLDLGGGLGVTYSNETPPHPTDYATALLQKLQAYNLEIILEPGRAICAN
FT                   AGVLVTKVEYLKSNETHNFAIVDAGMNDMIRPALYEAYMNIIEADRTLPRAKAVYDVVG
FT                   PICETSDFLGKKRELAIAAGDYLVQRSAGAYGASMSSNYNSRPRTAEVMVDGDKAFLIR
FT                   RRESYQNLWQLENLLP"
FT   gene            complement(225059..225214)
FT                   /locus_tag="Asuc_0189"
FT   CDS_pept        complement(225059..225214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73569"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS2"
FT                   /protein_id="ABR73569.1"
FT                   /translation="MKKLFTLSIICALLTGCGVKGPLYLPADNQPEQDAQKQTQPQIQE
FT                   EQTQQQ"
FT   sig_peptide     complement(225152..225214)
FT                   /locus_tag="Asuc_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.557 at
FT                   residue 21"
FT   gene            complement(225225..225584)
FT                   /locus_tag="Asuc_0190"
FT   CDS_pept        complement(225225..225584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0190"
FT                   /product="diacylglycerol kinase"
FT                   /note="PFAM: diacylglycerol kinase; KEGG: msu:MS0242
FT                   diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73570"
FT                   /db_xref="GOA:A6VKS3"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS3"
FT                   /protein_id="ABR73570.1"
FT                   /translation="MYDKTTGLTHLINAAKYSLQGLQSAVKNEAAFRHELLLGVVFVPL
FT                   AFWLADDKTELVLMLASYFIVLIVELLNSALECTVDRIGTERHELSGRAKDQGSAAVFV
FT                   ALVNFVVTWSVLLIF"
FT   gene            complement(225628..227850)
FT                   /locus_tag="Asuc_0191"
FT   CDS_pept        complement(225628..227850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0191"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   RelA/SpoT domain protein; KEGG: msu:MS0241 guanosine
FT                   polyphosphate pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73571"
FT                   /db_xref="GOA:A6VKS4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS4"
FT                   /protein_id="ABR73571.1"
FT                   /translation="MVAVRGSHLLNPKDFVIENWCADLGLAPEVETRLVQAWRYSQTKA
FT                   QQLFLNSHWYLRDGVEMVEILHSLNMDGDTLLAAMLFPVVNAKIVNTEQIKEDFGSKIS
FT                   KLVKGVIDMSYIRQLDALQSSDNLQIDNIRRMLLAMVDDFRCVIIKLAERITYLRDADK
FT                   RYSREEKIAAAKECTKVYAPLANRLGIGQLKWELEDYCFRNLQPEQYRIIALKLNERRL
FT                   DREQYIQDFVQELSDYLHENIGKAEVYGRPKHIYSIWRKMKKKNLDFSGLYDIRAVRIL
FT                   VPNLEDCYTALGVVHTHFKHLPDEFDDYIANPKPNGYQSIHTVVLGKGDKPIEVQIRTE
FT                   KMHADAELGVAAHWKYKEGTTGSMSAYEEKITWLRKLLAWQADIADSGGIVGEMRTQIF
FT                   DDRVYVFTPKGEVVDLPAGSTPLDFAYAIHSDVGHRCIGAKAGGRIVPFTYQLQMGDQI
FT                   DILTQKTPNPSRDWLNPSLGFTHTQKARSKIAAFFKKLDRDKNIPLGKEQLENELAKHG
FT                   FSLKQAEQLGLPRYNLKSLEDLYNGIGSGDIKLNQLINFLQNKLVKPTAAEADAEVLRH
FT                   VTQKSVVNSQQKADKKGYVVVEGVGNLMHHMARCCQPIPGDEIVGYVTVGRGISIHRAD
FT                   CEQLTELAAAHPERVVETNWGDQDHQNGYHVSIRVVATDRNGLLRDITTVLANEKISVT
FT                   GVSSRADNKRQIATIDLEIALANVEMLGKITARLASLEDVIDVKRL"
FT   gene            complement(227863..229182)
FT                   /locus_tag="Asuc_0192"
FT   CDS_pept        complement(227863..229182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0192"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase; KEGG: msu:MS0240
FT                   SAM-dependent methyltransferases related to tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73572"
FT                   /db_xref="GOA:A6VKS5"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS5"
FT                   /protein_id="ABR73572.1"
FT                   /translation="MALFYSPQKSAKKRPHFQPVLTADIIDLDYQGAGVAKIRGKTWFI
FT                   DNALPSETVQFRVTEDKRRYGLGVTENILRASPLRQTPKCRFFGECGGCQSQHIPSDMQ
FT                   RNAKQQALFQRLQKLQKDIEFMPMMTGEPWQYRRRARLSLLFDGKTRQLEMGFRGKGSA
FT                   QIVAVDRCEVLEPALNNLLPNLTALFARFSQPASLGHVELVAADNGVAVLLRVTQNLVE
FT                   SDRTLLLGFAESYGVNLFVQDNQSIRLLHGEPPYYEIQGLRLQFDIRDFIQVNADLNRK
FT                   MVATASDWLALKPTDRVLDLFCGMGNFTLPISRLVKSAVGIEGVSAMVTKATKNAEQNH
FT                   CENVEFYQTDLDSSFVDKPWANRPFDKILLDPPRSGAAFALSALIGLQPEKILYVSCNP
FT                   ATLIRDAENLLRAGYRLRRVAMIDMFPHTGHLESISLFEK"
FT   gene            complement(229206..229919)
FT                   /locus_tag="Asuc_0193"
FT   CDS_pept        complement(229206..229919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0193"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O RecO; KEGG: hit:NTHI0450 DNA repair
FT                   protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73573"
FT                   /db_xref="GOA:A6VKS6"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKS6"
FT                   /protein_id="ABR73573.1"
FT                   /translation="MAIETFQRGFVLHRKPYSETSLLVDLFTEETGRLTVLAKGARAKR
FT                   SAWKGVLQPFTPLLLRWSGKGALKTLTKAEPAAIALPLQQTALFSGFYVNELLCRVIEA
FT                   ETPNGELFQDYLHCLTRLASEDGVEPALRTFEFQLLTMLGYGVDFTHCAGSGEPVDEAM
FT                   TYRYREEKGFTASLIKDNATFYGRDLLAFEARDFRDPAVRSAAKRFTRMALKPYLGNKP
FT                   LKSRELFAHNILFLK"
FT   gene            230137..230556
FT                   /locus_tag="Asuc_0194"
FT   CDS_pept        230137..230556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0194"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: hin:HI0501
FT                   D-ribose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73574"
FT                   /db_xref="GOA:A6VKS7"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKS7"
FT                   /protein_id="ABR73574.1"
FT                   /translation="MKKTTIINAQLSYAIATLGHTETLTLCDAGLPIPNSSNRIDLALT
FT                   KGIPSFLETLYAVTSEMFVERAILASEIKEKNPEILTALLAHLSQLATKQGNQIPVEFV
FT                   SHEKFKKLTHDSKGIVRSGECSPYANIILVSGVPF"
FT   gene            230566..232068
FT                   /locus_tag="Asuc_0195"
FT   CDS_pept        230566..232068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0195"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pmu:PM0155 ribose trasport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73575"
FT                   /db_xref="GOA:A6VKS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS8"
FT                   /protein_id="ABR73575.1"
FT                   /translation="MEYETLLKINGIDKSFPGVKALSNACLSVYAGRAMALMGENGAGK
FT                   STLMKVLTGIYSKDAGTIEYLGKAVSFNGPKDSQEAGISIIHQELNLVGNLTIAENIFL
FT                   GREFTTAWGAINWKKMYDEADKLLARLNVPHSSHQLCSELSIGEQQMVEIAKALSFESK
FT                   VIIMDEPTDALTDTETEALFNVIRELKAEKCGIVYISHRIKEIFEICDDVTVLRDGQFI
FT                   GESAVSDLTEDRLIEMMVGRRLDEQYPYVEVPKGDIRLEVKNLTGSGVHDVSFQLHSGE
FT                   ILGISGLMGAGRTELMKVLYGALPKESGKMRLNHKEISNNCPQDGLNNGIVYISEDRKG
FT                   DGLILGMSVKENMSLTALEHFSKMCRIRHDSEQLAVDDFILMFNIKTPSRDQQIGLLSG
FT                   GNQQKVAIAKGLMTRPNVLILDEPTRGVDVGAKKEIYQLINKFKQDGLSIVIVSSEMPE
FT                   VLGMSDRILVMREGRISGEFSRSEATQEKLLAAAIGKSAVKN"
FT   gene            232078..233046
FT                   /locus_tag="Asuc_0196"
FT   CDS_pept        232078..233046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0196"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pmu:PM0154
FT                   ribose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73576"
FT                   /db_xref="GOA:A6VKS9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKS9"
FT                   /protein_id="ABR73576.1"
FT                   /translation="MYTQNSFKLGKFLLEQRSIVALLVLIGIVSAINPDFFTIDNILNI
FT                   LRQTSVNAIIAVGMTFVILIAGIDLSVGSVLALTGAIAASLVGSEFSMLLVIPAVLFIG
FT                   AFLGGVSGVIVAKGKVQAFIATLVTMTLLRGVTMVYTDGRPISTGFSDAADQFSYLGTG
FT                   YLFGIPVPIWLMAVVFAVAWYILKHTRIGRYIYALGGNEAATQLSGINVNKIKVFVFAV
FT                   SGFLSALAGLIVTSRLSSAQPTAGVSYELDAIAAVVVGGTSLMGGKGRVMGTLIGALII
FT                   GFLNNALNLLDISSYYQMIAKALVILAAVLADNYLGSKKHN"
FT   gene            233066..233944
FT                   /locus_tag="Asuc_0197"
FT   CDS_pept        233066..233944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0197"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: hit:NTHI0632
FT                   ribose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73577"
FT                   /db_xref="GOA:A6VKT0"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:4ZJP"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT0"
FT                   /protein_id="ABR73577.1"
FT                   /translation="MKKLTTIASSFVLAFAVSGSVLAQETIALTVSTLDNPFFVSLKDG
FT                   AQKKATELGYKLVVLDSQNDPSKELSNVEDLTVRGAKVLLINPTDSAAVSNAVAIANRN
FT                   KIPVITLDRGAAKGEVVSHIASDNVAGGKMAGDFIAQKLGDGAKVIQLEGLAGTSAARE
FT                   RGEGFKQAIEAHKFDVLASQPADFDRTKGLNVTENLLASKGSVQAIFAQNDEMALGALR
FT                   AISAAGKKVLVVGFDGTEDGVKAVKSGKLAATVAQQPELIGSLGVETADKILKGEKVDA
FT                   KIPVALKVVTE"
FT   sig_peptide     233066..233137
FT                   /locus_tag="Asuc_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            234004..234936
FT                   /locus_tag="Asuc_0198"
FT   CDS_pept        234004..234936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0198"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: hso:HS_0225
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73578"
FT                   /db_xref="GOA:A6VKT1"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT1"
FT                   /protein_id="ABR73578.1"
FT                   /translation="MKKLTVLGSINADHVISVPYFAKPGETLTGSHYHIAYGGKGANQA
FT                   VAAARLCDQSQMTVSFIGCIGEDGIGRTMKQAFADDGINVAPIVEVKDETTGIAMIQVA
FT                   ATGENSIVISPGANAYLNEEVVERFSDEITSADYLLMQLETPLPAIMKAAALAKKHGTK
FT                   VVLNPAPARPLPDELLTNTDIITPNETEAEILTGVCVTDEQSAVKSAQVFHDKGIETVL
FT                   ITLGSKGVYFSRQSKGGIVAGFRVRAVDTTAAGDTFNGAFLTALLDGKTMANAITFAHA
FT                   AAALSVTREGAQPSIPSRAETLRFLAQQG"
FT   gene            234972..235979
FT                   /locus_tag="Asuc_0199"
FT   CDS_pept        234972..235979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0199"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: pmu:PM0151
FT                   Rbs repressor homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73579"
FT                   /db_xref="GOA:A6VKT2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT2"
FT                   /protein_id="ABR73579.1"
FT                   /translation="MATMKDIAKRAQVSTSTVSHVINNTRYVSDEIREKILAIVNELNY
FT                   QPSALARSFKLKQTQTIGMLVTASNNPFFAEVVGAVERYCGRNNYNLILCNTDGDSERL
FT                   HKSLQTLIQKQVDGLLLMCTETQLQQNETLQLSVPTVIMDWWPNLSADKIFEDSELGGY
FT                   LATNMLIEQGHRRIGIITGNLQKPLALNRLNGYKKALRENGLTENPEWIVESQFDFDGG
FT                   ITGMEKLLAQPRRPTAVFACSDTIAIGVYQTAWKHGLRIPEDISVIGYDDITLARYLSP
FT                   PLTTVHQPKAELGKIAVETLFERIKNPQKKHRTLLLKPHIVARHSVARPHATSA"
FT   gene            236063..236794
FT                   /locus_tag="Asuc_0200"
FT   CDS_pept        236063..236794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0200"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   msu:MS0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73580"
FT                   /db_xref="GOA:A6VKT3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT3"
FT                   /protein_id="ABR73580.1"
FT                   /translation="MRVPRIYHPESLLNQSSCRLSEEAANHVGRVLRMQAGEALELFDG
FT                   SNHIYPAVISRADKKTVTVNIRERISDDRESPLAIHLGQVISRGERMEFTIQKSVELGV
FT                   KVITPLWSERCGVKLEGDRLAKKIRQWQKIAVSACEQCGRNVIPQIRPMMKLQDWCAEN
FT                   DGALKLNLHPRAQYSIKTLPTIPAEGIRLLIGSEGGLSPQEIALTEQQGFTEILLGKRI
FT                   LRTETAALTAITALQICFGDL"
FT   gene            236806..237411
FT                   /locus_tag="Asuc_0201"
FT   CDS_pept        236806..237411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0201"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   pmu:PM1869 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73581"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT4"
FT                   /protein_id="ABR73581.1"
FT                   /translation="MLTDKEVEMDDKQTVKMNLQNQLLVAMPNLEDDYFSRAVIYICEH
FT                   TEQGTMGLVINQPTDLSITELAAKVNFMMKIDRTLPNQAVLAGGPVNVERGFILHTPIR
FT                   KPLQHSYRITDRLSLTTSADIIETFGSPDSPEKYLVVLGCAAWVPGQLEQEIGRNDWLV
FT                   VPADDSVLFDTPYEQRWLAAQKLLGFESYNLSDKAGRA"
FT   gene            237411..237833
FT                   /locus_tag="Asuc_0202"
FT   CDS_pept        237411..237833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0202"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: hit:NTHI0416
FT                   putative holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73582"
FT                   /db_xref="GOA:A6VKT5"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKT5"
FT                   /protein_id="ABR73582.1"
FT                   /translation="MGMTVIAFDFGTKSIGCAVGQSITGTAQSLPAFKAQDGIPDWADI
FT                   EKCLKEWKPDMVVVGLPLNMDGTEQDLTRRARKFGHRLNGRFGVKVAWQDERLTTTQAR
FT                   TEIFERGGYRALKKGKVDSISACLILESWFEEHPEG"
FT   gene            complement(237942..239219)
FT                   /locus_tag="Asuc_0203"
FT   CDS_pept        complement(237942..239219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0203"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: msu:MS1995 Fe-S
FT                   oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73583"
FT                   /db_xref="GOA:A6VKT6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT6"
FT                   /protein_id="ABR73583.1"
FT                   /translation="MNIQELIAKAQQEFEAPVMQHTHTDESFEQCLKCTACTAVCPVTK
FT                   VNPFYPGPKQSGPDGERLRLKSADFYDEALKYCLNCKRCEVACPSDVKIGDIIVRARNK
FT                   YLDRQHKPLVHKLRDAILSNTDIMGSLNTPLAPIVNTITGLSATKFLLEKTIGVSKHRA
FT                   LPKYAFGTFRNFYLKKLAAEQAKYETKIAYYHGCYVNYNNPQLGKEVIDVFNALDIGVV
FT                   LLEKEKCCGLPLMVNSFPERAKKIAQFNTDYIGKMVDENGLDVIGEASSCTLNLREEYH
FT                   HVLGIDNAKVRPHIHLATVYLYKLLQQGKELPLKPLNLKVAYHTACHVEKAGWAPYTLE
FT                   VLRRIPGLEIVILPSQCCGIAGTYGFKAENYEKSQAIGKSLFDAINESGADYVISECQT
FT                   CKWQIDMSSDLTCLHPFTLLAMALDK"
FT   gene            complement(239221..240513)
FT                   /locus_tag="Asuc_0204"
FT   CDS_pept        complement(239221..240513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0204"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: msu:MS1994 anaerobic glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73584"
FT                   /db_xref="GOA:A6VKT7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKT7"
FT                   /protein_id="ABR73584.1"
FT                   /translation="MNFDVVIIGGGLAGLTCGIALQEQGKRCAIVNNGQAAMDFSTGSI
FT                   DLLGRLPNGENVQKVDRALAGLSEQLPAHPYAKLGAERVLAKAKQFEGMAAKLNLGLAG
FT                   SVEQNHARVTPLGGLRRTWLSPDSVPTVRPNEAFPYNNIVILGIEGYHDFQPQLLADNL
FT                   KLQPQFAHCEIKPGFLTIPELDFLRRQSREFRSVHIAQTLEQKVNPASLINEIRQAASG
FT                   ADVVFLPACFGQNSQAFFNELQAATDFMLFELPTLPPSLLGGRQHNILRQYFERLGGVM
FT                   MNGDRALRAEFEGNRVVKLFTRIHEDEPLAADNYVLASGSFFSNGLVAEFERIYEPVFG
FT                   ADIVQTERFDPSDHFTWTTRRFSAPQPYQSAGVVINTDCRVQKCGRFFDNLYAAGAVIG
FT                   GFNGIELGCGSGVAVVTALTVADEIAEKSGG"
FT   gene            complement(240503..242182)
FT                   /locus_tag="Asuc_0205"
FT   CDS_pept        complement(240503..242182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0205"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG: msu:MS1993
FT                   glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73585"
FT                   /db_xref="GOA:A6VKT8"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT8"
FT                   /protein_id="ABR73585.1"
FT                   /translation="MAMSSLYQNAGDFSPVSTDVIIIGGGATGAGIARDCALRGLKCIL
FT                   LERRDIATGATGRNHGLLHSGGRYAVNDRESAEECIKENLILKNIARHCVDDTKGLFIT
FT                   LPEDDLNYQKTFIEACTASGIEAVAIDPALARHMEPSVNPDLVGAVVVPDGSIDPFRLT
FT                   AANMIDATERGAQVFTYCEVTGLIREGDKVIGVDVYDHKNALKRRFFAPIVVNAGGIWG
FT                   QGIAEYADLKIRMFPAKGALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSSR
FT                   IPYDQIDNMEVTPEEVDILFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSR
FT                   GIVLLDHAERDGLDGFVTITGGKLMTYRLMAEWATDLVCKKLNVNKKCETADRTLPGSE
FT                   ESRDEINKKIINIPKTISSSAVYRHGTRAKPMLENERLDRSLVCECEAVTAGEVRYAVD
FT                   NLNINNLVDLRRRTRVGMGTCQAELCACRAAGLMARFDVATARQSTLQLASFMEERWKG
FT                   IQPIAWGDAMRESEFTGWIYYSLLGLNDVRPQAVEGVNNNEF"
FT   gene            complement(242333..242623)
FT                   /locus_tag="Asuc_0206"
FT   CDS_pept        complement(242333..242623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0206"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   mma:MM1583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73586"
FT                   /db_xref="GOA:A6VKT9"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKT9"
FT                   /protein_id="ABR73586.1"
FT                   /translation="MSITVLATFQVKAEKVEDFLTACRELTEYTMKDKGVQTYELQRNN
FT                   EDTNLFVFVERWESQADLDAHLATEHIKKAFPIFLECCQSEPVVQVFSPAF"
FT   gene            complement(242700..245012)
FT                   /locus_tag="Asuc_0207"
FT   CDS_pept        complement(242700..245012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0207"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="TIGRFAM: formate acetyltransferase; PFAM: formate
FT                   C-acetyltransferase glycine radical; pyruvate formate-lyase
FT                   PFL; KEGG: msu:MS0401 pyruvate-formate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73587"
FT                   /db_xref="GOA:A6VKU0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU0"
FT                   /protein_id="ABR73587.1"
FT                   /translation="MAQLTEAQQKAWEGFVPGEWQEGVNLRDFIQKNYTPYEGDESFLA
FT                   DATPATTELWNSVMEGIKIENKTHAPLDFDEHTPSTITSHKPGYIDKDLEKIVGLQTDA
FT                   PLKRAIMPFGGIKMIKGSCQVYGRTLDPKVEFIFTEYRKTHNQGVFDVYTPDILRCRKS
FT                   GVLTGLPDAYGRGRIIGDYRRLAVYGIDYLMKDKKAQFDSLQPRLEAGEDIQATIQLRE
FT                   EIAEQHRALGKIKEMAASYGYDISGPAMNAQEAIQWTYFAYLAAVKSQNGAAMSFGRTS
FT                   TFLDIYIERDLKRGLITEQQAQELMDHLIMKLRMVRFLRTPEYDQLFSGDPMWATETIA
FT                   GMGLDGRPLVTKNSFRVLHTLYTMGTSPEPNLTILWSEQLPEAFKRFCAKVSIDTSSVQ
FT                   YENDDLMRPDFNNDDYAIACCVSPMVVGKQMQFFGARANLAKTMLYAINGGIDEKNGMQ
FT                   VGPKTAPITDEVLNFDTVIERMDSFMDWLATQYVTALNIIHFMHDKYAYEAALMAFHDR
FT                   DVFRTMACGIAGLSVAADSLSAIKYAKVKPIRGDIKDKDGNVVASNVAIDFEIEGEYPQ
FT                   FGNNDPRVDDLAVDLVERFMKKVQTHKTYRNAVPTQSILTITSNVVYGKKTGNTPDGRR
FT                   AGAPFGPGANPMHGRDQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDDDAQKR
FT                   NLAGLLDGYFHHEATVEGGQHLNVNVLNRETLLDAIDHPEKYPQLTIRVSGYAVRFNSL
FT                   TREQQQDVITRTFTQAM"
FT   gene            complement(245099..245956)
FT                   /locus_tag="Asuc_0208"
FT   CDS_pept        complement(245099..245956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0208"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG: hso:HS_1135
FT                   formate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73588"
FT                   /db_xref="GOA:A6VKU1"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023999"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU1"
FT                   /protein_id="ABR73588.1"
FT                   /translation="MKCEENQSTVAASPAQMAQTGEDVGAYKATKNQFYSFLSAISAGA
FT                   FIALAFVFYTTTQTGSADAPWGLTKLVGGLVFSLGVIMVVVCGCELFTSSTMTTVARVN
FT                   KRISTFQMVRNWVVVYFGNFIGGLFIVGLIWMGSQTMAANGQWGLTILTTAQHKIHHTW
FT                   SEAFALGILCNIMVCLAVWMTYAGKTLTDKAFIQILPIGLFVASGFEHSVANMFMIPMG
FT                   IITAHFSTPEFWQAIGLNPEQFADLDVYHFIVKNLIPVTLGNLVGGGICVALLQWYTNK
FT                   PHAH"
FT   gene            246234..246587
FT                   /locus_tag="Asuc_0209"
FT   CDS_pept        246234..246587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0209"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   pmu:PM0073 hit-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73589"
FT                   /db_xref="GOA:A6VKU2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU2"
FT                   /protein_id="ABR73589.1"
FT                   /translation="MAEETIFSKIVRKEIPADIVYQDELVTAFRDIAPQAKTHVLIIPN
FT                   KLIPTVNDATVEDETTLGRLFTVAAKIAETEGIAEDGYRLIVNCNKHGGQEVFHIHMHL
FT                   VGGEPLGRMLAKS"
FT   gene            246584..246937
FT                   /locus_tag="Asuc_0210"
FT   CDS_pept        246584..246937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS0397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73590"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="InterPro:IPR038483"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU3"
FT                   /protein_id="ABR73590.1"
FT                   /translation="MMKKTLLFVTALLLAACSAQPNLVHTHKPILNITAELNPFIEADV
FT                   GENSAWVKNNTEAPLALRYDIFWYAENGVTQPVSATQEAYSGSLLLNPQQKYAVPLQKP
FT                   TPESVNYRLYLRN"
FT   sig_peptide     246584..246643
FT                   /locus_tag="Asuc_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.755 at
FT                   residue 20"
FT   gene            246939..247979
FT                   /locus_tag="Asuc_0211"
FT   CDS_pept        246939..247979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0211"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: msu:MS0396 beta-glucosidase-related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73591"
FT                   /db_xref="GOA:A6VKU4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKU4"
FT                   /protein_id="ABR73591.1"
FT                   /translation="MSTLLIDLKGQTLRQEEVELLEHPLVAGLILFTRNFYDRPQIQAL
FT                   VKDIRQRVKKPLLITVDQEGGRVQRFRDGFTKLPAMQSFAALIQEPEQQLATAKEAGWQ
FT                   MAAEMTALDIDLSFAPVLDLGHECKAIGDRSFCSDAESVFRLASAFIDGMHAAGMATTG
FT                   KHFPGHGHVLADSHLETPFDNRPSAVIFERDIRPFQRLIAQNKLNAVMPAHVIYTDCDD
FT                   QPASGSKYWLQDILRRKLGFHGAVFSDDLGMKGAGFMGDFVTRSEKALSAGCDLLLLCN
FT                   EPDGVVQVLDNLKLNESRPHFEARQQRLKTLFKKKSFNWTELTQTEKWLKNTQKLTALQ
FT                   AQWQSS"
FT   gene            248489..249640
FT                   /locus_tag="Asuc_0212"
FT   CDS_pept        248489..249640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0212"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumB"
FT                   /note="TIGRFAM: 23S rRNA (uracil-5-)-methyltransferase
FT                   RumB; PFAM: (Uracil-5)-methyltransferase; KEGG: msu:MS0395
FT                   SAM-dependent methyltransferases related to tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73592"
FT                   /db_xref="GOA:A6VKU5"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011825"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKU5"
FT                   /protein_id="ABR73592.1"
FT                   /translation="MNCPHYQTQTCISCRWLETPYADQLTQKQTHLQQQISILDQSRLE
FT                   WIPPFQSAQSGFRNKAKMVVNGTVERPILGIINERNQPADLTDCPLYPARFAEIFSVLK
FT                   DFIGRAGLVPYNIAKQKGELKYILLTESRANQTLMLRFVLRSETKLPLMRRELAGLSTK
FT                   IPDLAVVTANIQPQHAAILEGQKEIFLTEQQVLEERFNGIPLFIRPQGFFQTNPAVAEG
FT                   LYGTAQNWVKNLPVQRLWDLFCGVGGFGLHCAAALQANTPDVALTGIEISPSAIYSAAL
FT                   SAEKCGLKNVSFQSLDAANFALNQDDKPDLVIVNPPRRGIGKPLAEFLNNLRPQFLLYS
FT                   SCNAVTMGSDLQSLTHYQMRKIRLFDMFPHTAHYEVLTLLTLK"
FT   gene            complement(249814..251022)
FT                   /locus_tag="Asuc_0213"
FT   CDS_pept        complement(249814..251022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0213"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: rsp:RSP_3384 mandelate racemase/muconate
FT                   lactonizing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73593"
FT                   /db_xref="GOA:A6VKU6"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034611"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU6"
FT                   /protein_id="ABR73593.1"
FT                   /translation="MQFMHKSNYPLEEDAMRITDILEITKPISSPIRNAYIDFSQMTCS
FT                   MVAVVTDVVIDGRRVVGYGFNSNGRYGQGGLIRDRFRDRILKADPDSLLNDKGDNLDPH
FT                   RIWDVMMSNEKPGGHGERSVAVGTLDMAIWDATAKIAQKPLFQLLADREGIQANPRIFV
FT                   YAAGGYYYPGKDLNALQQEMRGYINRGYNVVKMKIGGASLEQDQRRIEAVLQEIDGDAR
FT                   LAVDANGRFDLETAIAYAKMLRQYPLFWYEEAGDPLDYALQAALAEFYPGTMATGENLF
FT                   SHHEARNLLRYGGMRPDRDYLQFDCALSYGLVEYLRTLKVVKDAGWSWSRCIPHGGHQM
FT                   SLNIAAGLGLGGNESYPDLFQPYGGFPDSVQVEDGHIVMPELPGIGFEGKADLIKVMRE
FT                   LAE"
FT   gene            251141..252064
FT                   /locus_tag="Asuc_0214"
FT   CDS_pept        251141..252064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0214"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: stm:STM0764 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73594"
FT                   /db_xref="GOA:A6VKU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU7"
FT                   /protein_id="ABR73594.1"
FT                   /translation="MQNSHNLELTWLKDCLALAEKLNFSQAAAARYVTQSAFSRRIQSL
FT                   EQWIGTPLFARNRRDVRLTPAGEIFCAKVPEILRMIDNGRNEALDTAGKHRPDVVIAAT
FT                   HSLSFSFFPELLRRNHDIARFGAFRLISDTLQACERTLLQGQSQFLLCHYHPYMRFNLA
FT                   PENFSSLRLGVDRLIPYSKTEQAGQQPLWKIDGGEKIPYLAFSNESGIGRIIANTEAIN
FT                   GIGNNLQLTFTSDLAATLLAMVKSGDGVAWLPETLAEQDIKNGDIMPATELADFRLPVE
FT                   IRLYRPTAKMSETVEALWDIFAQSAL"
FT   gene            complement(252108..253013)
FT                   /locus_tag="Asuc_0215"
FT   CDS_pept        complement(252108..253013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0215"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: msu:MS1689 LysR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73595"
FT                   /db_xref="GOA:A6VKU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU8"
FT                   /protein_id="ABR73595.1"
FT                   /translation="MQSSIYGYLTYFHEIVNKGSIAAAARKLEIAPPAVSNALKLLERH
FT                   LGLPLFTRTTRKMELTEAGQRLFDSTKDMIRGLDLMMESVRDLAEKPAGAVRITTSTIS
FT                   YLLLIRPHFAEFCERYPDIRLEISVNDGIVDIVKEGFDVGIRFGDRLEQNVVAKKLLDP
FT                   IRLGLYASESYLSKYGKPESLQDLSRHKLLGYRFVTANRTYPLTLNQNGREISVNMPYS
FT                   ILTNNLIVELDAIRQGIALGRLFEPVVNALHDSEKFIPVLEENWTHYPALYLFYMQHSQ
FT                   KAGRVRVLIDFLLEKSRPNK"
FT   gene            253156..253596
FT                   /locus_tag="Asuc_0216"
FT   CDS_pept        253156..253596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS1688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73596"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKU9"
FT                   /protein_id="ABR73596.1"
FT                   /translation="MKYSMIKTAAFAFIASAFTTQAMAASHMERRIVRDISNQSHQAVK
FT                   TENNRYDALKSELNSKLVQLNQASEMNAFNALAAEAKELAQQTKAAALAQTFNYGEPSD
FT                   NRRAELGVNYVSWKLNKLIDSLDQAAAQSDLAAAKTEIRSHI"
FT   sig_peptide     253156..253230
FT                   /locus_tag="Asuc_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 25"
FT   gene            complement(253666..254307)
FT                   /locus_tag="Asuc_0217"
FT   CDS_pept        complement(253666..254307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0217"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   msu:MS2252 lysine efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73597"
FT                   /db_xref="GOA:A6VKV0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV0"
FT                   /protein_id="ABR73597.1"
FT                   /translation="MGKKVVFFIQGFLVCGGLIIAIGAQNAFVLKQGLLKRNILAVVLT
FT                   CFICDFVLISSGVLGLGSLISGSPVATVALAIVGAVFLFVYGLRAFRSAYAGNSALNLN
FT                   AENSVQSSTLKAVLTTLAITLLNPHVYLDCFAIIGGIAGTIPAAQKTFFLLGALTASAL
FT                   WFFSLGYGARLLIPLFKRPATWRVLDGVIGVVMWSIAYNLACYAVRIYGA"
FT   gene            254425..255099
FT                   /locus_tag="Asuc_0218"
FT   CDS_pept        254425..255099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0218"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   msu:MS2330 pentose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73598"
FT                   /db_xref="GOA:A6VKV1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV1"
FT                   /protein_id="ABR73598.1"
FT                   /translation="MKPYLIAPSILSADLARLGEDVENVLKCGADLIHFDVMDNHYVPN
FT                   LTFGAPVCKALREYGITAPIDVHLMATPVDSLVVDFAKAGATSITFHGEASLHIDRTLQ
FT                   LIRDQGCRAGLVFNPATPLNYLDFVMDKLDMILLMSVNPGFGGQSFIPATLDKLRQVRQ
FT                   RIDDSGFDIRLEVDGGVKIDNIAQIAAAGADMFVAGSAIFDAPDYQKVIDDMRAELAKV
FT                   QK"
FT   gene            255108..255782
FT                   /locus_tag="Asuc_0219"
FT   CDS_pept        255108..255782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0219"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase ;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   msu:MS2331 predicted phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73599"
FT                   /db_xref="GOA:A6VKV2"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV2"
FT                   /protein_id="ABR73599.1"
FT                   /translation="MASQFKLIGFDLDGTLVNSLPDLALSVNSALAEFGLPQAPEPLVL
FT                   TWIGNGADVLISRGVEWASVQSGTTLSEEETVQLKARFNHFYGENLCNVSRLFPNVKET
FT                   LDKLKARGFILAVVTNKPTQHVQPVLKAFGIDHFFSEALGGQSLPAIKPHPAPLYYLCG
FT                   KFGFYPHQVLFVGDSRNDILAARAAGCPAVGLTYGYNYNIPIAESKPDWVLDDFAEILN
FT                   IV"
FT   gene            255826..256830
FT                   /locus_tag="Asuc_0220"
FT   CDS_pept        255826..256830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0220"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; KEGG: msu:MS2332
FT                   tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73600"
FT                   /db_xref="GOA:A6VKV3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV3"
FT                   /protein_id="ABR73600.1"
FT                   /translation="MTKPVVLSGVQPSGELTIGNYLGALRQWVNMQDDYECLFCIVDLH
FT                   AITVRQDPETLRKATLDVLALYLACGIDPEKSTIFIQSHVPEHTQLAWVLNCYTYFGEM
FT                   GRMTQFKDKSAKHADNINVGLFTYPVLMAADILLYQANQVPVGEDQRQHLEISRDIAQR
FT                   FNALYGERFVVPEAFIPKAGARIMALQEPTKKMSKSDDNRNNVITLLEDPKSVEKKIKR
FT                   ALTDGDEPPVVRYDVQNKAGVSNLLEMLAVMSEKSISELEKEFEGKMYGHLKSAVAEET
FT                   VKMLTALQERFHHYRNDEALLTRIAAEGAQKAKVRAQKTLKAVYDAVGFVPAA"
FT   gene            complement(257034..258650)
FT                   /locus_tag="Asuc_0221"
FT   CDS_pept        complement(257034..258650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0221"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   hit:NTHI0973 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73601"
FT                   /db_xref="GOA:A6VKV4"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="PDB:1YGG"
FT                   /db_xref="PDB:1YLH"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKV4"
FT                   /protein_id="ABR73601.1"
FT                   /translation="MTDLNKLVKELNDLGLTDVKEIVYNPSYEQLFEEETKPGLEGFDK
FT                   GTLTTLGAVAVDTGIFTGRSPKDKYIVCDETTKDTVWWNSEAAKNDNKPMTQETWKSLR
FT                   ELVAKQLSGKRLFVVEGYCGASEKHRIGVRMVTEVAWQAHFVKNMFIRPTDEELKNFKA
FT                   DFTVLNGAKCTNPNWKEQGLNSENFVAFNITEGIQLIGGTWYGGEMKKGMFSMMNYFLP
FT                   LKGVASMHCSANVGKDGDVAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDESGVFNFEG
FT                   GCYAKTINLSQENEPDIYGAIRRDALLENVVVRADGSVDFDDGSKTENTRVSYPIYHID
FT                   NIVRPVSKAGHATKVIFLTADAFGVLPPVSKLTPEQTEYYFLSGFTAKLAGTERGVTEP
FT                   TPTFSACFGAAFLSLHPIQYADVLVERMKASGAEAYLVNTGWNGTGKRISIKDTRGIID
FT                   AILDGSIEKAEMGELPIFNLAIPKALPGVDPAILDPRDTYADKAQWQVKAEDLANRFVK
FT                   NFVKYTANPEAAKLVGAGPKA"
FT   gene            complement(258859..259725)
FT                   /locus_tag="Asuc_0222"
FT   CDS_pept        complement(258859..259725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0222"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: msu:MS2262 disulfide bond
FT                   chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73602"
FT                   /db_xref="GOA:A6VKV5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKV5"
FT                   /protein_id="ABR73602.1"
FT                   /translation="MTYQQDNDKLYRYLFQNRAVRGEWVRMNKSFSETLNTHHYPIAVQ
FT                   NLLGEMMVATGLLTATLKFTGHITVQIQGDGPLKLALVNGTDSQQIRALARLQGEISDD
FT                   MTLHQMIGKGVLVITIAPEEGERYQGVVTLDKPTITECLEEYFERSEQLKTQLIIRTGE
FT                   FNGEPVAAGMLLQVMPDGSGSPDDFEHLAALTATVKDDEIFGLTAEEMLYRLYHEEQVE
FT                   IYAPQAVTFHCGCSAERSGAALLLISDAELDEILAEHNGSIDMQCECCGTHYFFNRDAI
FT                   DKLKMQQ"
FT   gene            complement(259839..260249)
FT                   /locus_tag="Asuc_0223"
FT   CDS_pept        complement(259839..260249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0223"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   msu:MS2264 ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73603"
FT                   /db_xref="GOA:A6VKV6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV6"
FT                   /protein_id="ABR73603.1"
FT                   /translation="MAKNTQKKVQNENDDVRLDKWLWAARFYKTRTICKEMIDGGKVHY
FT                   NGQRTKPNKTVEIGAKIKLRQGNDEKEVEVTALSARRRGAPEARLLYRETEQSLENREK
FT                   MALARKMNAMPHPDRRPNKKERRDLMRFKHQG"
FT   gene            260321..260884
FT                   /locus_tag="Asuc_0224"
FT   CDS_pept        260321..260884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0224"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: msu:MS0019 nTP
FT                   pyrophosphohydrolases including oxidative damage repair
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73604"
FT                   /db_xref="GOA:A6VKV7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV7"
FT                   /protein_id="ABR73604.1"
FT                   /translation="MTQQLPEILAVSVSAKSRIFEIQAVDLKFSNGELRTYERFTPASR
FT                   AAVMVVPIDGDDILMVREYAVGTERYELGFTKGLMEKDETPEQSANREMQEEIGLGARK
FT                   FRHLRTVNSNPSYMNNPMHILLAWDFYPSKLAGDEPEPLQLVRFPLARIDELIRDADFC
FT                   EARNLVALYALRDYLTDVHKKVRS"
FT   gene            complement(260931..261677)
FT                   /locus_tag="Asuc_0225"
FT   CDS_pept        complement(260931..261677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0225"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: msu:MS1568 DltE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73605"
FT                   /db_xref="GOA:A6VKV8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV8"
FT                   /protein_id="ABR73605.1"
FT                   /translation="MAILVTGASAGFGKSTCRTFVKAGYSVIGAARRLEKLDELKAELG
FT                   DKFYPLQMDVSDPAKVDAALASLPAEWSEIDLLVNNAGLALGLEPAYEVNFNDWLTMIQ
FT                   TNIVGLTYLTRQILPNMVQRNKGHIINLGSIAGNYPYPGGNVYGATKAFVKQFSLNLRA
FT                   DLAGTAVRVTNVEPGLCGGTEFSNVRFKGDDQKAASLYEGAHSIQPEDIANAILWIYQQ
FT                   PPHVNINRIEIMPVTQTFAGLKVTKD"
FT   gene            261798..262610
FT                   /locus_tag="Asuc_0226"
FT   CDS_pept        261798..262610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0226"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: hit:NTHI0687 CysQ"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73606"
FT                   /db_xref="GOA:A6VKV9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKV9"
FT                   /protein_id="ABR73606.1"
FT                   /translation="MQCTPDLLQAVIAISHQAGEHLKRFYTRSVYVHTKSDNTPVTEAD
FT                   LFVSRFLTEKLTALTPEIPVLSEENCEMPLEVRSTWREYWLIDPLDGTKHFINHTGQFA
FT                   ILIALIQHNRPTLGVIYAPITELTHYAMKNYGAFRLQQGCRKQLQARRLDLNKPLKIAI
FT                   GSESAITKVRSILNDNIRAEFVVHGSSGLKCTMVADGLADCYIRLGRTGEWDTAAGELL
FT                   LEELGGNALDEHYQPLTYNQRETFVNPDFVITADASVNWKNVFQFNLP"
FT   gene            262680..264167
FT                   /locus_tag="Asuc_0227"
FT   CDS_pept        262680..264167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0227"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="TIGRFAM: glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase; KEGG: msu:MS0016
FT                   glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73607"
FT                   /db_xref="GOA:A6VKW0"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW0"
FT                   /protein_id="ABR73607.1"
FT                   /translation="MKAENNCIVIFGASGDLTHRKLIPALYNLYKIGRLEENFSVLGVA
FT                   RTEMTDDIFREKMRTALITQENAEGETLDKFCSHLYYQAVNTSDSADYVKLLPRLDELH
FT                   DKYQTCGNTLYYLSTPPSLYGVIPECLAAHGLNTEEFGWKRIIVEKPFGYDIKTAKALD
FT                   IQIHRFFEEHQIYRIDHYLGKETVQNLLVLRFSNGLFEPLWNRNFIDYVEITGAEEIGV
FT                   EQRGGYYDGSGAMRDMFQNHLLQVLAMVAMEPPAIINADSMRDETAKVLYCLHPLTTED
FT                   LKHNLVLGQYTASTVDDKPVKGYLEEAGVPSDSGTETYMALRCQIDNWRWAGVPFYVRT
FT                   GKRLPTRVTEIVIHFKTTPHPVFSQNAPDNKLIIRIQPDEGISMFFGLKKPGAGFEAKE
FT                   VSMDFRYADISSSANLLTAYERLLLDAMKGDATLFARTDAVHACWKFVQPILDYKENQG
FT                   RVYEYEAGTWGPVEADKLIAREGRVWRRPSGSMKKKA"
FT   gene            264298..264999
FT                   /locus_tag="Asuc_0228"
FT   CDS_pept        264298..264999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0228"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   msu:MS0015
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73608"
FT                   /db_xref="GOA:A6VKW1"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW1"
FT                   /protein_id="ABR73608.1"
FT                   /translation="MNYITFPTARHAVEKIAQEFVLYSQLNRPVHISLSGGSTPKLLFK
FT                   TLAQAPFNTDVRWQNLHFWWGDDRMVPPTNPESNYGEVQKLLFDHIQIPAQNIHRIRGE
FT                   EPAEQELKRFEAELSAVVPDGVFDWIILGMGGDGHTASLFPHQTDFNDPNLAVIAKHPE
FT                   SGQIRISKTAKLIERAKRITYLVTGAAKAEILKQIQTTPAEQLPYPVARIQAKNGITEW
FT                   YLDADAAKLLN"
FT   gene            265027..265473
FT                   /locus_tag="Asuc_0229"
FT   CDS_pept        265027..265473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hit:NTHI1855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73609"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW2"
FT                   /protein_id="ABR73609.1"
FT                   /translation="MDKIYLASYKAKGNWVDKIIRFFTKGKYSHSELAIEKTEGAEKWF
FT                   EIYSSSPRDGGVRMKKMAELDPAKWDLIELTGITEQDVKAYYQKTKGMKYDFFGAIGTK
FT                   LLIRQSRSKMFCSEWVFNLLQKSTEGWRFDPNQLHAMFASNINN"
FT   gene            265512..266207
FT                   /locus_tag="Asuc_0230"
FT   CDS_pept        265512..266207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0230"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: msu:MS0014 RacX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73610"
FT                   /db_xref="GOA:A6VKW3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW3"
FT                   /protein_id="ABR73610.1"
FT                   /translation="MKTLGILGGMSPESTVSYYVNINRAVNRALGGNRSAKMLMSSVDF
FT                   EEIVQCQKAGDWQKAGEILAEQAKLLERAGADGILLATNTMHKVANRITDRISVPFLHI
FT                   LDVVANRIKARGLTHVALLGTAFTMSDNFYRDGLTQRGINAIVPDKKDQREIHRIIFDE
FT                   LCLGVIKPESKDFYLKTIEKLTALGARGVILGCTEIGLLINQTDSALPFFDTAALHSEM
FT                   AVDFVLEKE"
FT   gene            266217..266480
FT                   /locus_tag="Asuc_0231"
FT   CDS_pept        266217..266480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73611"
FT                   /db_xref="InterPro:IPR017167"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW4"
FT                   /protein_id="ABR73611.1"
FT                   /translation="MKPIVYFAPWCPDTAPFFAELERLHADVEKVDMVGNPAGLKAFLK
FT                   LRDNHPAFESVKQNGYIGIPALLLDNGDVVLDKDQLAAIFNK"
FT   gene            267356..268810
FT                   /locus_tag="Asuc_0232"
FT   CDS_pept        267356..268810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0232"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding; KEGG: msu:MS0013 6-phosphogluconate
FT                   dehydrogenase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73612"
FT                   /db_xref="GOA:A6VKW5"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW5"
FT                   /protein_id="ABR73612.1"
FT                   /translation="MSEKGDIGVIGLAVMGQNLILNMNDNGFKVVAFNRTTSKVDEFLQ
FT                   GAAKGTNIIGAYSLEDLAAKLEKPRKVMLMVRAGDVVDHFIDALLPHLEAGDIIIDGGN
FT                   SNYPDTNRRTQALAEKGVRFIGTGVSGGEEGARHGPSIMPGGNPEAWPYVKPILQAISA
FT                   KTDKGEPCCDWVGKEGAGHFVKMVHNGIEYGDMQLICEAYQFLKEGLGLSYEEMHEIFK
FT                   QWKTTELDSYLVDITTDILAYKDTDGQPLVEKILDTAGQKGTGKWTGINALDFGIPLTL
FT                   ITESVFARCVSSFKQQRVEASKLFNKTVSPVEGDKKVWIEAVRKALLASKIISYAQGFM
FT                   LIREASEQFDWNINYGATALLWREGCIIRSAFLGNIRDAYEANPDLVFLGSDPYFKGIL
FT                   ENAMADWRKVVAKSVEVGIPMPCMASAITFLDGYTSERVPANLLQAQRDYFGAHTYERT
FT                   DKPRGEFFHTNWTGRGGNTASTTYDV"
FT   gene            268926..269249
FT                   /locus_tag="Asuc_0233"
FT   CDS_pept        268926..269249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73613"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW6"
FT                   /protein_id="ABR73613.1"
FT                   /translation="MKKLLGIALTALTLAACSHHDRPEPMQGPMEQDAMVQGDMNQTAM
FT                   PQQGQQMPPRQGANPQVEEALKSCQQSVGSKPDQAKLDACMKEKGFVRPTQQPAPQTAP
FT                   VQK"
FT   sig_peptide     268926..268982
FT                   /locus_tag="Asuc_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.844 at
FT                   residue 19"
FT   gene            complement(269430..270122)
FT                   /locus_tag="Asuc_0234"
FT   CDS_pept        complement(269430..270122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0234"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="TIGRFAM: L-ribulose-5-phosphate 4-epimerase; PFAM:
FT                   class II aldolase/adducin family protein; KEGG: msu:MS0046
FT                   ribulose-5-phosphate 4-epimerase and related epimerases and
FT                   aldolases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73614"
FT                   /db_xref="GOA:A6VKW7"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW7"
FT                   /protein_id="ABR73614.1"
FT                   /translation="MLKELRERVLQANLELPKHKLITFTWGNVSEIDREKGLVAIKPSG
FT                   VDYDVMTVDDIVIVDLEGNHVWGDKKPSSDTATHLELYRQFPEIGGIVHTHSRHATAWA
FT                   QAGEDLIALGTTHGDYFYGAIPCTRKMTPEEIAGEYELETGKVIVETFRTRNINPQDIP
FT                   AVLVNSHGPFVWGKDGFNAVHNSVVLEEIAYMNAFSKLIRPNVQPMQQELLDKHYLRKH
FT                   GKNAYYGQ"
FT   gene            complement(270116..270976)
FT                   /locus_tag="Asuc_0235"
FT   CDS_pept        complement(270116..270976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0235"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="TIGRFAM: putative hexulose-6-phosphate isomerase;
FT                   PFAM: Xylose isomerase domain protein TIM barrel; KEGG:
FT                   msu:MS0047 SgaU protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73615"
FT                   /db_xref="GOA:A6VKW8"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW8"
FT                   /protein_id="ABR73615.1"
FT                   /translation="MRKHKLGIYEKALPKGISWQDRLSIAKACGFDFVEISIDETDERL
FT                   ARLDWTQEERIELVSAIIKTGVTIPSMCLSGHRRFPFGSHDETIRRKAYEIMEKAIKLA
FT                   VDLGIRTIQLAGYDVYYEERDESTLQRFQEGMEWATALAAGNEVTLAVEIMDTEFMSSI
FT                   TRWKKWDEIIKSPWFTVYPDVGNLSAWNDNVEEELTLGIDKISKIHLKDTYKVTETCKG
FT                   QFRDVPFGEGCVDFVNVFRILDKLNYRGAFLIEMWTEKSDEPIAEIINARRWIEQKMKE
FT                   GGLQC"
FT   gene            complement(271010..271756)
FT                   /locus_tag="Asuc_0236"
FT   CDS_pept        complement(271010..271756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0236"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; regulatory protein DeoR; KEGG:
FT                   pmu:PM0762 transcription regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73616"
FT                   /db_xref="GOA:A6VKW9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKW9"
FT                   /protein_id="ABR73616.1"
FT                   /translation="MNENYRHKQLLSLLDEKTVLSTTEIIRLLGVSPATARRDINKLNS
FT                   LGKLVKVRNGAEKISKGIELEQARNIRNLEEKRRIAQAASRLCRDGESVLLTCGSTMQV
FT                   LGDYLCGRKLQIITNYLPLANYLIQHDHDDVVIIGGQYDKNKQIMLSLNNQNEAIYAAN
FT                   IMFTSGKGFTTEGLYKTDMIIANSEQQMSSKANKYVVLLDSSKLGKQVGMLFNELKNID
FT                   ILITGKEADSAIIKALRDKGLEVILA"
FT   gene            complement(271859..272950)
FT                   /locus_tag="Asuc_0237"
FT   CDS_pept        complement(271859..272950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0237"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold"
FT                   /note="KEGG: msu:MS0023 predicted Zn-dependent hydrolases
FT                   of the beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73617"
FT                   /db_xref="GOA:A6VKX0"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKX0"
FT                   /protein_id="ABR73617.1"
FT                   /translation="MSKVNEITRESWILSTFPEWGTWLNEEIEQEEVPANNVAMWWLGC
FT                   VGLWVKTPGDANLCIDLWCGRGKATKKVKDMVRGHQMANMAGVRKLQPNLRNSVSVLDP
FT                   FAINNVDAIVATHYHNDHIDVNVAAAVIQNPALNHVKFIGPQYCVDMWKKWGVPEERCV
FT                   VVKPGDSVKIKDLELVALDSFDRTCLVTLPARGAEDNGGELNGICPSDEEMGLKAVNYL
FT                   IKTPGGNVYHSGDSHYSIYYAKHGKDYDIDVALGSYGENPLGIQDKMTSIDILRMAECL
FT                   RAKVVIPVHHDIWTNFTASTDEILALYRMRKDRLQYQFHPFIWEVGGKYVYPRDKDLVE
FT                   YHHPRGFDDCFEQEPNVPFKSIL"
FT   gene            273323..275095
FT                   /locus_tag="Asuc_0238"
FT   CDS_pept        273323..275095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0238"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; putative
FT                   sugar-specific permease SgaT/UlaA; KEGG: msu:MS0022
FT                   uncharacterized BCR"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73618"
FT                   /db_xref="GOA:A6VKX1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR017180"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKX1"
FT                   /protein_id="ABR73618.1"
FT                   /translation="MEIFMWINEQILSKAPLLLGIVACIGYILLKKDTATVIKGTIKTI
FT                   VGFMLVQVGAATLVQGFKPIIDNLAKFHGLTGAVIDPYTSMQATIQTMGENYAWVGYAV
FT                   LLALAINILFVIFRRFTGIRTIMLTGHIMFQQAGLVAVFYMIIGASMWETVIYTAVIMA
FT                   LYWGISSNIMYKATQSVTGGAGFSIGHQQQVASWIATKIAPKLGDKNDNVDHMDLPKWL
FT                   HIFHDSISATAIVMSVFFGIILLSFGLENLQSMAGKTHWTIYILETGLKFAVAIQVIVM
FT                   GVRMFVAELSEAFKGISERVIPNAVLAIDCAAIYAFSPNAMVFGFMWGAIGQFVAVGIL
FT                   LAVGAPILIIPGFIPMFFSNATIGVFSNHFGGWKAVMKICFVMGIIEVLGSAWVIQLLA
FT                   GQGTTFNGWMGMADWALLFPPILQGIVSIPFFFFILVALSLIYMYFASSKLRADEAAAA
FT                   AAGKTLEQMDGYGLEEEAETETMQAESVAEQDGVRPIRILAVCGSGQGSSMMMKMKIKG
FT                   YLDKRGIPNIMDSCAVTDYKGKLSEIDIIVASQHLADEIDVGEGKSVLGVKNMLNPNSF
FT                   GDELVELIKKHTEQ"
FT   gene            275166..275633
FT                   /locus_tag="Asuc_0239"
FT   CDS_pept        275166..275633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0239"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: hdu:HD1859 PTS
FT                   system Enzyme II-A permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73619"
FT                   /db_xref="GOA:A6VKX2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKX2"
FT                   /protein_id="ABR73619.1"
FT                   /translation="MLKESLIENNSIKLNQTAADWKEAIKIGTDLLVAAGTIEPRYYDH
FT                   IIDNIEKMGPYIILAPGLAMPHARPEEGVIKTSFALVTLKEPVAFQGEDEPVSVFITLA
FT                   GSDSDKHMEGLMEITQTLDDPDSESGVDLGKILRCQTNEEVLAVIDAALSE"
FT   gene            275696..276373
FT                   /locus_tag="Asuc_0240"
FT   CDS_pept        275696..276373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0240"
FT                   /product="3-dehydro-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.85"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   msu:MS0020 3-hexulose-6-phosphate synthase and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73620"
FT                   /db_xref="GOA:A6VKX3"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKX3"
FT                   /protein_id="ABR73620.1"
FT                   /translation="MSKPLLQIALDSLTLEKAVADAKQAENSVEIIEIGTILACAEGMK
FT                   AVSVLRALHPNHIIVCDLKTTDGGAILAKMAFEAGADWLTVSAAAHPATKAACKKVADE
FT                   FNAAHPDLKVKKEIQIEIYGNWTLDDAKDWVALGVQQAIYHRSRDAELAGKGWTPEDVE
FT                   LMKKLSDLGLQLSITGGIVPQDIHLFKEIANAKAFIAGRALVGEKGQQTAAAIREQINQ
FT                   YWA"
FT   gene            complement(276557..276773)
FT                   /pseudo
FT                   /locus_tag="Asuc_0241"
FT   gene            complement(277027..277728)
FT                   /locus_tag="Asuc_0242"
FT   CDS_pept        complement(277027..277728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0242"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   msu:MS2199 fKBP-type peptidyl-prolyl cis-trans isomerases
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73621"
FT                   /db_xref="GOA:A6VKX4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKX4"
FT                   /protein_id="ABR73621.1"
FT                   /translation="MKAAKNVVVSIAYQVRTEDGVLVDEAPANQPLEYLQGHNNLVIGL
FT                   EKALEGKEVGDKFEVRVKPEEGYGEYNENMVQRVPKDVFVGVDELEVGMRFIADTDMGP
FT                   LPVVITDVAETEVTVDGNHMLAGQELHFTVEVVATREATPEEIAHGHIHSGDHDHGHGG
FT                   CGCGGHGHDHEHGHGCCGGHGHDHEHGHVGCGGHGHHHDHEHAHGEGCCGGHGKKEGHG
FT                   HGGCGCGGHGH"
FT   gene            complement(277816..278514)
FT                   /locus_tag="Asuc_0243"
FT   CDS_pept        complement(277816..278514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0243"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   msu:MS2198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73622"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKX5"
FT                   /protein_id="ABR73622.1"
FT                   /translation="MKKLALILLAVPFALAAQPSERVAVNNRIDFSVEVQKEVPMDVLQ
FT                   VRLFVQEEGKDLKTLHKTVNEKIQSALSKIKAQQTVTIQSNQRNTAARYDGKGQKNGWI
FT                   ERADFVLESKDFYALSRLADEVSDQLSIESIQALLSAEAKAQLEDEMTQAVLVRFRSKA
FT                   EVIRTALQAKGYSLVQLNLPKINTERFEYDNMTATSLRMAKMETASVPVQLESGTTQIK
FT                   AVANATIDLQ"
FT   sig_peptide     complement(278464..278514)
FT                   /locus_tag="Asuc_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 17"
FT   gene            complement(278720..279148)
FT                   /locus_tag="Asuc_0244"
FT   CDS_pept        complement(278720..279148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0244"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260; KEGG:
FT                   hit:NTHI0823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73623"
FT                   /db_xref="GOA:A6VKX6"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKX6"
FT                   /protein_id="ABR73623.1"
FT                   /translation="MTHATPQELQAETREIIENLLNDGSDPNALYIIEHHIAHYDFDKL
FT                   EKIAVDAFKAGYEVSDAEELEDDNGKPLYCFDIVAEVELKAEIIDAQQQQLVPLVAKHG
FT                   GIYDGWGTYFEDPNADEDEYGEDGEFFDDEFADDDEKR"
FT   gene            complement(279205..279591)
FT                   /locus_tag="Asuc_0245"
FT   CDS_pept        complement(279205..279591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0245"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: msu:MS2196 large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73624"
FT                   /db_xref="GOA:A6VKX7"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKX7"
FT                   /protein_id="ABR73624.1"
FT                   /translation="MSFIKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVGDVVMPVL
FT                   GILTGGVDFKDMKMVLAEAVGETPAVTLNYGMFIQNVFDFIIIAFAIFLMIKAINKLKK
FT                   PAEEAPKGPSQEELLAEIRDLLKK"
FT   gene            complement(279672..281048)
FT                   /locus_tag="Asuc_0246"
FT   CDS_pept        complement(279672..281048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0246"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: pmu:PM1563 TRK system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73625"
FT                   /db_xref="GOA:A6VKX8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKX8"
FT                   /protein_id="ABR73625.1"
FT                   /translation="MKIIILGAGQVGTTLAENLVGEDNDITLVDNAEARLEHLQDKHDL
FT                   RVVRGVASSPAVLREAGAPDADLLVAVTSSDEVNMVACQVSYTLFNTPTKIARIRQNDY
FT                   LREKDKLFLPEVLPIDHIISPEKLVSDEVVRLIDYPGALQVAHFADQRISLVVCKAYYG
FT                   GPLVGYAISALREHMPHINCRIVSILRQDITIRPQGSTIIEAGDEVTFICETAYIKAVM
FT                   SELQRLEKPYKRVMIVGGGNIGASVAKRLEHSCIVKLIERDAAKAMVLSEKLSDTLVFH
FT                   GDASDQSLLFEEHIENIDAFISLTSDDEANIMASLLAKRLGAKKALVLIQRMAYINLIQ
FT                   GGAIDIAISPQQATISALLAHVRKGDTPNVATLRHGVAEALEVVVHGDEATSSVVGRKV
FT                   SELKLPNGAILGAILRQNDVIIAKKDVVLQDEDHVVVYVSDKKMVPDIEKLFQPSAFFI
FT                   "
FT   gene            281225..281857
FT                   /locus_tag="Asuc_0247"
FT   CDS_pept        281225..281857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0247"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   KEGG: msu:MS2064 pyridoxamine phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73626"
FT                   /db_xref="GOA:A6VKX9"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKX9"
FT                   /protein_id="ABR73626.1"
FT                   /translation="MELHDIREDYTKRELSEKHCAADPIKQFEKWLKEAIWAKVNEPTA
FT                   MNIATVGENGKPTSRVVLLKEVNAQGFVFFTNYLSRKGKSLAANPFAALNFFWPELERQ
FT                   VRVEGHVVKLDEIKSDEYFASRPYTSRVGAWASEQSAVISGKNVLLAKAALVAAQHPLN
FT                   VPRPPHWGGYIVEPDTIEFWQGRPSRLHDRIRYRLENQIWVKERLSP"
FT   gene            281866..282117
FT                   /locus_tag="Asuc_0248"
FT   CDS_pept        281866..282117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0248"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339; KEGG:
FT                   hso:HS_1604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73627"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKY0"
FT                   /protein_id="ABR73627.1"
FT                   /translation="MEYNKLRLEWDCRRGMLELDKVIMPFYQQHFEALPDEKKAVFVRL
FT                   LACSDLQLFSWFFNRTSAPDAELQAMVDEIHQKLNITS"
FT   gene            282228..282803
FT                   /locus_tag="Asuc_0249"
FT   CDS_pept        282228..282803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0249"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-70 RpoE type; PFAM: sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: msu:MS2228 DNA-directed RNA polymerase specialized
FT                   sigma subunits, sigma24 similarity"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73628"
FT                   /db_xref="GOA:A6VKY1"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKY1"
FT                   /protein_id="ABR73628.1"
FT                   /translation="MAEQLTDQALVERVQQGDKKAFNLLVSRYQNKVAGLLTRYISRND
FT                   IPDVVQESFIKAYRSIESFRGESAFYTWLYRIAVNTAKNYLTAQGRRPPNEDILAEDAE
FT                   SYDVGGNLRGVDTPENELLSNELRKVVFDTIEGMQEELKTAITLRELEGLSYEEIAEIM
FT                   DCPVGTVRSRIFRAREILENKINPLLQR"
FT   gene            282826..283389
FT                   /locus_tag="Asuc_0250"
FT   CDS_pept        282826..283389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0250"
FT                   /product="anti sigma-E protein, RseA"
FT                   /note="PFAM: Anti sigma-E protein RseA family protein; Anti
FT                   sigma-E protein RseA domain protein; KEGG: msu:MS2229
FT                   negative regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73629"
FT                   /db_xref="GOA:A6VKY2"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKY2"
FT                   /protein_id="ABR73629.1"
FT                   /translation="MQKELLSAYMDGENVSNALTAELCRDAELQKSWGNFHTIRSVMRD
FT                   ETAVFLGADFTAKMEALIDAEPAMISQPTPEEAKTLPFMQKIKATFAPMMQVAVAAGVC
FT                   LVAVLGVQSFNASQADKTEDTPVLQTLPFNNSVRAVSYNAPEKDIVTSQQLEQKNKRIG
FT                   ALLQNYELQRRVNAEGVDISQQQK"
FT   gene            283472..284428
FT                   /locus_tag="Asuc_0251"
FT   CDS_pept        283472..284428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0251"
FT                   /product="sigma E regulatory protein, MucB/RseB"
FT                   /note="PFAM: MucB/RseB family protein; KEGG: pmu:PM1787
FT                   sigma-E factor regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73630"
FT                   /db_xref="InterPro:IPR005588"
FT                   /db_xref="InterPro:IPR033434"
FT                   /db_xref="InterPro:IPR033436"
FT                   /db_xref="InterPro:IPR038484"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKY3"
FT                   /protein_id="ABR73630.1"
FT                   /translation="MLKILQKPTALFACLLSFLLAAPVWAGEELSPQQLLNSMTQAEQQ
FT                   LNYQFIFVQNDNGNNHALQYRYSLKENKKYAQMTTMDGVKRDIIQRDDMVSYFRPQMAP
FT                   FTLKSKYIVDNLPPLMQANFNKLAKYYDFTALGRNRIADRMVQMVRITPKDNFRYRYVA
FT                   FIDEETHLLLRSDLLDQDGVLLDQFRIIQLAVSETPLPFVESVEQLPFPPLISAQSRPG
FT                   KSSNWKLNWLPQGFRQIRKTETTDDEGNNTESRFYSDGLFTFEIFVSDGQKDEAQNSSL
FT                   RHGAVTIYSETVNDKEITLIGQLPIGTAKRIVQDLKF"
FT   sig_peptide     283472..283552
FT                   /locus_tag="Asuc_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            284444..284878
FT                   /locus_tag="Asuc_0252"
FT   CDS_pept        284444..284878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0252"
FT                   /product="positive regulator of sigma E, RseC/MucC"
FT                   /note="PFAM: Positive regulator of sigma(E) RseC/MucC;
FT                   KEGG: msu:MS2231 positive regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73631"
FT                   /db_xref="GOA:A6VKY4"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKY4"
FT                   /protein_id="ABR73631.1"
FT                   /translation="MMTETAVVVYYDDGKATVKCQTKSACGNCTARNACGTAALAGLTG
FT                   EQGEHLFAVETLTPVKRGQLVEIGLPERSLMASAFWLYAVPLVTLLIATFVGEAWLPNE
FT                   LIRTIFIFFLTALSFIIVKIFTRKAARKSAFQPVLLRIIG"
FT   gene            complement(284949..286331)
FT                   /locus_tag="Asuc_0253"
FT   CDS_pept        complement(284949..286331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0253"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: msu:MS0237 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73632"
FT                   /db_xref="GOA:A6VKY5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKY5"
FT                   /protein_id="ABR73632.1"
FT                   /translation="MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIEGSIGWSKALV
FT                   SVNILTQDEQRQLEKALNELLIEVRSNPQAILQDDAEDIHSWVESKLIDKVGNLGKKLH
FT                   TGRSRNDQVALDIKMWCKAQVLELQKTVRELQAKLVLTAENTQHAVMPGYTHLQRAQPI
FT                   SFAHWCMAYVEMLERDYTRLGDAYQRMNACPLGSGALAGTAYPIDREQLAQDLDFASAT
FT                   RNSLDSVSDRDHIIELLSTASLSMAHLSRFAEDMIIFNSGEADFVELSDRVTSGSSLMP
FT                   QKKNPDACELIRGKTGRVIGSLMGMLTTVKGLPLAYNKDMQEDKEGIFDALDTWHDCLT
FT                   MAAFVLEDIKVNVERTREAALKGYSNATELADYLVAKGVPFRDSHHIVGETVVYAIKVH
FT                   KGLEDLTVDEFRQFSDVVSDDVYDILSLQSCLDKRCAKGGVSPLRVAEAIADAKQRIGL
FT                   NA"
FT   gene            complement(286414..287187)
FT                   /locus_tag="Asuc_0254"
FT   CDS_pept        complement(286414..287187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0254"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: msu:MS0236
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73633"
FT                   /db_xref="GOA:A6VKY6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKY6"
FT                   /protein_id="ABR73633.1"
FT                   /translation="MRPLVIKLGGILLDTPAAMENLFNALAKYLQNSDRSLLIVHGGGC
FT                   VVDDLMKRLNLPVRKKNGLRVTPSDQIDIIVGALAGIANKTLVAQAAKFKLNPVGLCLG
FT                   DGELTAAKQFDPELGHVAGVIARNPALLDNLLSGGFLPIISSIAVDENGLLMNVNADQA
FT                   ATAIASLIDADLVMLSDVDGVLDADKTLLSELNSAQIARLIENKVITDGMIVKVNAALD
FT                   AAKILNRGVDIANWKYPEKLTALFAGEIIGTRIAP"
FT   gene            complement(287267..288277)
FT                   /locus_tag="Asuc_0255"
FT   CDS_pept        complement(287267..288277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0255"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region; KEGG:
FT                   msu:MS0235 acetylglutamate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73634"
FT                   /db_xref="GOA:A6VKY7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKY7"
FT                   /protein_id="ABR73634.1"
FT                   /translation="MAQKAIVVGASGYTGAELAKILTRHPEFELAGLYVSTHSADANKP
FT                   ISALYPQLRTICDLPLQPLPEDLTDIAQNADLAFFGTAHEVSHNLVPVFLKNGCKVFDL
FT                   SGAFRVDNGEFYRQYYGFEHQYPELLKQAVYGLAEWNREKIAQTNLVAVAGCYPTVSQL
FT                   SLKPLIENELLDPDQLPVINAVSGVSGAGRKASLTSSFCEVSLNAYGVFNHRHQPEIAT
FT                   HLATEVIFTPHLGNFKRGILATITAKLKAGVTEQQIRAAYRQYYNGCPLVRVYEQGLPS
FT                   IKAVEFTSYCDIGFATKNGHIIIVGAEDNLLKGAAAQAVQCANIRYGFDEVSGLI"
FT   gene            288380..289522
FT                   /locus_tag="Asuc_0256"
FT   CDS_pept        288380..289522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0256"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   msu:MS0233 acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73635"
FT                   /db_xref="GOA:A6VKY8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKY8"
FT                   /protein_id="ABR73635.1"
FT                   /translation="MKSHPQFLDMYSQLIAIPTVSDIDKNNDISNRTLIELLANWLADL
FT                   GFKTDILPVEGSNDKYNLLATYGQGEGGLLLAGHTDTVPFDQGRWTFDPFKLTEQNGKF
FT                   YGLGSADMKGFFAFVLDAVQQIDLTKLTKPLRILATADEETTMLGTRTFVKHTHIRPDC
FT                   AIIGEPTSLRPVRAHKGHIGKGLRIVGKSGHSSDPSKGINAIELMHEATGYLLQMRNEL
FT                   REKYHHADFEIPYPTMNLGAIHGGDAVNRICACCELHFDIRPLPKMRLEDLDEMLRQKL
FT                   APMFAQYGDRISIRNLHEPTPGYECEHSAQVVRVVEKLLGEKCEVVNYCTEAPYIQELC
FT                   PTLVLGPGSIEQAHQPDEFLSAEFIRPTRDLLTKLIQHFC"
FT   gene            complement(289667..290581)
FT                   /locus_tag="Asuc_0257"
FT   CDS_pept        complement(289667..290581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0257"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; PFAM:
FT                   sugar isomerase (SIS); KEGG: msu:MS1987 predicted sugar
FT                   phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73636"
FT                   /db_xref="GOA:A6VKY9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKY9"
FT                   /protein_id="ABR73636.1"
FT                   /translation="MTEQNLLQSLAQMVTEQRNANSIDIDRLNAAEIVKIINQEDKSVP
FT                   FAVEQCLPQIALAVEKIVTAFRQGGRLVYIGAGTSGRLGVLDASECPPTYGVPSDMVVG
FT                   IIAGGERALRHPIEGAEDNPQQGQADLENIHFTAKDVLVGIAASGRTPYVIGALNYAKS
FT                   LDAVTVAITGNPGSAMTQIADIAIEAVVGQEVLTGSSRMKSGTAQKLVLNMLTTASMIL
FT                   MGKCYQNLMVDVQASNEKLRARAVRIVMQATECSKDVAQETLQRADNNAKLAIMMVLSG
FT                   LEKTDAAQVLDRHQGKLRQALAQ"
FT   gene            complement(290583..291692)
FT                   /locus_tag="Asuc_0258"
FT   CDS_pept        complement(290583..291692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0258"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   hin:HI0753 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73637"
FT                   /db_xref="GOA:A6VKZ0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ0"
FT                   /protein_id="ABR73637.1"
FT                   /translation="MNNYYLGMMSGTSLDGVDLALVDFNHDTARIVAVGFMPMPENLRQ
FT                   KLTALLHEGHSSLQNLGEIDHQLGLLYAQSANQFLAEHTVSAEQVRAIGCHGQTIWHSP
FT                   HGDFPFSMQIGDMNLVAAQTGIAVVADFRRKDMAYGGQGAPLVPAFHQAVFASPQYLTV
FT                   VLNIGGISNISILNPHAVTTGYDIGPGNTLLDAWIERHLGRRYDKNGEWAKTGTINQTL
FT                   LNALLNEPFFRRTAPKSTGRELFNLPWLVKKYPNLTALSAQDVQRTLVELTVQSITREL
FT                   NRIHTVLPCRLLVCGGGAHNPLILQGLKTGLPHWQTAITTEYGMHADYVEAAAFAWLAY
FT                   CRMNRLPSNLPAVTGAASAVSLGVIYPKE"
FT   gene            complement(291748..293592)
FT                   /locus_tag="Asuc_0259"
FT   CDS_pept        complement(291748..293592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0259"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: msu:MS0394 ABC-type multidrug/protein/lipid transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73638"
FT                   /db_xref="GOA:A6VKZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ1"
FT                   /protein_id="ABR73638.1"
FT                   /translation="MINKIFTWFESRIDAYPDGQPDPPREGLGGFIWSSLDGLKGWIAF
FT                   FAFLTIGTGVIEAMLFQFMGKIVDWLGTYTPATLWSEKGHYLIGMMLVLVLSIGWTFLT
FT                   SAVRLQTLQGVFPMRLRWNFHRLMLGQSLSFYQDEFAGRVSAKVMQTALAVRDTVLTVA
FT                   NMVVYVGVYFITSGAILIAFDGWLLVPFIIWIGIFTCILYFLIPKLARTAERQADARSL
FT                   MTGRVTDAYSNITTVKLFSHGAREAAYAKSSMEEFMVTVHAQMRLATVLDTLTYASNIF
FT                   LTLSTAILGIMLWYQGAVGVGAIATATAMALRVNGLAHWIMWESARLFENIGTVNDGMT
FT                   TLSKPHTIVDKPNASPLMVKQGEIKFDHVNFAYSPDKPLLQDFNLTIKPGEKVGLIGRS
FT                   GAGKSTIVNLLLRFYEAQNGTITIDGQNVLDVKQESLRAQIGLVTQDTSLLHRSVRDNI
FT                   IYGRPDATEADMISAAERAEAADFIPLLSDAQGRRGYDAHVGERGVKLSGGQRQRIAIA
FT                   RVMLKDAPILLLDEATSALDSEVEAAIQESLDKMMENKTVIAIAHRLSTIAAMDRLIVL
FT                   DQGKIVEQGSHAELLAQHGLYAKLWQHQSGGFLTEHDD"
FT   gene            complement(293721..294200)
FT                   /locus_tag="Asuc_0260"
FT   CDS_pept        complement(293721..294200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0260"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: msu:MS2242
FT                   uncharacterized BCR"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73639"
FT                   /db_xref="GOA:A6VKZ2"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ2"
FT                   /protein_id="ABR73639.1"
FT                   /translation="MDTESRPSNLQLALGYVVNLLARREYSEYEIRCKMQEKAFDEEDI
FT                   EAVIAHCQQKNWQSDRRFTENYLNFRAQRGYGPVRIKQELRQLKGISSDIIEEVLLESD
FT                   IDWSQIARLVLDKKFPAFREKQNPQAKQKIWRYMLSHGFHSDDFADFIGNGDSFD"
FT   gene            complement(294358..295461)
FT                   /locus_tag="Asuc_0261"
FT   CDS_pept        complement(294358..295461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0261"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: msu:MS2243 RecA/RadA recombinase; TIGRFAM:
FT                   recA protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73640"
FT                   /db_xref="GOA:A6VKZ3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ3"
FT                   /protein_id="ABR73640.1"
FT                   /translation="MATPNDKTKPSAEEKSKALAAALGQIEKQFGKGAIMKLGDRPDMD
FT                   VESVSTGSIGLDVALGIGGLPMGRIVEIFGPESSGKTTLTLSVIAQAQKAGKVCAFIDA
FT                   EHALDPIYAAKLGVDVKELFISQPDNGEQALEICDALVRSGAIDVIIVDSVAALTPKAE
FT                   IEGDMGDAHVGLQARLMSQALRKLTAQIKSSNCLVVFINQIRMKIGVMFGNPETTTGGN
FT                   ALKFYSSVRLDIRRIGSVKAGDEIIGNETRVKVVKNKLAAPFRTVDFQIMYGEGISKNG
FT                   ELIELGVKQKLVQKSGAWFAYEGQKIGQGKANAMKWLADNPEKAAELESKIRAEFQENP
FT                   EKTLIAELDGSGKNTELDDSEDTVNFE"
FT   gene            complement(295673..296539)
FT                   /locus_tag="Asuc_0262"
FT   CDS_pept        complement(295673..296539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0262"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="TIGRFAM: DNA adenine methylase; PFAM: D12 class N6
FT                   adenine-specific DNA methyltransferase; KEGG: msu:MS1967
FT                   site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73641"
FT                   /db_xref="GOA:A6VKZ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ4"
FT                   /protein_id="ABR73641.1"
FT                   /translation="MTKHIRKTKPTKYRSFLKWAGGKYRLTDDINSLLPKKKKCLVEPF
FT                   VGAGSVFLNSHYERYILADINPDLINLFNVLKQDVECYIAALKPVFFHPNANTPDYYYA
FT                   RREEFNQSGDVFLRSVLFVYLNRFGFNGLCRYNANNEFNVPFGSHKTHYFPENEMRYFA
FT                   QKAQSAVFICGDFQETFLLADEHSVIYCDPPYAPLHQDSNFTKYAGNNFSLEHQKALAD
FT                   LAHQTRIERRIPVVISNHDTRFTREIYQKAELKKIRVQRSISRKSERRLKVNELIAVFN
FT                   PKRNIMP"
FT   gene            complement(296545..297633)
FT                   /locus_tag="Asuc_0263"
FT   CDS_pept        complement(296545..297633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0263"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: msu:MS1968
FT                   3-dehydroquinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73642"
FT                   /db_xref="GOA:A6VKZ5"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKZ5"
FT                   /protein_id="ABR73642.1"
FT                   /translation="MQCVNVELKERRYPIYIGEGLLTDSSVYPLKSGDKVMIVTNETIA
FT                   PLYLETVTDTLNQIGCQVSHVLLKDGEKYKTLGSLNQIFTALLQENHGRDTTLIALGGG
FT                   VIGDVAGYAAASYQRGIKFIQIPTTLLSQVDSSVGGKTAVNHELGKNMIGAFYQPITVI
FT                   IDTTTLNTLPKREVNAGLAEVIKYGAILDYPFFEWLERHIDNLVALNQQDLQYCIARCC
FT                   RIKADVVARDETEKGDRALLNLGHTFGHAIETHLGYGNWLHGEAVAAGSMMAAALSEKL
FT                   GNLARTDVARVEKLFARANLPTLSPDGMQPEDYLPHMMRDKKVLAGKLRLVLLKALGQA
FT                   YVATDTDPALVLDAIYACTQTD"
FT   gene            complement(297707..298234)
FT                   /locus_tag="Asuc_0264"
FT   CDS_pept        complement(297707..298234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0264"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: pmu:PM1224 shikimate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73643"
FT                   /db_xref="GOA:A6VKZ6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKZ6"
FT                   /protein_id="ABR73643.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLGMEFFDSDSVIEERAGA
FT                   EISWIFDIEGENGFRKREERIINELTQKQGIVLSTGGGVVLSKENRNHLSARGIVVYLQ
FT                   TTVAKQFERTQRDKKRPLLQGVEDARQVLENLAVIRNPLYEEVADITLPTDEQSAKVMA
FT                   NQIIDLIDNFHG"
FT   gene            complement(298524..300530)
FT                   /locus_tag="Asuc_0265"
FT   CDS_pept        complement(298524..300530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0265"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: msu:MS0057
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73644"
FT                   /db_xref="GOA:A6VKZ7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ7"
FT                   /protein_id="ABR73644.1"
FT                   /translation="MADQKQLANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRGFM
FT                   KHNPSNPKWADRDRFVLSNGHGSMLIYSLLHLTGYDLSIEDLKNFRQLHSKTPGHPEYG
FT                   YAPGVETTTGPLGQGITNAVGMAIAEKTLAAQFNREGHDIVDHHTYVFLGDGCLMEGVS
FT                   HEACSLAGTLGLGKLIAFYDDNNISIDGHVDGWFTDNTKGRFEAYGWQVIDNVDGHDPE
FT                   QIAAAVKLAQAETEKPSIIICKTIIGYGSPNKSASHDCHGAPLGEEEIALTRKALGWNY
FT                   APFEIPADIYAAWDAKAAGQAAEAAWNEKFAAYAKAYPELATEFTRRVNGELPANWAAE
FT                   SQAFIEKLQANPAAIASRKASQNAIEAYARILPEFLGGSADLASSNLTLWSGSKPIRAK
FT                   ENTDGNYINYGVREFGMSAIMNGIALHGGFIPYGATFLMFYEYAHNAVRMAALMKQRAL
FT                   FVYTHDSIGLGEDGPTHQPVEQTAALRLIPNLNVWRPADQVESAVAWKEAVERQDGPSA
FT                   LIFTRQNLAQQDRTSAQLANVARGGYILRECCEKGDCPDLILIATGSEVELAMKAADVL
FT                   DAEGVKVRVVSMPSTNVFDKQDEAYRESVLPSSVTKRVAIEAQIADFWYKYVGLEGRII
FT                   GMNRFGESAPAEQLFKLFGFTVENVVAKAKEIL"
FT   gene            complement(300592..300865)
FT                   /pseudo
FT                   /locus_tag="Asuc_0266"
FT   gene            complement(300974..301762)
FT                   /locus_tag="Asuc_0267"
FT   CDS_pept        complement(300974..301762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0267"
FT                   /product="Transcriptional regulator IclR"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: msu:MS0055 IclR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73645"
FT                   /db_xref="GOA:A6VKZ8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ8"
FT                   /protein_id="ABR73645.1"
FT                   /translation="MEKNNGNQSLIRGLRLIEILSRFPNGCSLLQLSNVAELNKSTVHR
FT                   LLQGLQQEGFVQPSTRIGSYRLTSKCLSIGQKMLSSVNIISLVSPYLETLNLELGETVN
FT                   FSMRENNHAIMIYKLEPTMGIMRTRAYIGQHLQLYCSAMGKLYLAYDQAAYLDRYWQEN
FT                   ETQIKMLTCNTITKLPLMKKELEEVKKLGFAVDREENEIGISCIACPIFDSQNHVKYAL
FT                   SVSISTAKLQQYGIDFLLNKIKPTAQLISQELGWTVNSRD"
FT   gene            301939..302937
FT                   /locus_tag="Asuc_0268"
FT   CDS_pept        301939..302937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0268"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   msu:MS0054 malate/L-lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73646"
FT                   /db_xref="GOA:A6VKZ9"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKZ9"
FT                   /protein_id="ABR73646.1"
FT                   /translation="MKVSYEELKAEFKRVLLSRNVREDIAEECATVFADTTQAGAYSHG
FT                   VNRFPRFIQQLENGDIKPEAQPTKELSLGAIEQWDAHQAIGNLTAKKMMDRAMELAAQN
FT                   GVGIVALRNANHWMRGGSYGWQAAEKGYIGICWTNALAVMPPWGAKECRIGTNPLIVAV
FT                   PTTPITMVDMSCSMYSYGMLEVHRLQGCQTFVDAGFDDNDNPTRDPATVEKNRRLMPMG
FT                   FWKGSGLSIVLDMIATLLSNGESTAAVTEDKDDEYCVSQVFIAIEVDRLIDGKTRDEKL
FT                   NRIIDYVKTAEPVDPNQPVRLPGHEFTTILADNMANGIPVNDTVWAKLKSL"
FT   gene            303040..303513
FT                   /locus_tag="Asuc_0269"
FT   CDS_pept        303040..303513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0269"
FT                   /product="conserved hypothetical protein 22"
FT                   /note="PFAM: conserved hypothetical protein 22; KEGG:
FT                   msu:MS0053 EbgC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73647"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL00"
FT                   /protein_id="ABR73647.1"
FT                   /translation="MIFGHISNVNPNPYPQAIRLALEYLTKTDFDAMTPGRYSLKGDKI
FT                   YVQVLDLETKPKAEYLPEIHRTFIDVQYLHAGTEIMAVSPDLGNNPVAIEYDPERDILY
FT                   YAEVENEQELHCQPGNFAVFFPEDTHRAAIYDGSGKIRKIVVKIALSEIEESL"
FT   gene            303510..303992
FT                   /locus_tag="Asuc_0270"
FT   CDS_pept        303510..303992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0270"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: msu:MS0052 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73648"
FT                   /db_xref="GOA:A6VL01"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL01"
FT                   /protein_id="ABR73648.1"
FT                   /translation="MNALAHFVKKAIEVICVIILSAMSILVFVNVVLRYGFNSSINITE
FT                   EVSRYMFVWLAFLGAVLAFNDNQHVRVTVFVEKLSPVARKLLHIVTDAAMLFCCYLIVD
FT                   GSWLQFNLNLNNLAPISGLPQGITYLASTIAGMLIGILIIARMITGIFTLNKGEAK"
FT   gene            303989..305266
FT                   /locus_tag="Asuc_0271"
FT   CDS_pept        303989..305266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0271"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: msu:MS0051
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73649"
FT                   /db_xref="GOA:A6VL02"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL02"
FT                   /protein_id="ABR73649.1"
FT                   /translation="MTVVIFLSVLLSAIILGIPVAFSLLVCGVALMLHLDLFDSQILAQ
FT                   QIVSGADSFSLMAIPFFILAGELMNEGGLSKRIIDLPMKLVGHKRGGLGFVAILAAMIM
FT                   ASLSGSAVADTAAVAAMLLPMMKTTGYPEARSAGLIGTAGIIAPIIPPSIPFIVFGVAS
FT                   GVSITKLFLAGIFPGIFMGLCLGLLWWWQAKRLNLMTFSKATRQDLCISFKNSIWALLL
FT                   PVIIIGGFRTGIFTPTEAGAVATFYALIVSLFVYRELKFKDLYKVVLAASKTTAVVMFL
FT                   VAAANVTGWLITVAELPMMLTELLEPLIETPTTLLLVVMLAVFVVGMVMDLTPTVLILT
FT                   PVLMPLIQEAGIDPVYFGVLFILNTSIGLITPPVGNVLNVITGVSKLPFDKAARGIMPY
FT                   LIMMIMLLLLFVFFPSLVLVPLSWMQ"
FT   sig_peptide     303989..304075
FT                   /locus_tag="Asuc_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.364 at
FT                   residue 29"
FT   gene            305339..306325
FT                   /locus_tag="Asuc_0272"
FT   CDS_pept        305339..306325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0272"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: msu:MS0050 DctP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73650"
FT                   /db_xref="GOA:A6VL03"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL03"
FT                   /protein_id="ABR73650.1"
FT                   /translation="MKLFNLKTLAALVAGIAVMSGSASAETSFRFGYEAPRSDTQHIAA
FT                   KKFAELLKEKTKDEIKLKLFPDSTLGNAQTMISGVRGGTIDIEMSGSPNFTGLEPKLNV
FT                   IDIPFIFKDRDHAFKVLDGEIGQGLLKDLEAQGLKGLAYWDVGFRAFSNSKHSVSKPED
FT                   IKGLKVRTNQNPMYIEAFTLLGSNPVPMPLSELYTALETRAVDAQEHPVGIFWSSKLYE
FT                   VQKFLSLTNHGYTPLIVVMNKAKFDALSPELQQAVLESAKEAGAYQRELNIKNEKEIIE
FT                   NVRKEGVEVTEQVDQAPFKAVIEEKVRKTFIDKYGKELVEQIDALAK"
FT   sig_peptide     305339..305416
FT                   /locus_tag="Asuc_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            306385..307374
FT                   /locus_tag="Asuc_0273"
FT   CDS_pept        306385..307374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0273"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: msu:MS0049 DctP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73651"
FT                   /db_xref="GOA:A6VL04"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL04"
FT                   /protein_id="ABR73651.1"
FT                   /translation="MKLFSLTKLTALIAGMTLFSAVSAQAETALRFGYEAPRSDTQHIA
FT                   AKKFNDLLKEKTSGEIKLNLFPDSTLGNAQTMISAVRGGTVDLEMSSSSNFTGLVSALN
FT                   VIDIPFIFKDRAHAYKVLDGEIGRNLLAQLDAHGLKGIAFWEVGFRGFTNSKHPVTKPE
FT                   DIKGLKVRTNQNPMYIKAFSILGANPVPMPLSELYTALETKAVDAQEHPIGIVWSSKLY
FT                   EVQKYFSFTNHGYTPLIVVMNKAKFDALSPELQKAIVDAAEEAGKYQRQLNLDNEQGIV
FT                   EKMKKAGIEFVDNLDTAPFKAAVEQETRKAFIDANGDSLIKQIDALGE"
FT   sig_peptide     306385..306465
FT                   /locus_tag="Asuc_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 27"
FT   gene            307447..308904
FT                   /locus_tag="Asuc_0274"
FT   CDS_pept        307447..308904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0274"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: msu:MS0048
FT                   sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73652"
FT                   /db_xref="GOA:A6VL05"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL05"
FT                   /protein_id="ABR73652.1"
FT                   /translation="MNYYLGIDCGGTFVKAALFDETGNLQGIARENVPVMSDKAGYAER
FT                   DMPQLWQVCADVVRQTIAESNISPDFIKGVGISAQGKGAFLLDKNKKPLGRAILSSDQR
FT                   SLDIVKQWQQKGIPEKLYPLTRQTLWTGHPVSILRWLKENEPDRYARIGSVLMSHDYLR
FT                   FCLTGELHCEETNISESNLYNMEKGRYDPVLADLLGLEGIIEKLPPVIRSDQIAGYVTQ
FT                   QAAELTGLKAGTAVAGGLFDVVSTALCAGLEDETKLNTVFGTWCVVSGITDHIAANQSL
FT                   PFVYGRYAEKNKFIVHEASPTSAGNLEWFVKQWNLDYGQINEEIAALPPAASSVLFVPF
FT                   LYGSNAGLGMQAGFYGIQSHHKQAHLLQAVYEGVLFSLMYHLDRILQRFPHTNVLRVTG
FT                   GSAKSAVWMQMLADFTGMTLEIPKVEETGCLGAAAIAMQSSGVTLNFSKVLNKGMTVVQ
FT                   PNPDNYAAYQQKYRRYVKFTTALKAML"
FT   gene            complement(309022..310008)
FT                   /locus_tag="Asuc_0275"
FT   CDS_pept        complement(309022..310008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0275"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: msu:MS0521
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73653"
FT                   /db_xref="GOA:A6VL06"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL06"
FT                   /protein_id="ABR73653.1"
FT                   /translation="MRALKQISHYLTKFTALFIILTACITFYAPELFTWVKGDAQVLVL
FT                   GVIMLSMGMTLGANDYKILAQRPFDIFVGSIAQYTIMPFIAITIANVFNLSPGLTLGLV
FT                   LVGCCPGGVSSNIMSLLCKGDVAFSVGMTTVSTIIAPVMTPILISYLVGESIDMDGWAM
FT                   FKFMLLVTILPVGLGSAFNIFFHKRKWFHDVQATMPGVAVIGFACIVGGVVAVHGSKFL
FT                   ESGLIIFVCIACHNAIGYVLGYSAGKLFGMNTAKKRTLSIEVGVQNAGLATGLSSKFFP
FT                   TSAESAIACAVSCVWHSISGTVLANFYLWLDKKQGKPVSTVHSVAES"
FT   gene            complement(310362..311267)
FT                   /locus_tag="Asuc_0276"
FT   CDS_pept        complement(310362..311267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0276"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   msu:MS2333 MscS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73654"
FT                   /db_xref="GOA:A6VL07"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL07"
FT                   /protein_id="ABR73654.1"
FT                   /translation="MAAEQAQEAVPAINVQEQASKMIDTVSSMNMDTLLYDWIIPYGTK
FT                   ILLALAIYVVGKWIARFISKLLGKAALASSKDEMLQSFVSSISYFLLLLIVVIAALSQL
FT                   GINTSSLVALIGAAGLAVGLALQNSLQNFAAGVMLLVFKPFRKGDLIETGGMTGTVEQM
FT                   GLLVLELRTADNKTVLIPNGKVFSDSIVNNSANKTRRIDFIFDIAYDADIAAAKAIVAR
FT                   VLDEDPRVLKTPAPTIAVGALAASSVQLFVRPWVNTPDYWGVHFDVTEQIKLEFDKAGI
FT                   EIPFAQMDLHLPENTTISMK"
FT   gene            complement(311359..312303)
FT                   /locus_tag="Asuc_0277"
FT   CDS_pept        complement(311359..312303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0277"
FT                   /product="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hin:HI0645
FT                   lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73655"
FT                   /db_xref="GOA:A6VL08"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL08"
FT                   /protein_id="ABR73655.1"
FT                   /translation="MYREPHFGKFALSRLLPFAEQFPVQYIDGQNHCRVAYRHFHHQTH
FT                   RKLVILVNGRAENLLKWTEVAYDFYHRGYDVLAFDHRGQGFSQRLLRDKQKGYLDEFRF
FT                   YAADMAKIIEKNTALFSYQTQHILAHSMGGLISAYYLADYDHHISNAVFCAPFFGMPLK
FT                   RPIRDQAIIGLMLLFGQGERYVFGKKPYRPVNVSVNDLSSCATRMKWMNRVNRKHPELG
FT                   LGGPTFRWVHLCLQAIRRLPQILPKIDIPVLILQSEREKIVANKNLENLTALLRQGKLE
FT                   RIPLAKHEILFEKDDVRENALQKIWTFMDNPLN"
FT   gene            complement(312372..313484)
FT                   /locus_tag="Asuc_0278"
FT   CDS_pept        complement(312372..313484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0278"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; KEGG: msu:MS0006
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73656"
FT                   /db_xref="GOA:A6VL09"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL09"
FT                   /protein_id="ABR73656.1"
FT                   /translation="MKNVGFIGWRGMVGSVLMDRMQQERDFANLNPIFFTTSQAGQQAP
FT                   VFGGKEAGTLKDAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRM
FT                   EKDSIIVLDPVNQHVISDGLKNGVKTFVGGNCTVSLMLMALGGLFERDLVEWISVATYQ
FT                   AASGAGAKNMRELVSQMGLLEKSVSAELANPASSILDIERKVTAEMRADSFPTDNFGTA
FT                   LAGSLIPWIDKLLPSGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFT
FT                   IKLKKDIPLEEIEQILASHNEWVKVIPNDKEATLRELTPAKVTGTLSIPVGRLRKLAMG
FT                   PEYLAAFTVGDQLLWGAAEPVRRILKQLVA"
FT   gene            complement(313706..314890)
FT                   /locus_tag="Asuc_0279"
FT   CDS_pept        complement(313706..314890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0279"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: msu:MS2187
FT                   GTPases - translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73657"
FT                   /db_xref="GOA:A6VKH7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VKH7"
FT                   /protein_id="ABR73657.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHYGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLTQYDF
FT                   PGDDTPIIRGSALKALEGEAEWEEKILELANALDSYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGDEVEIVGIKDTTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFVSEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNVKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVASVIK"
FT   gene            complement(314960..317062)
FT                   /locus_tag="Asuc_0280"
FT   CDS_pept        complement(314960..317062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0280"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: msu:MS0164 translation elongation and release factors
FT                   (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73658"
FT                   /db_xref="GOA:A6VL11"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL11"
FT                   /protein_id="ABR73658.1"
FT                   /translation="MARTTPIERYRNIGISAHIDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWSGMSQQFPQHRINVIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYHVPRIAFVNKMDRTGANFLRVVEQLKTRLG
FT                   ANAVPLQLPIGAEDNFKGVVDLVKMKAINWNEEDQGMTFNYDDIPADMVDICEEWHNNL
FT                   IEAAAESSEELMEKYLGGEDLTEEEIKGALRQRVLATEIILVTCGSAFKNKGVQAMLDA
FT                   VVEYLPSPTDIPAIKGINEDETEGERHANDDEPFAALAFKIATDPFVGNLTFFRVYSGI
FT                   VESGATVYNSVKQKRERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVGTGDTLCDQN
FT                   APIILERMEFPEPVISVAVEPKTKADQEKMGIALGRLAQEDPSFRVHTDEESGETIISG
FT                   MGELHLDIIVDRMKREFKVEANIGKPQVSYRETIRTRVNDIEGKHAKQSGGRGQYGHVV
FT                   IDLYPLDPEGPGYEFVNEIKGVVIPGEYIPAVDKGIQEQLKSGPLAGYPVVDLGVRLHF
FT                   GSYHDVDSSELAFKLAASIAFKAAFAKANPVLLEPIMKVEVETPPEYVGDVIGDLSRRR
FT                   AMVSGQEATDFAVKINAEVPLSEMFGYATDLRSQTQGRASYSMEPLKYSEAPKNVADAI
FT                   IEARRK"
FT   gene            complement(317161..317631)
FT                   /locus_tag="Asuc_0281"
FT   CDS_pept        complement(317161..317631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0281"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: hso:HS_1646 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73659"
FT                   /db_xref="GOA:A6VL12"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL12"
FT                   /protein_id="ABR73659.1"
FT                   /translation="MPRRRRIEPRKILPDPKFGSELLAKFINVLMVDGKKSIAESIVYN
FT                   ALETLAQRTGKDALESFEIALENVRPTVEVKSRRVGGSTYQVPVEVRPTRRNALGMRWI
FT                   VEAARKRGDKSMALRLANELSDAVDNKGAAVKKREDVHRMAEANKAFAHFRW"
FT   gene            complement(317739..318167)
FT                   /locus_tag="Asuc_0282"
FT   CDS_pept        complement(317739..318167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0282"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: pmu:PM1354 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73660"
FT                   /db_xref="GOA:A6VL13"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL13"
FT                   /protein_id="ABR73660.1"
FT                   /translation="MLSNTHSFRILLKLELNLMATINQLVRKPRVKKVVKSNVPALEAC
FT                   PQKRGVCTRVYTTTPKKPNSALRKVCRIRLTNGYEVTSYIGGEGHNLQEHSVVLIRGGR
FT                   VKDLPGVRYHTVRGALDCAGVKDRKQARSKYGVKRPKA"
FT   gene            complement(318248..318907)
FT                   /locus_tag="Asuc_0283"
FT   CDS_pept        complement(318248..318907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0283"
FT                   /product="regulator of competence-specific genes"
FT                   /note="PFAM: TfoX domain protein; KEGG: pmu:PM1558
FT                   transformation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73661"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="InterPro:IPR026256"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL14"
FT                   /protein_id="ABR73661.1"
FT                   /translation="MKQQVENKQAENTAVILELLRRLLNSNVISKPLFIGHGIFYDGTM
FT                   FAIYQKQELYLKADGDLANELLAYGSYPWAYIPRSNMKTGPKYYHISDSIQNDEILYKR
FT                   LVKLSIKQAKDQKRDIKLIKESSIKYLSNLTVKHERMLAKIGIFTVSEFREKGAIGAYV
FT                   ELIKSGMLLSINVLWKFVCALQNRNVLLLTDKEKEEIGVKLNEALTKEGLRAIKIN"
FT   gene            complement(319151..319265)
FT                   /locus_tag="Asuc_R0013"
FT   rRNA            complement(319151..319265)
FT                   /locus_tag="Asuc_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(319372..322367)
FT                   /locus_tag="Asuc_R0014"
FT   rRNA            complement(319372..322367)
FT                   /locus_tag="Asuc_R0014"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(322661..322736)
FT                   /locus_tag="Asuc_R0015"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(322661..322736)
FT                   /locus_tag="Asuc_R0015"
FT                   /product="tRNA-Ala"
FT   gene            complement(322807..322883)
FT                   /locus_tag="Asuc_R0016"
FT                   /note="tRNA-Ile2"
FT   tRNA            complement(322807..322883)
FT                   /locus_tag="Asuc_R0016"
FT                   /product="tRNA-Ile"
FT   gene            complement(322967..324501)
FT                   /locus_tag="Asuc_R0017"
FT   rRNA            complement(322967..324501)
FT                   /locus_tag="Asuc_R0017"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(324953..326458)
FT                   /locus_tag="Asuc_0284"
FT   CDS_pept        complement(324953..326458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0284"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   msu:MS2382 Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73662"
FT                   /db_xref="GOA:A6VL15"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL15"
FT                   /protein_id="ABR73662.1"
FT                   /translation="MSNSTRETFSGRRAFIMAAIGSAVGLGNIWRFPYTTYENGGGAFI
FT                   IPYIVALLTAGIPLLFLDYAIGHRHRGGAPLSYRRFNKHFETFGWWQVMVNVIIGLYYA
FT                   VVLGWAATYTYFSFTGAWGNDPVQFFVSEYLKVGDINQGVSFEFVGIVIGPLIAVWLAA
FT                   LGVLALGVQKGISKSANIIMPVLVVMFILLVASSLFLPGATKGLNALFTPDWDKLSDPS
FT                   VWIAAYGQIFFSLSICFGIMITYASYLKKESDLTGTGLVVGFANSSFELLAGIGVFAAL
FT                   GFMASAHGQEVSEVAKGGIGLAFFAFPTIINEAPFGEVIGVLFFGSLTFAALTSFISVI
FT                   EVIISAVQDKLRLRRSKVTFLVGLPMMMVSVILFGSTTGLPMLDVMDKFVNYFGIVAVA
FT                   FVSLMVIVADEKLGVLGQHINETSSFKVGFVWRLCIVVTTGILAFMLFSEGAKVFTEGY
FT                   EGYPDWFINIFGWGMAITLLVVAFLLSRLKWKNEVVTEYKEER"
FT   gene            326675..327229
FT                   /locus_tag="Asuc_0285"
FT   CDS_pept        326675..327229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0285"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   msu:MS2381 predicted esterase of the alpha/beta hydrolase
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73663"
FT                   /db_xref="GOA:A6VL16"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL16"
FT                   /protein_id="ABR73663.1"
FT                   /translation="MQKRVFITHGYTANSQKHWFPWLKVRLENEGFSVTVFDMPDADKP
FT                   NPTAWLTHHRTHIPQLYPQDIFIGHSLGCIATLHFLAQQAQPVSGLILVAGFDQSLPNL
FT                   PELNAFAAQKPDYNALIRHIPQRTVIASLDDDIVNPAFSEQLAVNLQAKYVTMQGYKHF
FT                   TDRQGVTQLSFVYEEIMAFAE"
FT   gene            327457..328428
FT                   /locus_tag="Asuc_0286"
FT   CDS_pept        327457..328428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0286"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIA
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IIA subunit; PFAM: PTS system fructose subfamily
FT                   IIA component; PTS system sorbose subfamily IIB component;
FT                   KEGG: msu:MS2379 phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73664"
FT                   /db_xref="GOA:A6VL17"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL17"
FT                   /protein_id="ABR73664.1"
FT                   /translation="MTHLIVATHGKFSEEIVNSAAMVFGEDENTHVVTFLPGEGGDDLV
FT                   AKYNVIIETLPENEPVLFMVDLFGGSPYNAAARIATNRENTDIVTGISLPMLLETLDAK
FT                   DSASLDELVETAKEVGMLAVKSFRNPEPKAGPAVKAEEKPAAPVPSEPRDPNLKGNMNI
FT                   SLLRIDSRLIHGQVMTSWAKAVKCEAIFAINDGVAKDDIRRELLLQIVPSHLKGYVITV
FT                   EKAIKVWHNPKYAGKNIIWLVTNPADIVRLIEGGVKINSVNVGGMTYREGDKLISQAVA
FT                   VNKDDVAAFKKLLELGVDMSLQQVAANRKEPLTQEKLDAIQF"
FT   gene            328443..329240
FT                   /locus_tag="Asuc_0287"
FT   CDS_pept        328443..329240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0287"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IIC subunit; PFAM: phosphotransferase system PTS
FT                   sorbose-specific IIC subunit; KEGG: msu:MS2378 PTS system,
FT                   mannose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73665"
FT                   /db_xref="GOA:A6VL18"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL18"
FT                   /protein_id="ABR73665.1"
FT                   /translation="MTTLEIILVTLVAAVCGMGSVLDERQTHRPLVACTLIGLVLGDLQ
FT                   SGIIVGGMLEMLALGWMNVGAAMAPDAALASVIAAILVIKGGQDKATAIAVAIPVAAAG
FT                   QVLTIFVRTLTIFLQHKADDYAEQANFRGIEFCHFAGLSLQALRVAIPTFFVALVAGTD
FT                   TVTEALNAIPEVVTRGLQIAGGFIVVVGYAMVINMMRAGALMPFFFMGFVIASFSNYNL
FT                   VGLGFLGACLALIYIQLNPQFNQSAGQVGNAKRELADDELEGL"
FT   gene            329255..330082
FT                   /locus_tag="Asuc_0288"
FT   CDS_pept        329255..330082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0288"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IID subunit; PFAM: PTS system
FT                   mannose/fructose/sorbose family IID component; KEGG:
FT                   msu:MS2377 PTS system, mannose-specific IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73666"
FT                   /db_xref="GOA:A6VL19"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL19"
FT                   /protein_id="ABR73666.1"
FT                   /translation="MSEKKQLTARDIRSTYWRSTFLLGSFNFERMQSMGFCVSMIPAIK
FT                   RLYSDKEDQAAALKRHLEFFNTQPWIGSAIMGVTAAMEQERANGADIDDAAISGVKVGL
FT                   MGPLAGVGDPIFWGTLRPVLAALGAGLAISGSILGPLLFFIGINIFRALTRWYGFKYGY
FT                   TKGTEIVSDMSGGRLQKVTQGASILGLFVMGSLVSKWTSINIPLELSRYKNAIGEEVVT
FT                   TVQSVLDELLPGLAALLLTFVCMWLLRKKVNAMYIIFALFGVGILGYWLGILA"
FT   gene            330189..330572
FT                   /locus_tag="Asuc_0289"
FT   CDS_pept        330189..330572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73667"
FT                   /db_xref="GOA:A6VL20"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL20"
FT                   /protein_id="ABR73667.1"
FT                   /translation="MKLKDLIQPPPSETYVKNSSPLVTALLIIAGLLWYVTQYGSIIAL
FT                   VLALFVLMGQKMLLAQANKDFHEMYLSRQQFETTQNPDYLRYIRARSEQMLRDNKVLSD
FT                   KAKREIAKLQAYVAENLKEENPQ"
FT   gene            330569..331069
FT                   /locus_tag="Asuc_0290"
FT   CDS_pept        330569..331069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0290"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: hin:HI0851
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73668"
FT                   /db_xref="GOA:A6VL21"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL21"
FT                   /protein_id="ABR73668.1"
FT                   /translation="MIPILGITGYSGSGKTTLLEKIVPELTALGVRVAVIKHSHHNATV
FT                   DKEGKDSWRMKEAGAGQVIMACDNRWALMTETPHAPVSLDYLTAQFDPNLTDLVLVEGF
FT                   KQEPIPKILLHRKAMTKPLPEIDEKVLAIATDYPLNTDKVRLNINEISQIAAFIFAYYQ
FT                   QQK"
FT   gene            331072..332496
FT                   /locus_tag="Asuc_0291"
FT   CDS_pept        331072..332496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0291"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pmu:PM1784 hypothetical HI0852"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73669"
FT                   /db_xref="GOA:A6VL22"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL22"
FT                   /protein_id="ABR73669.1"
FT                   /translation="MNSAHEKTQTPSQDYRSLAWIAAMALFMQSLDATILNTALPAISR
FT                   SLHQSPLEMELAIISYALTVAAVIPLSGWIADRFGTLFTFRGAVFIFTLGSLACALSAD
FT                   LDTLVASRILQGVGGALMLPVARLAIIRNVAKSQLIVAWNLMAMAGLIGPVLGPILGGW
FT                   IVTHTSWPWIFLINIPIGIIGMTVVGKYMTNNYGNVGKLDWLGFLLFAAGLVTTTYGLD
FT                   VIAENLANKSKAITLISIGALLLASYGLYALRVNNPLIPLSLLRFRTFNLGILGNLFIR
FT                   ISGSGVPFLLPLMWQVAFNFDAQTAGFMLAPIAISSILAKSFATKILYRFGYRNSLVVN
FT                   AILMAAAIAAMSRFTQDTPLWLYVPIMMWYGCCMSLMFTAVNTLTVCDLPDHLAGSGST
FT                   VLSMMQQLGIGVGIAISSVILALFREHFGQTDDLASAFSHTFLVSSLFAVGLACIMACL
FT                   HPEDGNNLRNRKPQKN"
FT   gene            complement(332641..333363)
FT                   /locus_tag="Asuc_0292"
FT   CDS_pept        complement(332641..333363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0292"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: pmu:PM1753
FT                   putative Mg2+ transporter-C (MgtC) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73670"
FT                   /db_xref="GOA:A6VL23"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL23"
FT                   /protein_id="ABR73670.1"
FT                   /translation="MDFLHEMPDVLLSSTHFVILLKLFIALLLGAIIGLERELKRKPVG
FT                   VKTCAIIAITTCILTVVSIQSAEYYAQISENIRTDPMRLAAQVVSGIGFLGAGVILRKS
FT                   NDAISGLTTAAIIWAAAGIGIASGAGFFFDAIMATAMILVAIRLSPIVQRFVHSRQKIK
FT                   EKKAIIRVYVPQISAMTYVTDLLLVNNFPFDNFTMKEQGNGEIKLSYRYSPLTAETLER
FT                   IYSLLKQQAQVLRVEVEN"
FT   gene            complement(333501..334178)
FT                   /locus_tag="Asuc_0293"
FT   CDS_pept        complement(333501..334178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0293"
FT                   /product="competence protein F"
FT                   /note="KEGG: hit:NTHI0559 competence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73671"
FT                   /db_xref="GOA:A6VL24"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL24"
FT                   /protein_id="ABR73671.1"
FT                   /translation="MNLLGFRCVLCGGRLALARHGLCSRCNRLIERFPYCGSCGAPLAV
FT                   NARHCGRCLRHEPGWDRLVVIGRYAEPLSVLIHRFKFQHQFWLDRTLARLMLLAIIRAK
FT                   REHGLSLPEAILPVPLHHFRQWRRGYNQTALLARYLSRWLDIPCDLRRIERIKRTPSQR
FT                   GLTAAARRSNLKNAFRVNSAVPYRSVALLDDVITTGSTLNEISRQLRKQGVQHIQAWGV
FT                   ARV"
FT   gene            complement(334332..334422)
FT                   /locus_tag="Asuc_R0018"
FT                   /note="tRNA-SeC(p)1"
FT   tRNA            complement(334332..334422)
FT                   /locus_tag="Asuc_R0018"
FT                   /product="tRNA-Sec"
FT   gene            334491..334946
FT                   /locus_tag="Asuc_0294"
FT   CDS_pept        334491..334946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0294"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: msu:MS2341 NTP
FT                   pyrophosphohydrolases including oxidative damage repair
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73672"
FT                   /db_xref="GOA:A6VL25"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL25"
FT                   /protein_id="ABR73672.1"
FT                   /translation="MHKPNITMACVVHCKDKFLFVEEIEHGKRTLNQPAGHLEKDETIL
FT                   QGASRELYEETGIRADMQKLIKIYQWHAPRSQTDYLRFVFALELDHRPATTPHDSDITR
FT                   ALWLTLEEFNHYIAQPQQCERNPLVIQAIQDYQKGESYPLDLLSVFE"
FT   gene            complement(334947..335423)
FT                   /locus_tag="Asuc_0295"
FT   CDS_pept        complement(334947..335423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0295"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: hin:HI0569 transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73673"
FT                   /db_xref="GOA:A6VL26"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL26"
FT                   /protein_id="ABR73673.1"
FT                   /translation="MAKSNYITRQGWNALDQELKFLWKEERPKVTQAVSDAAALGDRSE
FT                   NAEYIYGKRRLREIDRRVRFLMKRLEVLQIVDYHSRQEGKVFFGAWVELENEDGEAKQY
FT                   RIVGCDEFDPAKNWISVDSPVARALIGKTVDDEVRVETPAGKVTLYINEIWYEK"
FT   gene            335606..336190
FT                   /locus_tag="Asuc_0296"
FT   CDS_pept        335606..336190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0296"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="PFAM: HesB/YadR/YfhF-family protein; nitrogen-fixing
FT                   NifU domain protein; KEGG: msu:MS2232 thioredoxin-like
FT                   proteins and domains"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73674"
FT                   /db_xref="GOA:A6VL27"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL27"
FT                   /protein_id="ABR73674.1"
FT                   /translation="MEHIKISDAAQAHFRKLLESQEEGTNIRIFVVNPGTPNAECGVSY
FT                   CPPSNVEENDSELKFNGFSAFIDDISYPFLEDAEIDYVTEELGTQLTLKAPNAKMRKVA
FT                   DDAPLIERVDYVIQTQINPQLASHGGRITLIEITDDGYAVLQFGGGCNGCSMVDVTLKD
FT                   GVEKQLVEMFNGELKGAKDITEHQRGEHSYY"
FT   gene            336244..336819
FT                   /locus_tag="Asuc_0297"
FT   CDS_pept        336244..336819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0297"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase; KEGG: hin:HI0654
FT                   DNA-3-methyladenine glycosidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73675"
FT                   /db_xref="GOA:A6VL28"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL28"
FT                   /protein_id="ABR73675.1"
FT                   /translation="MNMKRCSWAGHNRIYVDYHDNEWGKPQFDSRKLFEKICLEGQQAG
FT                   LSWITVLKKREAYRAAFYRFEPEKIAQMTAEDIDNLMQNAGLIRHRAKLEAIVKNARAY
FT                   LAMEKCGQNFSDFIWSFVNHQPQINDVPDLSDVPAKTETSKAMSKALKKKGFVFVGETT
FT                   CYAFMQSMGLVDDHLNDCFCKSQKQVKK"
FT   gene            336925..337713
FT                   /locus_tag="Asuc_0298"
FT   CDS_pept        336925..337713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0298"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: msu:MS1277 ABC-type amino acid transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73676"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL29"
FT                   /protein_id="ABR73676.1"
FT                   /translation="MFKKLTLLAASALALATATQVAAADSLLDRINNKGTISVGTEGTY
FT                   APFTYHDASGKLTGYDVEVTRAVAEKLGVKVDFKETVWDSMMAGLKAGRFDMVANQVAL
FT                   TTPERRAIFDKSEAYSWSGAMMAVRADDDSIKTLEDIKGRKAAQSLTSNYGELAREKQA
FT                   QIVPVDGLAQSLLVVQQKRADLTLNDSLAILDYLKKNPNAGLKTPWEAPAEEKLGSGLI
FT                   VNKGNDEALAKISAAIVELQQDGTLKKLGEQFFGKDISVK"
FT   sig_peptide     336925..336996
FT                   /locus_tag="Asuc_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 24"
FT   gene            337703..338419
FT                   /locus_tag="Asuc_0299"
FT   CDS_pept        337703..338419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0299"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: msu:MS1276 ABC-type
FT                   amino acid transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73677"
FT                   /db_xref="GOA:A6VL30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL30"
FT                   /protein_id="ABR73677.1"
FT                   /translation="MLNNLLLSLPFMTESRADLVINAFRPMVEAAVLVSIPLAIASFII
FT                   GMIIAVGVALIRITPVTGVLHRITLALVKIYISIIRGTPMLVQISVVFYGLPAIGIFID
FT                   PIPAAIIGFSLNIGAYASETVRAAISSVPKGQWEAGYTIGMNYMQTFRRIIAPQAFRVA
FT                   VPPLSNTFIGLFKDTSLASVVTVTEMFRVAQQMANMSYDFLPVYIEAGLVYWCFCWILF
FT                   FIQARLEKRMARYVAR"
FT   gene            338435..339184
FT                   /locus_tag="Asuc_0300"
FT   CDS_pept        338435..339184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0300"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: msu:MS1275 ABC-type polar amino acid transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73678"
FT                   /db_xref="GOA:A6VL31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL31"
FT                   /protein_id="ABR73678.1"
FT                   /translation="MIKIRNIHKSFGDNTILRGIDLDITKGEVVVILGPSGSGKTTFLR
FT                   CLNALEMPEQGTIEFDNANPLSVNFAAKPSKKDILALRRKSGMVFQNYNLFPHKTALEN
FT                   VMEGPVQVQGKSVQQTRQEASELLNKVGLSDKADLYPFQLSGGQQQRVGIARALALQPE
FT                   LMLFDEPTSALDPELVQDVLDTMKSLAKEGWTMVVVTHEIKFALDVADLVIVMDDGVIV
FT                   EQGSPQQLFDNPRHERTKAFLQRLRSH"
FT   gene            complement(339433..340740)
FT                   /locus_tag="Asuc_0301"
FT   CDS_pept        complement(339433..340740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0301"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit;
FT                   KEGG: msu:MS0038 Na+-transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73679"
FT                   /db_xref="GOA:A6VL32"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL32"
FT                   /protein_id="ABR73679.1"
FT                   /translation="MDSIIALIQGTGIMHMEWGQAVMIAISVLLLWLAISKKFEPLLLL
FT                   PIGFGGLLSNIPEAGLAMTALENLLHLGSPEQIGMIAAKLGVAADPAAIKSALSSVPAS
FT                   TVNQLETMSMDMGYSAGILALFYKVAISYGVAPLIIFMGVGAMTDFGPLLANPKTLLLG
FT                   AAAQFGIFATVLGALTLNYFGIIEFTLPQAASIGIIGGADGPTAIYLTSKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMKALTTEEERKIRMTQLRSVSNREKIIFPIILLLLVALLLP
FT                   DAAPLLGMFCFGNLMKVSGVVDRLSDTTQNALINIVTIILGLSVGSKLIADKFLQPQTL
FT                   GILLLGVVAFCIGTGCGVLMAKLMNKLSKTKVNPLIGAAGVSAVPMAARVANKVGLEAD
FT                   SQNFLLMHAMGPNVAGVIGSAIAAGIMLKYVSAFIM"
FT   gene            complement(340751..342559)
FT                   /locus_tag="Asuc_0302"
FT   CDS_pept        complement(340751..342559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0302"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="TIGRFAM: oxaloacetate decarboxylase alpha subunit;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   pyruvate carboxyltransferase; Conserved carboxylase region;
FT                   KEGG: msu:MS0039 Na+-transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73680"
FT                   /db_xref="GOA:A6VL33"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL33"
FT                   /protein_id="ABR73680.1"
FT                   /translation="MAKKIKVTELVLRDAHQSLFATRLRLDDMLPIAAELDDIGYWSLE
FT                   AWGGATFDSCIRFLGEDPWVRLRELKKACPKTPLQMLLRGQNLLGYRHYADDVVERFVE
FT                   RCVANGMDVFRVFDALNDPRNMKAALQAVKKQGGHAQGTLSYTTSPVHTLQTWLDTTEQ
FT                   LLEIGVDSLVIKDMSGILNPMAAAELVGEIKKRFDIELHLHCHATTGMSEMALLKAIEA
FT                   GVDGVDTAISSMSGTYGHPATEAIVATLQGTAFDTGLDIPRLEKIAAYFRDVRKKYAKF
FT                   EGQLRGVDSRILVAQVPGGMLTNLENQLKQQNASDKLDKVLEEIPLVRKDLGYIPLVTP
FT                   TSQIVGTQAVINVLMGERYKTIAKETAGVLKGEYGKTPAPVNAELQARVLEGGEPMTDR
FT                   PADHLEPEMANIEADVIAQAKEKGVALSENSVDDALIVALFPQIAWKFLENRNNPAAFE
FT                   PAPTAESAAEKPQEKAAPKAQSGSAVYTVEVEGKAFVVKVSEGGDISAIAPATAPAAAA
FT                   QAAPAAAPAPAPSAGGVQVTAPMAGNIWKVIATEGQTVAEGDVLFILEAMKMETEVKAA
FT                   QAGTVRNIQVKAGDSVSVGDVVMTLA"
FT   gene            complement(342579..342848)
FT                   /locus_tag="Asuc_0303"
FT   CDS_pept        complement(342579..342848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0303"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   msu:MS0040 Na+-transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73681"
FT                   /db_xref="GOA:A6VL34"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL34"
FT                   /protein_id="ABR73681.1"
FT                   /translation="MTPAELFGEGINLMLSGMGFVITFLLILIWAITTMSKLINRFFPE
FT                   PVKQSKPSQKPTALSAAVQGNDLDRLRPVIVAAIAHHRRSQGLN"
FT   gene            complement(343007..344284)
FT                   /locus_tag="Asuc_0304"
FT   CDS_pept        complement(343007..344284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0304"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: Arsenical pump
FT                   membrane protein; sodium/sulphate symporter;
FT                   C4-dicarboxylate anaerobic carrier; Citrate transporter;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: hdu:HD0866 possible sodium/sulphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73682"
FT                   /db_xref="GOA:A6VL35"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL35"
FT                   /protein_id="ABR73682.1"
FT                   /translation="MTPSAITLCFLVFAIIMFAWEKLPLAVTAMVVSVGLALTGVLSAK
FT                   DAFMGFVDTNVILFVAMFVIGGALFETGMANKIGGVVSRFATSERKLMVVLMVITGVMS
FT                   GVLSNTGTAAILIPVILGISAKSDFARSRLLMPMAFASTLGGNLSLIGSPNNLVVQGVL
FT                   SQSGDKFGFFEYAEIGVPILIIGIIFFVLIGYRLLPTQLNLHVEQEDYQAFHNHHNHIP
FT                   KWKQWLSLAVLIATLLAMVFEDFIGIKLYLSACVGALILVIMRVITEKQAYQAIDSQVV
FT                   FLFAGTLALANALQTTGAGAQIAHTILGWLGAQPNSYLLLFTILVLSCVLTNFMSNTAT
FT                   AALLAPIGLSIAHSLGADPKAVLMAVVVGSSCAFATPIATPANTMILSVGHYRFADYAK
FT                   AGVPLIVVTIAAAMILLPILFPFFPS"
FT   sig_peptide     complement(344219..344284)
FT                   /locus_tag="Asuc_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.648 at
FT                   residue 22"
FT   gene            complement(344511..345560)
FT                   /locus_tag="Asuc_0305"
FT   CDS_pept        complement(344511..345560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0305"
FT                   /product="citrate lyase ligase"
FT                   /EC_number="6.2.1.22"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; citrate
FT                   lyase ligase; PFAM: GCN5-related N-acetyltransferase;
FT                   Citrate lyase ligase domain protein; KEGG: fnu:FN0319
FT                   citrate (pro-3S)-lyase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73683"
FT                   /db_xref="GOA:A6VL36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL36"
FT                   /protein_id="ABR73683.1"
FT                   /translation="MSYNIGKVNPLNHKELAEIDRLLAQQGIRRDQNLDYTCAMYDEDD
FT                   NIIATGSLFANSLRCLAVSEDHQGEGLMNQIVTHLINEQFERGHFHLFLYTKSCAVKFF
FT                   SDLSFYEIAKIEGKIAFMENRRNGFADYLQKLVDESPERQTEKRIAAIVMNANPFTLGH
FT                   QYLVEKAAAENDIVHLFMVSEDQSLVPFDVRRKLILEGVAHLPNVVCHDSGSYIISSAT
FT                   FPSYFQKDDDAVIESNALVDVNIFVKIARKLGIKRRYVGDEPFSHVTHIYNKIMQRQLP
FT                   EYDIECIVLERKTVNGQIISASAVRQAIKDEDWDKLKVMLPVSSLRFFESNEAKPIINK
FT                   IKQTSDVSH"
FT   gene            complement(345617..346450)
FT                   /locus_tag="Asuc_0306"
FT   CDS_pept        complement(345617..346450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73684"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL37"
FT                   /protein_id="ABR73684.1"
FT                   /translation="MTNEKFIGLGVAGNFAGHLEQAGEAADFVNVKTQEAVQPKAIFPF
FT                   YIPCENLDELTRFLSVYPLSAESLSFPKDADNLQIEPEIALICDVEYSDKKVTALHPTH
FT                   FAAYNDCSIRRPNARKISEKKNWGENSKGLCSTRIALDKFAAGGNIDTYHIACFHKRDG
FT                   KLNEYGQDSQAVGYSYFHQKLLDWIIDRMNNQPDEGPMNDIARLLQQADYPTKAVISIG
FT                   ATRYTPFGESHFLQVGDTSMVIVYNGEKYNHKQIVEMAEKEQFPSDISALVQKVV"
FT   gene            complement(346530..346859)
FT                   /locus_tag="Asuc_0307"
FT   CDS_pept        complement(346530..346859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0307"
FT                   /product="protein of unknown function DUF413"
FT                   /note="PFAM: protein of unknown function DUF413; KEGG:
FT                   msu:MS2060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73685"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL38"
FT                   /protein_id="ABR73685.1"
FT                   /translation="MTESFSVERRFFDDKNYPRGFARHGDYTIKESQALEQYGQAFKAL
FT                   DLGEREPKTDEEKAFAAFCKGERQPETFFEKTWDKYRTHIGKTKRVYTLSGVVGDNLDE
FT                   MSNVD"
FT   gene            complement(346873..347490)
FT                   /locus_tag="Asuc_0308"
FT   CDS_pept        complement(346873..347490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0308"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: hit:NTHI1012
FT                   thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73686"
FT                   /db_xref="GOA:A6VL39"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL39"
FT                   /protein_id="ABR73686.1"
FT                   /translation="MKKTLFALISAVAVVMSLNVQAAELKEGEQYVTVAQNPSAQPEVI
FT                   EFFSFYCQHCYSFEMQYKIPEKVKAELPQGTIFKQYHVDFLGHQSENLTRAWALAMALG
FT                   VESKVKQSLFESAQANALRSMDDIRQKFIDNGITAEQFDGGINSFAVNALVKKQQNLAE
FT                   QFKVQGVPDFYVNGKYRVNPEGLSHDDFVGDYIKTTIELLKK"
FT   sig_peptide     complement(347422..347490)
FT                   /locus_tag="Asuc_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(347501..347770)
FT                   /locus_tag="Asuc_0309"
FT   CDS_pept        complement(347501..347770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0309"
FT                   /product="protein of unknown function DUF1040"
FT                   /note="PFAM: protein of unknown function DUF1040; KEGG:
FT                   msu:MS2058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73687"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL40"
FT                   /protein_id="ABR73687.1"
FT                   /translation="MKCHRLNEVLELLQPYWSKKDPEMSLMQILQSIADEAGFDKPLTE
FT                   LSDEVIIYQLKMRDADKLEPIPGIKKDYEDDFKTALLKARGIIK"
FT   gene            347845..348414
FT                   /locus_tag="Asuc_0310"
FT   CDS_pept        347845..348414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0310"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: msu:MS2057
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73688"
FT                   /db_xref="GOA:A6VL41"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL41"
FT                   /protein_id="ABR73688.1"
FT                   /translation="MITISAVILAGGLARRMNGADKGLQKFHGKPLIQHVIERLQPQIS
FT                   TILINANRNLTDYKKFGLPIFSDELADYQGPLSGMLTGLKKAQTDYVLFVPCDCPFLPL
FT                   NLVEKLKSAVEKSDVFAAYATDGERAHPTFCLISRQLLTALSEYLVRGERRMLHFLNNR
FT                   RAVAVDFSQQKSAFRNFNTLEELQSP"
FT   gene            348433..349332
FT                   /locus_tag="Asuc_0311"
FT   CDS_pept        348433..349332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0311"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: msu:MS2075 ARA1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73689"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL42"
FT                   /protein_id="ABR73689.1"
FT                   /translation="MQHIQLAPDLTFSRLIQGFWRLKSWQKSPQELLTFIKQGLEFGID
FT                   TFDHAACYGSFTAEAELGRALALDKSLRSQLTLVTKCGILYPNDELSQIKSHHYDNSYR
FT                   HIIWSAQRSIEKLQCEYLDVLLIHRLSPCADPEQIARAFNELHQSGKVRYFGVSNYTPA
FT                   KFSMLQSYVNQPLITNQIEISPLHRQAFDDGTLDFLLEKRVKPMAWSPLAGGRLFNHDE
FT                   NLRIIQKTLLEIGETKSETRLDTLVYAWLLAHPAKIMPIIGSGKTERVKNAADALKISF
FT                   TEEEWIKVYVAAQGHDIP"
FT   gene            complement(349444..351519)
FT                   /locus_tag="Asuc_0312"
FT   CDS_pept        complement(349444..351519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0312"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77; KEGG: msu:MS2074
FT                   4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73690"
FT                   /db_xref="GOA:A6VL43"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL43"
FT                   /protein_id="ABR73690.1"
FT                   /translation="MTITTKQFRRAGIMPYFFDERGVKKWAPYNIKKALFRSFEGNIQA
FT                   SCVPIPAVKILYQNRPHFLPINSADKKRPLKGRWQLQLENTQSVISGSVTARGINLPRD
FT                   LPLGYHQLQLQSGGKVFDCTIIVAPQVCYQPQALREHKKLWGTFLQLYTLKSEQNWGIG
FT                   DFGDLKKFLQNLAPFQADFLGLNPIHSLFPANPYSASPYSPSSRQWLNIAYIDVNQLAE
FT                   FRQSEEAQAWFHSAEVQQKLTELRRAEWLDYGKIIPLKLEGLRFAFRKFKQNPTALSVR
FT                   QFTQFVRRGGESLQVQATFDALHQHLAARFDNQWGWDFWAKEYQDYHSSAVQRFRIEHQ
FT                   AEIEFYAWLQFIADQQLAECDTVCRQLNMRIGMYRDLAVGVTGSGAETWNDKRLYCLNA
FT                   SVGAPPDVLGPQGQNWGLTPMNPHVLKQQAYRPFIALVRANMKYCGALRIDHIMSLLRL
FT                   WWIPKGDSAANGAYVSYPVDDLIAILALESQRHQCLIIGEDLGTVPKEIIGKLKNAGIL
FT                   SYKIFYFEFDEQGQSRDLRTYPYQAMTTLSTHDLPTVSGYWRGYDFELGEKFGVYPNPK
FT                   ILDILQRERVRAKTRILQRLAQHYVPVDTEINAELGSPVNNKFIHRLQTYVAHVSSGLF
FT                   GFQPEDWLGMSEPVNIPGTSTQYANWRRRLTANITDIFADTDIRKLLKEVNAIRKE"
FT   gene            complement(351600..353969)
FT                   /locus_tag="Asuc_0313"
FT   CDS_pept        complement(351600..353969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0313"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="TIGRFAM: glycogen/starch/alpha-glucan phosphorylase;
FT                   PFAM: glycosyl transferase family 35; KEGG: msu:MS2073
FT                   glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73691"
FT                   /db_xref="GOA:A6VL44"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL44"
FT                   /protein_id="ABR73691.1"
FT                   /translation="MMFQSIVEKYCRYFDVANPKQFTLQQWYRIVAEGTLGLAYSQPAA
FT                   KPEDSRHVNYLSMEFLVGRLTGNNLMNLGYYEQIRDYLKQYQVELVDVLEQERDPALGN
FT                   GGLGRLAACFLDSMAALGQKATGYGLHYQYGLFKQSFAGGMQKETPDIWERDSYPWHRF
FT                   NPSKTRIVCFGGKIKHIQGDNYEWSPKLRIQGKAFDLPVVGYRNNLIQPLRLWQADSDQ
FT                   SFNFDAFNEGKFLNADKTIVNAAALTQVLYPNDNHKAGQKLRLMQQYFHCACSVADILD
FT                   RHFAEGYQLADFAKRQVIQLNDTHPTLAIPELMRLLLDDYHLTWDQAWDICTNTFAYTN
FT                   HTLLPEALEQWDQRLFKRLLPRHYKIVEKINDIFHQKVRSEFGENSQVWEKLAILFDYR
FT                   VRMANLCVVTCFRVNGVAQIHSDLLVTDLFPEYHKLFPGKFCNVTNGITPRRWIRRANP
FT                   QLSDLLDRTLKQDWSKELELLAGVEKYVDDAGFREEYQRIKHHNKIVLADEINRTLDLK
FT                   VNPDAIFDVQIKRFHEYKRQHLNLLNIIADYQSLKANPNQDYTPRVFVFAGKAAPGYYL
FT                   AKNIIHAINNVADIINNDKQVNDRLQVAFLPDYRVSLAEKIIPAADVSEQISMAGKEAS
FT                   GTGNMKLALNGALTLGTLDGANVEIAEMVGEENIFIFGHTVDSVRELLAKGYRPKDYYK
FT                   KDGVLKNAVDFLARGKASKGDREIFRLMLDSLLERDPFLVFADFYSYRCAQQKISNAYL
FT                   NRDVWLRSAILNTARLGAFSSDRSIRDYQQRIWLNK"
FT   gene            354073..356859
FT                   /locus_tag="Asuc_0314"
FT   CDS_pept        354073..356859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0314"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: msu:MS2072
FT                   ATP-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73692"
FT                   /db_xref="GOA:A6VL45"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL45"
FT                   /protein_id="ABR73692.1"
FT                   /translation="MKCKRREIYLRFAMKEKLKSIMLIPSKLICSYRLQNSVQRTRLTQ
FT                   LLNKSYLYPVVLVNAPAGYGKTTLLSQWIENIQNVGWYSLDEGDNKTDRFAVYFSAALY
FT                   TATNETDPLSEEKRQANLLALFNQLLIKVSRFPQHLYLVIDDYHLIENDEIHEALKYWI
FT                   KHQPSNMTLILISRSVPPLGIASLRVQEQLLEIDMNQLMFDHSECIEFFQTRLGSQLKQ
FT                   QDMIALCNEVEGWPTALQLISLFAKNKSRTLQVPLQDIAKRLAVSNNYHINEYLADEVL
FT                   NKVDNNTRLFILRCSVLHSMNEYLVRAVTGEKNSCNKLESLEKQGLFLQQMANSKWQSI
FT                   DDNWWKFHPLFASFLNFHCHHELRDELPELHRRAANAWVKLGYVTEALYHAMQLSDTTL
FT                   LLNLLAEHGWSLFHQGELKQLEESLNRLAYSHLSKYTNLVLLKAWLVQSQHRHTEVSGI
FT                   LAEFSQTLTENKIELSKTAQAEFNVLRAQVAINSGDENTALQLASDALKDLSENAYYAH
FT                   IVATSIIGEAHHCHANLPQALAMLQKAERMARQHHTYHNILWSLLQQSEILLAQGFSQA
FT                   AYEMLDKAHEFVKENHLQKVPMYEFLLRLKGKILWEWYNLDKAESMATAGMQVLQKNED
FT                   KLQCLTLLTKISLVRGHLDNTARLLHETEQLEGTHTYHHDWIANADQIHIFYWQMTNDV
FT                   ESVRNWLIQNPAPVSDKNHFTQIQWRNIARARILLGQYEQAKDILDKLIETAEAFSLIS
FT                   DLNRALIVRNRLYHLQGMKESAQQDLIAALKLTRQTNFISAFVIEGDVMAQQIRNLLQL
FT                   NVLDELVLHKAQFILRNINQFYRHKFAHFDEDFVNRLLNNPKVPELLKISPLTQREWQV
FT                   LGLIYSGYSNEQISDELQVAATTIKTHIRNLYQKIGVTNRNEAISYTKELLILMGYN"
FT   gene            complement(356912..358969)
FT                   /locus_tag="Asuc_0315"
FT   CDS_pept        complement(356912..358969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0315"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: msu:MS2071
FT                   glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73693"
FT                   /db_xref="GOA:A6VL46"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR014635"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL46"
FT                   /protein_id="ABR73693.1"
FT                   /translation="MKKSLLYFCLFTSSVSFAQGWQHTHFRYFNDSAETNLFQSQTALE
FT                   KGYYPLTFIFDNQCYQPQSAMKLNQTVSLIPCFGEAPHIRLFRRGNYIAQIDMRSGTPT
FT                   LKIGVQQQQSSDKNALKSCPRWNKQPIEIDVSSTFAEGESVRDFYSNQIAEVKNGKVIM
FT                   MPAANADGLILLEKSAVEKTDVFDWKNATVYFVLTDRFHNGNPANDNSYGRHKDGMQEI
FT                   GTFHGGDLQGLTEKLDYLQQLGVNALWISSPLEQMHGWVGGGNKGDFPHYGYHGYYHLD
FT                   WTKLDANMGTESDLRNLIQQAHRRGIRVLFDIVMNHTGYATLADMQEFKFGDFYLKPEE
FT                   ITAVLGEKWTNWQPEKGQNWHSFNDFIKFGDSKAWQNWWGKDWVRADIGDYDSPKFDDL
FT                   RMSLSALPDLKTESESAVELPRFFQHKNTNAKKLDNAKVRDYLIVWLTDWVRRYGVDGF
FT                   RVDTAKHVEKSTWLALKQASQRALKEWQQKNPKESFGDDFWMTGEAWGHGVFKSDYYQN
FT                   GFDAMINFDFQDQAKNALDCFARIEPVYQEMNNKLKDFNVLSYLSSHDTRLFFHSDSER
FT                   NVAKQKIAANLLLLSSGAVQIYYGDESGREFGATGSDPVQGTRSDMNWTDLQKDRSKQA
FT                   LHQHWQKLAQFRQRHQAVGAGVHQTLKSESYFAFSRTLGEDKVMVVWAGN"
FT   sig_peptide     complement(358913..358969)
FT                   /locus_tag="Asuc_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 19"
FT   gene            complement(359119..360009)
FT                   /locus_tag="Asuc_0316"
FT   CDS_pept        complement(359119..360009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0316"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: msu:MS2070 sugar permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73694"
FT                   /db_xref="GOA:A6VL47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL47"
FT                   /protein_id="ABR73694.1"
FT                   /translation="MAIVQSKSVRYRVWATHFILVCFLALIIFPLLMVIGISLRPGNLA
FT                   IGDIIPSQISWEHWQAALGFEVTHADGSVTPPPFPVLRWLWNSIKVATITSIGIVTLST
FT                   TCAYAFARMKFKGKKTILQGMLIFQMFPAVLSLVALYALFDRLGQYVPFLGLNTHGGVI
FT                   FAYLGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLILLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNSYTLAVGMQQYLYPQNYLWGDFAAAAVLSAIPITLVFLLA
FT                   QRWLIGGLTAGGVKG"
FT   gene            complement(360063..361598)
FT                   /locus_tag="Asuc_0317"
FT   CDS_pept        complement(360063..361598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0317"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: msu:MS2069 ABC-type sugar
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73695"
FT                   /db_xref="GOA:A6VL48"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL48"
FT                   /protein_id="ABR73695.1"
FT                   /translation="MPILTQFQSTQWLKYLIAGFVLLLDFYLVGLMYLQGEYLFAILTL
FT                   VILTSGVYVFTNPNAYAWRYVYPGIMGMTIFILFPLVATIAIAFTNYSGSNQLSFERVL
FT                   SVLTEQRYFSGDKYNFKLYPQADNKYKIVLTNPATAQTFVSESVALNTENVPVNEQAEP
FT                   AGEIAPLKIITQNRRFLQAMKVILPNNNELTMSSLRQFSEQKARYQFDKENNILRNNEN
FT                   GKLYKANDETGFFQAVNESGDWLNETLEPGYTVGSGFHNFVKIFTDKGIQKPFVQIFIW
FT                   TVVFSLLTVVFTVILGMILACLMQWEALKGKAVYRLLLILPYAVPSFISILIFKGLFNQ
FT                   SFGEINIILNQLFGISPEWFNDPFLAKVMILIVNTWLGYPYMMILCMGLLKAIPSDLYE
FT                   ASAMDGASTWQNFSKITFPLLLKPLTPLMIASFAFNFNNFVLIQLLTNGRPDMIGTTTP
FT                   AGYTDLLVSYTYRIAFEGSGTQDFGLAAAIATIIFLLVGGLALLNIKATKMEL"
FT   gene            complement(361680..362870)
FT                   /locus_tag="Asuc_0318"
FT   CDS_pept        complement(361680..362870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0318"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: msu:MS2068 maltose-binding periplasmic
FT                   proteins/domains"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73696"
FT                   /db_xref="GOA:A6VL49"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL49"
FT                   /protein_id="ABR73696.1"
FT                   /translation="MKNKLIKLTLTAVAGLVLSASVTAKMTEGNLVIWINGDKGYNGLA
FT                   EVGKKFEKDTGVKVLVEHPDRLEEKFAQVASTGDGPDIMFWAHDRFGGYAQSGLLAEVN
FT                   VSKEFKDKFVDFAWDAETYNGKIIGYPVAIEAISLIYNKDLVKEAPKSWEEIIELDKKL
FT                   KKDGKNAIMWNLSEPYFTWPVAASNGAYAFKYNNGKYDVKDIGVNNEGAVKALQFVVDM
FT                   VKNKHISADMDYAVAEASFNKGQTALTINGPWSWGNIDKSGVKYGVAVLPTLNGQASKP
FT                   FVGVLSAGVNSASPNKDLAKEFLENYLLTDEGLDTVNKDKPLGAVALKSYQAKLAADPR
FT                   IAATMENAKNGEIMPNIPQMTSFWYAEKSAINNAVTGRQTVKAALDDAHARIQKQQ"
FT   sig_peptide     complement(362796..362870)
FT                   /locus_tag="Asuc_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            complement(362890..364095)
FT                   /locus_tag="Asuc_0319"
FT   CDS_pept        complement(362890..364095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0319"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: msu:MS2068 maltose-binding periplasmic
FT                   proteins/domains"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73697"
FT                   /db_xref="GOA:A6VL50"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL50"
FT                   /protein_id="ABR73697.1"
FT                   /translation="MKLNSKSKTLFYTLLSGSIIFFSFSAWAKFEEGKLVVWGGGKGHP
FT                   VIAQIGEQFEKDTGIAVKVENPGKLEEDYAQLASNGAGPDIIIYAHDRFGGYAKAGLLA
FT                   ELTPSKEFKDKFSGFAWDAETYEGKIIGYPMAIEALSLIYNKALVQTPPKTWEELKVLD
FT                   DELRKKGKNAIVWNISEPYFTWPVLAADGGYAFKINQGKYDISDIGVNNPGAKKALQFV
FT                   VDFVNSDHIRADTDYAIAEAGFIRGDTAMIINGPWAWVNLDKAEMNYGVTALPTFNGKP
FT                   SKPFVGIISIGINASSPNKDLAKEFIENYLLTDESLEIINKTNTLGAVPLLSLQAKLAS
FT                   DPRVAATMENAKNGEIMPNIPQMTSFWYSMKSAINNAITGRETASQALDNAEQRIRSGI
FT                   NK"
FT   sig_peptide     complement(364009..364095)
FT                   /locus_tag="Asuc_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            364446..365564
FT                   /locus_tag="Asuc_0320"
FT   CDS_pept        364446..365564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0320"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: msu:MS2067 ABC-type
FT                   sugar/spermidine/putrescine/iron/thiamine transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73698"
FT                   /db_xref="GOA:A6VL51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL51"
FT                   /protein_id="ABR73698.1"
FT                   /translation="MASVTLRNVSKSYGDVCISKDINLDIKEGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITTGKLYIGDKLMNEVEPSKRGIGMVFQSYALYPHLNVAENMSFGLKLAG
FT                   INKAERDKRVNQVAEILQLAHLLDRKPKALSGGQRQRVAIGRTLVSQPEVFLLDEPLSN
FT                   LDAALRVQMRVEISKLHKKLKRTMIYVTHDQVEAMTLANKIVVLNAGGIAQVGKPLELY
FT                   HYPANRFVAGFIGSPKMNFLPVKVTAVEKERVKIELPDANHHNFWIPVSGDGVNVGNNL
FT                   SLGIRPEHLVPSDQTAITLRGIVQVVELLGNETQIHLEIPEIKKPSLIYRQSDVVLVNE
FT                   GDEMNIGIVPERCHLFKEDGIACKRLFLEKGI"
FT   gene            365581..366912
FT                   /locus_tag="Asuc_0321"
FT   CDS_pept        365581..366912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0321"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: pat:Patl_2810 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73699"
FT                   /db_xref="GOA:A6VL52"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL52"
FT                   /protein_id="ABR73699.1"
FT                   /translation="MCLSVYQAKPYVELKHPEWAEKAVIYQANIRHFTAEGTFQAFRAH
FT                   LPRLKNLGIDIIWLMPVHPIGELNRKGSLGSPYAVKDYYAVNPEFGTAEDLKILVNDIH
FT                   TLGMFVILDWVANHSAWDNVLTLSHPEWYSKNKQGNFQPTPWYDWSDIIEFDYTNSGLR
FT                   QYMTEAMKYWVKNYDIDGFRCDVAGFVPTDFWNQVRLELDAIKPVFMLAEWESRDLHQK
FT                   AFDMTYGWDLWNKLLAVANGRGYNDQAFPALIEYMAHDVKTFPRNAYRMLFTDNHDKNA
FT                   WEGNQYENFADALEVATVMTVLANGMPLVYNGQEAGLDRSLAFFDKDLIEWKPHNNGEL
FT                   YRMLFSLKHKNLALRNGLRGGEMIRIPNSGEKILSFYRESDGDRAVAILNFSNKKQMLK
FT                   LQCDGIEGIYINWFSQRSYQLEISHQVEIDPWGYIVLSQHKINN"
FT   gene            366941..368233
FT                   /locus_tag="Asuc_0322"
FT   CDS_pept        366941..368233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0322"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: msu:MS2066 maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73700"
FT                   /db_xref="GOA:A6VL53"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL53"
FT                   /protein_id="ABR73700.1"
FT                   /translation="MNNKKTLLAVAISGMMFATSAAAVDFHGYARSGIGWTSGGGEQTA
FT                   LQVNGGGSKYRLGNETETYVELKLGQELFKEGNKSIYLDSNIAYSVDQQVDWEATDPAL
FT                   REINVQFKNFAEDLLPDATLWAGKRFYQRHDVHMNDFYYWDISGPGAGVENINLGFGKL
FT                   SLAVTRNTEGGATATYGTDKVYYIDDNGQIQSRFEERKANVYNDVFDIRLAELNVNPNG
FT                   KLEIGFDYGNAHTKNGYYLEPGASKNGYMITLEHTQGEFFGGFNKFVAQYATDSMTSWN
FT                   TGHSQGSSVNNNGHMLRLIDHGVVQFSPKVEMMYALIYEKTDLDNNQGKTWYSAGIRPM
FT                   YKWNKTMSTLIELGYDRIKDQSSGEKNDLAKITLAQQWQAGDSIWARPAIRVFGTYGRW
FT                   NDKFNITDRTNAGYKAKDAEFVAGVQFEAWW"
FT   sig_peptide     366941..367012
FT                   /locus_tag="Asuc_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.891 at
FT                   residue 24"
FT   gene            368401..369288
FT                   /locus_tag="Asuc_0323"
FT   CDS_pept        368401..369288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0323"
FT                   /product="Maltose operon periplasmic"
FT                   /note="PFAM: Maltose operon periplasmic; KEGG: msu:MS2065
FT                   maltose operon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73701"
FT                   /db_xref="GOA:A6VL54"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL54"
FT                   /protein_id="ABR73701.1"
FT                   /translation="MKKTLLSTALLLANIVTVLPAVANNSTTPVHINSTVLAQIQWQDV
FT                   PLSQTVKTTLTEQQKQAFTAQFAGVASPVAAYRIPANQGTLEIEIESPVVDKNLFVPTA
FT                   VVLDGNFNVAATYPSSEFKLQEERGLKGNRLGARLNLTPSINQDYIYLLVYTTQQDLAK
FT                   TTIVPHPAKLYAKATGKQPPAINDIEVAHSLNGKIEINVSGANGTKFIGLPTEIFSSDK
FT                   ASTPVGKPAASTVQNPGAVITAVDKDTEAYFNQAVTKALKAKDVNKALNLVNEAEKLGL
FT                   KSPRQIFLKNVNSN"
FT   sig_peptide     368401..368472
FT                   /locus_tag="Asuc_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 24"
FT   gene            complement(369370..370152)
FT                   /locus_tag="Asuc_0324"
FT   CDS_pept        complement(369370..370152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0324"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; Haloacid dehalogenase domain
FT                   protein hydrolase type 3; KEGG: msu:MS2344 predicted
FT                   hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73702"
FT                   /db_xref="GOA:A6VL55"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL55"
FT                   /protein_id="ABR73702.1"
FT                   /translation="MQYKAIFSDMDGTLLNSRHQISSRTEQAIKSVISKGVPFIPVSAR
FT                   PPYAITPYTDKLQTNQAIICYSGALILDQNLRELYSVQIDQTDLAILNQILTDYQYLSI
FT                   NHYVGLDWFANDLNNYWTKQEADITGLSPERIPTNLKKAHKILVMGEADKIQPLEQKLK
FT                   QKLPHLSIHRSKPEYLEIMNKAATKAKAISFMEQYLHVNADEVIAFGDNFNDLDMLQYA
FT                   GLSVAMGNAPDEIKSVAKEVTMSNDEDGIALVLEDKFK"
FT   gene            complement(370273..370701)
FT                   /locus_tag="Asuc_0325"
FT   CDS_pept        complement(370273..370701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0325"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: msu:MS2345 F0F1-type ATP synthase epsilon subunit
FT                   (mitochondrial delta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73703"
FT                   /db_xref="GOA:A6VL56"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL56"
FT                   /protein_id="ABR73703.1"
FT                   /translation="MATFNLTVVSAEEKIFEGAVKSIQATGSEGELGILAGHIPLLTGI
FT                   KPGIVKITREDNSEEVLYVSGGFLEVQPNIVTVLADVAIRGIELDQERILNAKRKAEDN
FT                   IVAKHADVDHNLLVAKLSKELAKLRAYELTEKLVKNKR"
FT   gene            complement(370741..372117)
FT                   /locus_tag="Asuc_0326"
FT   CDS_pept        complement(370741..372117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0326"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase; KEGG: msu:MS2346
FT                   F0F1-type ATP synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73704"
FT                   /db_xref="GOA:A6VL57"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL57"
FT                   /protein_id="ABR73704.1"
FT                   /translation="MSAGKIVQIIGAVIDVEFPQNAVPKVYDALKVEEGGLTLEVQQQL
FT                   GGGVVRCIALGTSDGLKRGLAVKNTGNPISVPVGTKTLGRIMNVLGEPIDQKGEIGAEE
FT                   TWAIHREAPSYEDQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIR
FT                   NIAIEHSGFSVFAGVGERTREGNDFYHEMTESNVLDKVSLVYGQMNEPPGNRLRVALTG
FT                   LTMAEKFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERI
FT                   TSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRNIASLGIYPAVDPLDSTS
FT                   RQLDPQVVGQEHYDVARGVQGILQRYKELKDIIAILSMDELSEDDKLVVARARKIERFL
FT                   SQPFFVAEVFTGSPGKYVSLKDTIRGFKGILEGEYDHIPEQAFYMVGSIEEVVEKAKNM
FT                   "
FT   gene            complement(372133..373002)
FT                   /locus_tag="Asuc_0327"
FT   CDS_pept        complement(372133..373002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0327"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit; KEGG:
FT                   msu:MS2347 F0F1-type ATP synthase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73705"
FT                   /db_xref="GOA:A6VL58"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL58"
FT                   /protein_id="ABR73705.1"
FT                   /translation="MASGKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPY
FT                   SETIRNVISHVSKASIGYKHPFLMEREVKTVGMLVVSTDRGMCGGLNINLFKAVLNEIK
FT                   KWKEQGVTVEVGVIGAKGIAFFRSLGFKIRAQHSGIGDNPSVEELLGIANDMFDAYKED
FT                   KIDALYLAHNQFINTMSQKPSVAQLVPLPELDTDNLDERQQVWDYLYEPEPKVLLDNLL
FT                   TRYLESQVYQSVVDNLASEQAARMVAMKAATDNAGNLINDLQLVYNKARQASITNELNE
FT                   IVAGAAAI"
FT   gene            complement(373021..374562)
FT                   /locus_tag="Asuc_0328"
FT   CDS_pept        complement(373021..374562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0328"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: msu:MS2348 F0F1-type ATP synthase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73706"
FT                   /db_xref="GOA:A6VL59"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL59"
FT                   /protein_id="ABR73706.1"
FT                   /translation="MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLS
FT                   EVMQGEMIALPDNRYAMALNLERDSVGAVVMGPYIDLAEGMEVQCTGRILEVPVGRGLL
FT                   GRVVNTLGQPIDGKGEIKNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMVPIGRGQ
FT                   RELIIGDRQTGKTALAIDTIINQKDSGIKCIYVAIGQKASTIANVVRKLEENGALANTI
FT                   IVVASASESAALQYLAPYAGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPP
FT                   GREAFPGDVFYLHSRLLERAARVNEEYVENFTKGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLESNLFNAGVRPAVNPGISVSRVGGAAQTKVVKKLAGGIRTALAQ
FT                   YRELAAFAQFASDLDDATRKQLSHGEKVTEMLKQKQYAPLSVAEQAVLLFAVEFGYLDD
FT                   VELNKIADFETTLLDYANRTNAEFMRELTQSGDYNDEIKNTLEGILNNFKANNTW"
FT   gene            complement(374578..375108)
FT                   /locus_tag="Asuc_0329"
FT   CDS_pept        complement(374578..375108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0329"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: hit:NTHI0612 ATP synthase delta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73707"
FT                   /db_xref="GOA:A6VL60"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL60"
FT                   /protein_id="ABR73707.1"
FT                   /translation="MSELTTIARPYAKAAFDFAVEQSAVEKWHEMLAFIAEVAKDEQIQ
FT                   QFLTSSLSPEKVADTVISICGEHLDKSGQNLIRLMAENKRLTVLPAVFNEFRHYMEEYN
FT                   AIAEVQVISAQPLNATQTDKIAAAMEKRLARKVKLNCSVDNTLIAGVIIRTDDFVIDGS
FT                   SRGQLNRLANELQ"
FT   gene            complement(375122..375592)
FT                   /locus_tag="Asuc_0330"
FT   CDS_pept        complement(375122..375592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0330"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   pmu:PM1490 ATP synthase, b chain"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73708"
FT                   /db_xref="GOA:A6VL61"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL61"
FT                   /protein_id="ABR73708.1"
FT                   /translation="MNLNATLIGQLIAFALFTWFCVKFVWPPIIKAIEERQSSIANALA
FT                   SAEAARKEQADTKTLAEEEITKAKIQAQEIIDSANKRRNEVLDEVKAEAETLKAKIIEQ
FT                   GYAEVEAERKRVQEELRVKVASLAIAGAEKIVGRTVDEAANNDIIDKLVAEL"
FT   gene            complement(375660..375914)
FT                   /locus_tag="Asuc_0331"
FT   CDS_pept        complement(375660..375914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0331"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   msu:MS2351 F0F1-type ATP synthase c
FT                   subunit/Archaeal/vacuolar-type H+-ATPase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73709"
FT                   /db_xref="GOA:A6VL62"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL62"
FT                   /protein_id="ABR73709.1"
FT                   /translation="MESVITATIIGASILLAFAALGTAIGFAILGGKFLESSARQPELA
FT                   SSLQTKMFIVAGLLDAIAMIAVGISLLFIFANPFISLLQ"
FT   sig_peptide     complement(375855..375914)
FT                   /locus_tag="Asuc_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.669 at
FT                   residue 20"
FT   gene            complement(375971..376756)
FT                   /locus_tag="Asuc_0332"
FT   CDS_pept        complement(375971..376756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0332"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   msu:MS2352 F0F1-type ATP synthase a subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73710"
FT                   /db_xref="GOA:A6VL63"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL63"
FT                   /protein_id="ABR73710.1"
FT                   /translation="MAGTTAGYIGHHLTFLSSGEGFWAVHLDTLFFSIVSALIFLFVFR
FT                   NVAKKATSGVPGKLQCMVEIVVEWINGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDL
FT                   IPVDFLPQLAGLFGIHYLRAVPTADISATLGMSLCVFALILFYTVKSKGFGGLVKEYTL
FT                   HPFNHWTLVPVNFILETVTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANAAIAALG
FT                   IPLHLAWAIFHILIITLQAFIFMMLTVVYLSIAYNKAEH"
FT   gene            complement(376771..377154)
FT                   /locus_tag="Asuc_0333"
FT   CDS_pept        complement(376771..377154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0333"
FT                   /product="ATP synthase protein I"
FT                   /note="KEGG: hdu:HD0003 ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73711"
FT                   /db_xref="GOA:A6VL64"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL64"
FT                   /protein_id="ABR73711.1"
FT                   /translation="MSFVVNQAKRHYRKALWIESGIILLVTLLVLVANFDATLSLLTGL
FT                   LSGFLPYCLFVYWLFFRYSPKNQSKMTALYCGEGLKWLATIVLIAASFKLITNLNVLAF
FT                   FIGYIMMLIFNNLIPFVFSKVKN"
FT   gene            complement(377435..378070)
FT                   /locus_tag="Asuc_0334"
FT   CDS_pept        complement(377435..378070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0334"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: pmu:PM1486 glucose
FT                   inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73712"
FT                   /db_xref="GOA:A6VL65"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL65"
FT                   /protein_id="ABR73712.1"
FT                   /translation="MANNLEQILREKLEILLQSTALSLSSQQKQQLVKLVLLLNKWNKA
FT                   YNLTSVRDPQEMLVKHILDSLVVSPYLRGERFIDVGTGPGLPGLPLAIINPDKKFVLLD
FT                   SLGKRMSFIRNAVRELELTNVEPVLSRVEEYIPDHKFDGVLSRAFASLKDMTDWCSHLP
FT                   VNNGLFYALKGQYNEDEIKQLDEKFTIQQVIKLDVPELQGKRHLILIK"
FT   gene            complement(378060..379949)
FT                   /locus_tag="Asuc_0335"
FT   CDS_pept        complement(378060..379949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0335"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: hin:HI0582
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73713"
FT                   /db_xref="GOA:A6VL66"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL66"
FT                   /protein_id="ABR73713.1"
FT                   /translation="MFYTENYDVIVIGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQM
FT                   SCNPAIGGIGKGHLVKEIDAMGGLMATAADRAGIQFRTLNASKGPAVRATRAQADRVLY
FT                   RQAVRQALENQPNLDIFQQEATDILLERERAAGVSTKMGLTFRAKAVILTAGTFLAGKI
FT                   HIGLTNYEGGRAGDPASVTLSHRLRDLGLRVDRLKTGTPPRLDARTINFDILAKQYGDA
FT                   ELPVFSFMGSTDQHPRQIPCFITHTNEQTHDVIRNNLDRSPMYTGVIEGIGPRYCPSIE
FT                   DKIMRFADRTSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMKIVNSMKGLENTRIVKPG
FT                   YAIEYDYFDPRDLKPTLETKAIGGLFFAGQINGTTGYEEAAAQGLLAGINAGLFVREKD
FT                   AWFPRRDQAYVGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADSRLTPIAHELGLI
FT                   DEARWARFNRKMDNITKERERLKQIWIHPQSEHLNHINGLLNAPLTREASGEDLLRRPE
FT                   VSYEKLTKTAAFSPALEDKQAAEQVEIAIKYQGYIEHQQEEIEKQKRHENTLIPERFDY
FT                   SLVAGLSNEVRAKLEQHRPVSIGQAGRISGVTPAAISILLVNLKKQGMLKRGE"
FT   gene            380457..382838
FT                   /locus_tag="Asuc_0336"
FT   CDS_pept        380457..382838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0336"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein; KEGG: msu:MS2357 organic solvent tolerance protein
FT                   OstA"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73714"
FT                   /db_xref="GOA:A6VL67"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL67"
FT                   /protein_id="ABR73714.1"
FT                   /translation="MFNRLAMKHSSYSFISLAILTALYSGGAWANADNLHRRCLSGVPQ
FT                   FTGEPVSGDANEQPVYIEADSADIINPSRATYSGDVDIKQGNRHLQAPQVVVTQKGEGA
FT                   NALRHAYANGAFNYRDELILLKGENARINLNNNDADITNSDYQFVGRQGRGTAESSENR
FT                   DDYRLLKNATFTSCLPDDNSWQIDASEIKQHIKEEYAEMWHARFKVGGVPVFYTPYLQL
FT                   PIGDRRRSGLLIPSAGHSSRDGYWFAQPVYWNIAPNYDMTITPKYMSQRGWQWLGEFRY
FT                   LNVLGEGKIFGEYLGDDRYDDYTGENRSRHLFYWKHDARLWDDWRLNIDYTKVSDKRYF
FT                   SDFDSDYGNSTDGYATQSARLSYYQPNWNLTVSAKQFQIFDEVDIGPYKALPQIDFNYY
FT                   KNGLANGWLDFKLFAQAVHFDNDSKSMPTAWRYHAEPSLNIPLANKYGSLNIETKLYAT
FT                   HYQQKAGTGVDADIQKSVNRTIPQVKVDLQTVLASNETFIKGYTQTLEPHVQYLYRPYR
FT                   NQSNIGSKRYSDYLGLGYDSALLQQDYFSLFRDRRYSGLDRIASANQFTLGGTSRFYDE
FT                   NANERFNVSLGQIIYLNDSRIDENSNNSTTGRSSSWALESNWKINNQWNWRGSYQYDTR
FT                   LDAVSLMNTSLEYNPERNNLIQLNYRYASKEYIDQNLTSGVNRYNQDIKQLGSTVAWEI
FT                   ADNWAVVGRYYHDIALNKAVEQYAGVRYNTCCWSAGVGVRRYLVRESDTRKYSDSKDTL
FT                   YDNSVNFTVELRGLGPNDHHSGLVDMLDKGMLPYVKPFNL"
FT   sig_peptide     380457..380549
FT                   /locus_tag="Asuc_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            complement(382909..383718)
FT                   /locus_tag="Asuc_0337"
FT   CDS_pept        complement(382909..383718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0337"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: msu:MS0133
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73715"
FT                   /db_xref="GOA:A6VL68"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL68"
FT                   /protein_id="ABR73715.1"
FT                   /translation="MDNYAVWGNPIKQSKSPQIHKIFAEQTKQCMEYKAILGDPEKFET
FT                   ELLRFFADGAKGCNITAPFKERAYSLADEYSERALTAEACNTLKRLQDGRLYADNTDGA
FT                   GLVSDLERLGWLKSKQSLLIIGAGGATKGVLLPLLQAQQNITLCNRTLTKARDLADKFA
FT                   PYGNIQAMKLSEIPVQKFDLVINATSLGLQGKTVDIEPEILRLAGAVYDMQYDKGKDTP
FT                   FVAWAKALGVQNVHDGFGMLVGQAAHSFYLWRGIMPDIKPLLENDLI"
FT   gene            complement(383721..384272)
FT                   /locus_tag="Asuc_0338"
FT   CDS_pept        complement(383721..384272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0338"
FT                   /product="SUA5/yciO/yrdC domain"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: hin:HI0656
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73716"
FT                   /db_xref="GOA:A6VL69"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL69"
FT                   /protein_id="ABR73716.1"
FT                   /translation="MNFTEIAEKLKQNQVVAYPTEAVFGLGCNPLSESAVKKLLDLKQR
FT                   PIDKGLILIAPDLLYLLPFIDTERLNSRQISRLTANYSHPVTWVVPVKFGTPKFLTGRF
FT                   NSIAVRISDHPAVAELCSLTGFALTSTSANLSGLPPCKTAAEVRSQFGQFFPVLDYPVG
FT                   HAEKPSEIRNLLTDQLIREG"
FT   gene            complement(384269..384817)
FT                   /locus_tag="Asuc_0339"
FT   CDS_pept        complement(384269..384817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0339"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: msu:MS0131 Zn-finger domain associated with
FT                   topoisomerase type I"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73717"
FT                   /db_xref="GOA:A6VL70"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL70"
FT                   /protein_id="ABR73717.1"
FT                   /translation="MASALFEHTKHQEFCPQCGSPLQIRQSKKALFLGCSGYPKCDYIK
FT                   PLQPFSENKILKQLNETCPECGRFLQLKQGSFGMFIGCSGYPDCHFVVHDKEEATEESV
FT                   PCPECKKGELVARRGRQGKTFYGCNRFPVCKYTVAGKPYAVNCPQCGSLPVMLKKQTET
FT                   RRTFICLNKSCKHQFDIKL"
FT   gene            384896..386365
FT                   /locus_tag="Asuc_0340"
FT   CDS_pept        384896..386365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0340"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   msu:MS0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73718"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL71"
FT                   /protein_id="ABR73718.1"
FT                   /translation="MQQLLENPYFLTALLLGLLCLILLFMLLRRSRDAQELQQDLTKNI
FT                   QDYNRLADKFDALGALKNQQDLAVARFQTSNDYLHNEIAERDRALQTERDELSKTREKL
FT                   TALSQELTAFKITLAEKEKNFAEQQQNFTQSKQQLSVEFQNLANRILEEKSQSFSQSNQ
FT                   TALDALLKPFREQIEGFQKRANEIHSENVKGNTALESEIKKVLDIGLSMSQQANNLTSA
FT                   LKGEKKTLGNWGEVQLERALQLAGLMKDEHYRTQVHFKDEQGKNNYPDFVIYLPDNKHL
FT                   IIDSKMSLVAYESAVNCEDESQRAQFMREHVKAVRNHINDLSQKDYSNLIGMRSPNFVL
FT                   MFIAVEPAYIEAMKTDTELFNFGYNKNVIMVSHTTLMPILRTVANLWRMERGNEEAREI
FT                   SERAGEIYNQICLVAERLAKLGATLSTVNTRYNETVTALAGQQGLVGKVERFKDLSAKA
FT                   NKTLPKVELLHNDVETDKLSVVKAVDDNSED"
FT   sig_peptide     384896..385000
FT                   /locus_tag="Asuc_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.848 at
FT                   residue 35"
FT   gene            complement(386512..386946)
FT                   /locus_tag="Asuc_0341"
FT   CDS_pept        complement(386512..386946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0341"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   hin:HI0670 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73719"
FT                   /db_xref="GOA:A6VL72"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL72"
FT                   /protein_id="ABR73719.1"
FT                   /translation="MIALIQRVTRAQVDVDGKTAGKIGKGLLVLLGVEKEDNQARANKL
FT                   AEKVLNYRVFGDENDKMNLNVRQAQGELLVVSQFTLVADTGRGLRPSFSNGATPALADE
FT                   LYRYFIRKCREKIQVETGEFAANMQVSLTNDGPVTFWLQS"
FT   gene            complement(386943..387806)
FT                   /locus_tag="Asuc_0342"
FT   CDS_pept        complement(386943..387806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0342"
FT                   /product="putative ribonuclease BN"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: msu:MS0032 tRNA-processing
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73720"
FT                   /db_xref="GOA:A6VL73"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL73"
FT                   /protein_id="ABR73720.1"
FT                   /translation="MKTAFTPFASFGKIFLQRFGQNKLLLEAGALTYSTMLAIVPLIMV
FT                   IFSIFSAFPIFNDVTGVLKEFIFTNFAPSASDVVGQYIDQFVQNSKKMSAVGIISLIVV
FT                   ALMLINSIDNSLNGIWRTPKRGTLFSFAVYWTILTLGPIIMGVSIAISTYVTNLSLFRG
FT                   ELNLPFGIKLLGFVPFILTWLSFTLIYAIVPNKKINIKHAAAGALVAAVFFTLGKKAFM
FT                   WYITTFPSYQLIYGAMATLPLMLLWLQLSWLFILLGAQLAAVLDEIQLEQNNEIHSEQV
FT                   NNKDKK"
FT   gene            complement(387803..388267)
FT                   /locus_tag="Asuc_0343"
FT   CDS_pept        complement(387803..388267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0343"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: msu:MS0033
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73721"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL74"
FT                   /protein_id="ABR73721.1"
FT                   /translation="MTALCPCQSGLDYADCCEPFHSFKTCPQTAEQLMRSRYCAYVLKN
FT                   IDYVIQTTVPGQQAQLDKTLLQDWANDTSWTGLQIVRHQPAVSKIHSKVEFNAFFKVND
FT                   EKQTHNENSLFVKIDGRWYFVDSTVELPNQKHPCLCGSGKKFKHCCGAYL"
FT   gene            388416..389918
FT                   /locus_tag="Asuc_0344"
FT   CDS_pept        388416..389918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0344"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; SMART: AAA ATPase; KEGG: pmu:PM1435
FT                   hypothetical E.coli"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73722"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL75"
FT                   /protein_id="ABR73722.1"
FT                   /translation="MNIYHIARNARGETFGIHKKMANRHGLIAGATGTGKTVTLRKCAE
FT                   AFSDDGVPVFLVDVKGDLSGLSQKGALQGKIAERVEKLELGGEDYLDAYPVSFWDVFGN
FT                   SGIALRTTVSEMGPMLLARLLNLNDTQEGLLNILFRVADDKGLLLIDLKDLRAMLKYLA
FT                   DNAKEFQLQYGNISAASVGAIQRALLALENQGADKLFGEPALNLEDWLQTRDGKGVINV
FT                   LNSEKLINSPKMYSAFLLWLMAELFERLPEVGDPDKPKFVMFFDEAHLLFDGAPAVLVE
FT                   KVEQVVRLIRSKGVGIYFVTQNPLDLPESVLGQLGNRVQHALRAFTPRDQKAVKSAAET
FT                   FRSNKDVNVVEAITTLGVGEALVSFLDEKGMPTPVEIAMIYPPKSRLTPLTEEQRQAWV
FT                   KNDGLYPHYSAYVDNISAFEVLQQQADLAKVAEQQAKLAQEEEENGILGSLSRMIFGTK
FT                   KRGEKLTPTEQIVNGVVKSVGRNMRNQITKQIMRGILGALKK"
FT   gene            389981..392557
FT                   /locus_tag="Asuc_0345"
FT   CDS_pept        389981..392557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0345"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein; KEGG: msu:MS2244 mutS-like ATPases involved in
FT                   mismatch repair, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73723"
FT                   /db_xref="GOA:A6VL76"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL76"
FT                   /protein_id="ABR73723.1"
FT                   /translation="MPNFDAHTPMMKQYLTIKAENPDILLFYRMGDFYEMFYDDAKKAA
FT                   ALLDISLTKRGQSAGRPIPMAGVPYHAVEGYLAKLVQLGESVAICEQIGDPAASKGPVE
FT                   RKIVRIVTPGTVSDENLLPERQDNLLVAVYQEKDRFGLASLDMSSGRFQIAEAENAETL
FT                   HAELQRLQPAELLYSEDFSEMAIIEQTKGLRRRPIWEFELGTAVQLLNRQFGTKDLKAF
FT                   GVEKAVLGLCAAGCLFQYAKETQRTALPHIKSISLVQNSDTVQLDAATRRNLELTRNLS
FT                   GGTENTLASVLDKCVTPMGSRLLKRWIHQPIRKIQKLRQRQQTIAAILQDDLIDELQPL
FT                   LRQVGDMERILARVALRTARPRDLTRLRTALEQLPQLQQIIKTLQNLTALSQPMGEFAE
FT                   LCDLLQRAIIDSPPLLIRDGGVIAPGYHAELDEWRSLADGATQYLADLERRERESTGID
FT                   TLKIGYNAVHGYYIQISQGQAHNAPMHYVRRQTLKNAERYIIPELKTYEDKVLKAKGAA
FT                   LALEKQLYEEIFDQLLPHLAALQLSSMTLAELDVLTNLAERAETLNYVCPEFSPEIGVE
FT                   IQNGRHPVVEQVLKEPFIANPVCLNPQRRLLVITGPNMGGKSTYMRQTALITLMAYMGG
FT                   FVPAERAVIGPIDRIFTRIGASDDLASGRSTFMVEMTEMANILHQATADSLVLIDEIGR
FT                   GTSTYDGLSLAWACAEWLAKKLRSLTLFATHYFELTVLPEQFAGTANVHLDALEHDNTI
FT                   AFMHAVQDGAASKSYGLAVAALAGVPQQVIKLAKQKLAQLEKLSAQSADQKLQDLRTLH
FT                   QMQGELALMEEDDGKNAALEMLEKLDPDELSPKQALAYLYQLKTLL"
FT   gene            392566..392874
FT                   /locus_tag="Asuc_0346"
FT   CDS_pept        392566..392874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0346"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG: msu:MS2082
FT                   protein implicated in iron transport, frataxin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73724"
FT                   /db_xref="GOA:A6VL77"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL77"
FT                   /protein_id="ABR73724.1"
FT                   /translation="MNVAEFHQNIDQLWDSIEEQLEAQDADADCDRQGSVFTITFDDRS
FT                   QIVVNKQEPLLELWLASRLGGLHFAWKNNDWVNGQGVRFWDALTEACQAHGEQVSFI"
FT   gene            392874..394718
FT                   /locus_tag="Asuc_0347"
FT   CDS_pept        392874..394718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0347"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases; KEGG: msu:MS2081
FT                   superfamily II DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73725"
FT                   /db_xref="GOA:A6VL78"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL78"
FT                   /protein_id="ABR73725.1"
FT                   /translation="MDKTAEISTALQKLKEVFGYQAFRLGQEEAINAALQGQDSLVVMA
FT                   TGNGKSLCYQLPALCFPGLTLVISPLISLMKDQVDQLLANGIEADYLNSTQTFEQQQQV
FT                   QNKAISGQLKLLYLSPEKVMTNSFFSFISLCQVSFIAIDEAHCISQWGHDFRPEYTQLG
FT                   GLKASFPDAPIMALTATADSTTRQDILQNLRLNRPHLYVGSFDRPNIRYTLVEKFKPVE
FT                   QLCNFVVAQKGKSGIVYCNSRNKSEKVTEALKKRGVSAEFYHAGMDVTERERVQRAFQH
FT                   DNIQVVVATIAFGMGINKSNVRFVAHFDLSRSIEAYYQETGRAGRDDLPAEAVLFYEPS
FT                   DYGWLHKILMEEPESPQRDIKLHKLEAIGEFAESQTCRRLVLLNYFGENRQKPCGNCDI
FT                   CLDPPKKYDGLLDAQKILSAIYRTGQRFGVQYVIGVLRGLNNQKIRDHRHDTLSVYGIG
FT                   KDKSKEYWQSVIRQLIHLGFIRQVMNEVGVMLHLTESARAVLRGEIKLELATPRLSAIA
FT                   TVASPQRSAVTNYDKDLFARLRFLRKKIAERENIPPYIVFSDATLQEMSLYLPTSKAEM
FT                   LQINGVGAIKWDRFAQPFMAIIKEHKALFERSRQSLSQ"
FT   gene            394853..395227
FT                   /locus_tag="Asuc_0348"
FT   CDS_pept        394853..395227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73726"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL79"
FT                   /protein_id="ABR73726.1"
FT                   /translation="MKFNAKAALIAIFAGFFSATVFAAHIPRDIYVPYDADIVKADRKG
FT                   DGEFEAEFRLDSRDVSVPELAREVIRHARARGFHLEEKDIEHDDADLKFERGDEELDVS
FT                   IELKDHHRIEYKADLDLDRN"
FT   sig_peptide     394853..394924
FT                   /locus_tag="Asuc_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            395363..395884
FT                   /locus_tag="Asuc_0349"
FT   CDS_pept        395363..395884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0349"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   msu:MS0271 proteasome protease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73727"
FT                   /db_xref="GOA:A6VL80"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL80"
FT                   /protein_id="ABR73727.1"
FT                   /translation="MTTIVCVRKDGKVAIGGDGQATLGNSVEKGTVRKVRRTYKGKVVT
FT                   GFAGSTADAFILLELFEKKLELHQGHLVKSAVELAKEWRTERSLRRLEAMMIVADETDF
FT                   LLISGSGDVIEPEFDVLAIGSGGNYAKSAALALLRTENNLTAVEIVKEALTVAGDIDIY
FT                   TNHNHIIEEI"
FT   gene            395960..397285
FT                   /locus_tag="Asuc_0350"
FT   CDS_pept        395960..397285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0350"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: msu:MS0272 ATP-dependent protease, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73728"
FT                   /db_xref="GOA:A6VL81"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL81"
FT                   /protein_id="ABR73728.1"
FT                   /translation="MSTMTPREIVSELDAYIIGQSEAKRAVAIALRNRWRRMQLPEELR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLANAPFVKVEATKFTEVGYVGKEVDTIIRDLT
FT                   DMAVKQIRKIEVEKNRMKAQDAAEERILDILLPRAKNKWGETEYEKDSATRQVFRKKLR
FT                   EGALDDSEIEVDISSQMNVEIMTPPGMEEMTSQLQSLFEGLSPSHSKKRRMKVKDAMKV
FT                   LIDDEAAKLVNNEDLKQKAIESVEQNGIVFIDEIDKICKQSDRGGADVSREGVQRDLLP
FT                   IIEGSTVNTKHGMVKTDHILFICSGAFQVARPSDLLPELQGRLPIRVELKSLTKEDFER
FT                   ILTEPSASLTLQYKELMKTEGVTVEFTPDGISKIAEAAFHVNEKTENIGARRLHTVLER
FT                   LMDGISFDASERSGESVVIDEKYVSEVLNDVVDNEDLSRFIL"
FT   gene            complement(397467..398486)
FT                   /locus_tag="Asuc_0351"
FT   CDS_pept        complement(397467..398486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0351"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: msu:MS0292 Hmp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73729"
FT                   /db_xref="GOA:A6VL82"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL82"
FT                   /protein_id="ABR73729.1"
FT                   /translation="MAKTNKNPLCINELQVYSIVQEAPKVKTINFIAQDFYPYEAGQYA
FT                   LVSIRNTPHITRAYSLSSTPGESRFVSITVREIDGGIGSSWLNNEVKVGDQVWFSNPMG
FT                   DFSCQKIIADNYLLAGAGSGITPIMSMTRWLLKNRPEANITVIHSVHSPEGVIFKSEWA
FT                   QLKADNPGLNLVFNASVDATDGFEHGRISKQMLAKAVPNITDYTVMTCGPQTYMNALKS
FT                   MFLALGGSEQRFFTEAFFNTALADDISSDKKTTLTVNGAKPIKTEVPVGMTLLAALEAQ
FT                   EQPVVSGCRTGLCGLCKTKITGGEYETVSTGDLTEQEIAQGYVLACSCRVKENVTVEL"
FT   gene            complement(398576..400237)
FT                   /locus_tag="Asuc_0352"
FT   CDS_pept        complement(398576..400237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0352"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: msu:MS0291 6Fe-6S prismane cluster-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73730"
FT                   /db_xref="GOA:A6VL83"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL83"
FT                   /protein_id="ABR73730.1"
FT                   /translation="MYCVQCEQTMITPKGNGCSFSQGMCGKTAETSDLQDLLIACLHSL
FT                   SAWAVKAREYGIINHEADNFAPRAFFATLTNVNFDSARIAGYAQQALIYRNQLIKAVSA
FT                   FESNPTLDHPLANIELNGVSVDKLARQAKQFALDTDRAKIGEEAHGVRLLCLYGLKGAA
FT                   AYMEHAYVLDKFDNDIYAQYHGFMSWLGTHPSDLNELLEKALAIGSMNFNVMAMLDAGE
FT                   TEHFGNPVPAMVNVRPVKGKCILISGHDLKDLKELLEQTEGKGINVYTHGEMLPAHGYP
FT                   ELKKYKHLVGNFGSGWQNQQKEFARFPGAIVMTSNCLIDPNVGDYADRIFTRNIVGWPG
FT                   VTHLEEHDFSPVIEKALECDGFPYTELEHLITVGFGRKTLIDASDAVIDLVKAGKLSHV
FT                   FVIGGCDGDKEERHYYTDLAYALPKDTAVLTLGCGKYRFNKLDFGTIDGGLPRLLDAGQ
FT                   CNDTYSAIMLAVTLSQKLGIGLNELPLSIVLSWFEQKAIIVLLTLLALGVKNVYSGPSK
FT                   PAFLNDNVMALLHEKFGLSGLTTPEQDFGHIIGKNA"
FT   gene            complement(400441..401703)
FT                   /locus_tag="Asuc_0353"
FT   CDS_pept        complement(400441..401703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0353"
FT                   /product="HemY protein"
FT                   /note="TIGRFAM: HemY protein; PFAM: HemY domain protein;
FT                   KEGG: pmu:PM1815 hemY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73731"
FT                   /db_xref="GOA:A6VL84"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL84"
FT                   /protein_id="ABR73731.1"
FT                   /translation="MFRVLFLMLALLAGLIAGPYLAGKQGYVLIQTENYNYELSIVTLI
FT                   IFLVFALAVIYGIEWLVSRFCRLSNSTYGWFSRRKRMKAQKQTLEGLMRMNEGDYSKAE
FT                   KLIGKNAKHSEEPILNFIKAAEAAQQRGDDFSANKYLIEATELAGSDNLLVELARTRIL
FT                   LQQQKLPAARSSVDSLLILAPKNPEVLKLAVEIYRKSKAYAALDDILQQAEGLYPDAEY
FT                   TALQREAEDGLLDEKMNDEGLDGLLAWWDDQSRKRRNDNYVRVGLIRRLIDCNDHEKAY
FT                   ELTLDTLKKVEDEPELNNALLTQITRLQPVDSSKLIKQLEKNALNLPENKQCNIQRALG
FT                   YLFVRNNDFMHASDAFKKVLAQKDQWHHYDATMAAYVFEQIGDIVTAKEIRQEILKNAM
FT                   TPTKHKPVNITVKSTDKSEKR"
FT   sig_peptide     complement(401635..401703)
FT                   /locus_tag="Asuc_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.793 at
FT                   residue 23"
FT   gene            complement(401715..403151)
FT                   /locus_tag="Asuc_0354"
FT   CDS_pept        complement(401715..403151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0354"
FT                   /product="protein of unknown function DUF513 hemX"
FT                   /note="PFAM: protein of unknown function DUF513 hemX; KEGG:
FT                   msu:MS0274 uncharacterized BCR"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73732"
FT                   /db_xref="GOA:A6VL85"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL85"
FT                   /protein_id="ABR73732.1"
FT                   /translation="MSDKKEISNAEIKADEPILAKKGDAKTEQPKSKREQTEKTNPSSH
FT                   RATQADPPKPETVVVKKGGSGLAFLALLVALGVGAAGYYFGQQEVAKINQKMTALENKI
FT                   GSAPVTETTADSLPTIAQDNEQLTKLVNELKATDEKLSNLEVTLSDKDKALSALQSQVT
FT                   NVASNMNAQPSEWLLSEADFLLTNALRKLMLDNDVETGIALLKISDEVLAKVSEPEAKT
FT                   VRAAINADLKQLLSVDSIDQNAVMQRLSQLANSVDELVVMNLNFGDHDVQTQDEQVSDN
FT                   VTDWKNNLQKTATSFLNHFIRISPRTDKVTQALLAPNQDIYLRENIRLRLQIAILAVPR
FT                   QQNELYKQSLETVAAWVRSYFDTDTELAKNFLKSVDELAEQSIYVDVPNQLNSLNALDK
FT                   LLNKKPQEIQKIEISADKGLTEANQAAAKEIKSEEKSEDTKADIKSEAVTSAVPKTEES
FT                   KAEQPKADSPKTEDKPAENQ"
FT   gene            complement(403161..403910)
FT                   /locus_tag="Asuc_0355"
FT   CDS_pept        complement(403161..403910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0355"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   msu:MS0275 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73733"
FT                   /db_xref="GOA:A6VL86"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL86"
FT                   /protein_id="ABR73733.1"
FT                   /translation="MAVLVTRPDSRGEQLTEALNKAGVAALHMPLFSISAGRELNELPN
FT                   KMYQLKAGDYVFAVSKNAVEFAAETLSNTGFRWRQDLIYFAVGQSSAEYFCEQSEQPVH
FT                   YPYGHENSEGLLALPQMQRLTDKTVLILRGNGGRELFPAQAVRRGAQVEIIECYRRVPV
FT                   EYDPKKQTDLCQRAGINTIIATSSEILTRLTNFVPAEERDWLTQCRLVTASYRVAKSAE
FT                   RAGWQKRQILIAPRADNATLVKMLAEK"
FT   gene            complement(403931..404860)
FT                   /locus_tag="Asuc_0356"
FT   CDS_pept        complement(403931..404860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0356"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase; KEGG: msu:MS0276 porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73734"
FT                   /db_xref="GOA:A6VL87"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VL87"
FT                   /protein_id="ABR73734.1"
FT                   /translation="MQQEILKIATRQSPLALWQANFVKDRLTEIYPDLTVELVPMVTKG
FT                   DVILDTPLAKIGGKGLFVKELENALLNGDADIAVHSMKDVPMEFPAGLGLSVICKREDP
FT                   RDAFVSNRYRTLDDLPPGAIVGTSSLRRQCQLKKRRPDLNIRSLRGNVGTRLSKLDQGD
FT                   YDAIILASAGLIRLALPERIASFIETEISLPAAGQGAVGIECRINDQRVQKLLAPLADT
FT                   ETTACVLAERAMNNRLQGGCQVPIGGYAVLNGNELHLRALVGALDGSKIIRAEGKSAVE
FT                   NAEVLGIQIAESLLAQGADKILAEVYNG"
FT   gene            404994..405977
FT                   /locus_tag="Asuc_0357"
FT   CDS_pept        404994..405977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0357"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: msu:MS1531
FT                   PurR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73735"
FT                   /db_xref="GOA:A6VL88"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:3C3K"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL88"
FT                   /protein_id="ABR73735.1"
FT                   /translation="MSIQDLARRAGVSVATVSRVLNNQPSVKPQNKEKVLAAIKELNYQ
FT                   PNLLARQLRTAKTGMLLVMVSNIANPFCAAVVKGIEKTAEKNGYRILLCNTESDLARSR
FT                   SCLTLLSGKMVDGVITMDALSELPELQNIIGAFPWVQCAEYDPLSTVSSVSIDDVAASE
FT                   YVVDQLVKSGKKRIALINHDLAYQYAQHRESGYLNRLKFHGLDYSRISYAENLDYMAGK
FT                   LATFSLLKSAVKPDAIFAISDVLAAGAIQALTESGLSIPQDVAVVGFDGVDISQITVPA
FT                   LTTVQQPSEQIGMKAVSLLLEQIHSDVLAKTVHHLLPWKFVRRQSS"
FT   gene            406088..407311
FT                   /locus_tag="Asuc_0358"
FT   CDS_pept        406088..407311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0358"
FT                   /product="nucleoside:H symporter"
FT                   /note="PFAM: nucleoside:H symporter; major facilitator
FT                   superfamily MFS_1; KEGG: msu:MS1530 ProP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73736"
FT                   /db_xref="GOA:A6VL89"
FT                   /db_xref="InterPro:IPR004740"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL89"
FT                   /protein_id="ABR73736.1"
FT                   /translation="MNTEAKQPALIVPRLSLMMFMEFFIWGSWSVTLGIVMTKYDLSTL
FT                   IGDAFSMGPIASIISPFILGMLVDRFFPSEKVLAVLHLIGAAILWFIPDFITGQQGGTL
FT                   VFALLAYMLCYMPTVALTNNIAFHSLTDSEKSFPVIRVFGTIGWIVAGLFIGQADLSAS
FT                   PAIFQVAAICSLILGVYSFTLPNTPPPAKGKPFSMRDLMCADAISLFKIPHFLVFAVCA
FT                   TLISIPLGTYYAYAAPFLDAVGFEKIGSLMSMGQMSEIVFMLLIPFFFKRLGVKYMLLA
FT                   GMIAWFLRYAFFALGVSDEIRWAVYLGILLHGVCYDFFFVVGFMYTDKVADEKIRGQAQ
FT                   SLVVLFTYGLGMLLGSQISGGLYNNMFADNAELSTWSTFWWIPAVSAVVISVIFFIFFN
FT                   YKENKKEA"
FT   gene            407313..408368
FT                   /locus_tag="Asuc_0359"
FT   CDS_pept        407313..408368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0359"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: AP endonuclease 2 domain protein; Xylose
FT                   isomerase domain protein TIM barrel; KEGG: msu:MS1529 IolE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73737"
FT                   /db_xref="GOA:A6VL90"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL90"
FT                   /protein_id="ABR73737.1"
FT                   /translation="MKTIKGPGLFLAQFIDNKAPFNRLDSLAQWAAGLGFRALQIPCNH
FT                   KPIFDVELAAQSQTYCDEVKGVLAQYGLVISELSTHLEGQLVAVHPAYDTAFDGFAPEQ
FT                   VRGNGAARQAWAMNVIKQAAVASKRLGLNAHASFSGALAWPYFYPWPPRKEQLIQMAFD
FT                   ELAKRWKPILDHFDEQGVDVCYELHPGEDLHDGVTFERFLDKLNHHPRCNILYDPSHML
FT                   LQNMDYVRFIDFYHERIKAFHVKDAEFVKSGKSGCYGGYQNWLERAGHFRSLGDGQVDF
FT                   KAIFSKLTQYDYTGWAVLEWECCMKDSAVGAKEGAEFIQKHIIPVAEKSFDNFADTGDD
FT                   RKQAKIMLGLK"
FT   gene            408380..409531
FT                   /locus_tag="Asuc_0360"
FT   CDS_pept        408380..409531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0360"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain;
FT                   homoserine dehydrogenase NAD-binding; KEGG: msu:MS1528 MviM
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73738"
FT                   /db_xref="GOA:A6VL91"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL91"
FT                   /protein_id="ABR73738.1"
FT                   /translation="MKKIKVGVVGTGFIGVAHIEAVRRLGFVDVIALVESNQELADKKA
FT                   KELNIPLAYDDIDKLLANPDIQVVHNCTPNHVHFDINKKIMLAGKHVFSEKPLCLTSQE
FT                   ADELVALAEKQGVVTGVGFVYRNFAMVQQAADMVRDQQIGRIFAVNGHYLQDWMLLETD
FT                   YNWRVDPKVGGKSRTVADIGSHWCDTVQFVTGKKIKEVCADMSIVYPTRKASKLVESFA
FT                   SADVDSAYELKPVETEDYASVLVRFEDGSKGSFTVSQITAGHKNDLLFDLSGSEKSLHW
FT                   EQENPQYLKIGYRRQANRILCDDPSLVNPCVRAYNHFPGGHIEGWPDAFKNMMLAFYTF
FT                   IAEGKNPQKDEAKFAMFKDGAQIVHIVDAIIDSAQQGKWVAVK"
FT   gene            409689..412229
FT                   /locus_tag="Asuc_0361"
FT   CDS_pept        409689..412229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0361"
FT                   /product="putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylate cyclase class-I; KEGG: pmu:PM1811
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73739"
FT                   /db_xref="GOA:A6VL92"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL92"
FT                   /protein_id="ABR73739.1"
FT                   /translation="MKYDLEFARKQVADLEKFRLFRALSGTTDEFRYVFQLIALLLHAN
FT                   HPNLPGFVADAPTGIADFKLTDYQRHYLHEILAQSSDIQFPQIFDRTSYAIDGVYVMGS
FT                   IASIAQTTSSDLDIWVCLREGLKAREREKLQQKAAALQRWAKQYEVDVNLFLMDQNRFR
FT                   NFQSSGVMTKENCGSTQYMLLLDEFYRSAIRLAGKPLLWLHLLVEDEKNYESEVDDLIR
FT                   RGEIDPLEWVDFGGLGKFSANEYFGASLWQLYKGIDAPYKAVIKILLLEEYSWEYPNTR
FT                   LIASDFKFHLLMGHTEDHHFDPYLEMLERVTDYLTYRKDFKRLDDMRHCFYLKATEDWW
FT                   YRNESNWRVDLINRLAQDWGWSKETIQDLNLRPFWKIKRVKQSYNKLMQMLMVSYRNLI
FT                   DFARKHHVDANIVPQDISILTRKIYTAFEELPGKVLLINPQISTDLSEPYLTFVEVTAT
FT                   DRPVKKGWYMLNQAPEVSGFSHPRYTEYSATLHKLVASAYFNGLLMPHTRLHIQSPNVS
FT                   LPILQEFITNLAETLPVHALPPTNDDLHHPCEIRQLMVAINLSNDPTKQLTDSKMPIQQ
FT                   SDLFSFGSEQQNLVGSIDFIYRNLWNEIRTLHFEGPNAILMALKVLSNKIHHGSTALAN
FT                   IEVYSYSRNYRYSLANIVTALIKKCIDIQLGTNQAANSQSMLRVAGKNWQFFFEERGIS
FT                   LHELPENQELPVNELDKELYAEINKNDSVLPVRYEQNMPEKLQYPSEIDSFASEGFLQF
FT                   FFEDNSDDTFNVYILDEKNHVEIYHRCDGEKEQKINEINYIYTNADSSGNNPYGIIQQN
FT                   FNYPQFYRIIHNRYYEGNNPPVHIVPFQRQAKYT"
FT   gene            412438..413067
FT                   /locus_tag="Asuc_0362"
FT   CDS_pept        412438..413067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0362"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: hso:HS_0042 nitrate/nitrite response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73740"
FT                   /db_xref="GOA:A6VL93"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL93"
FT                   /protein_id="ABR73740.1"
FT                   /translation="MTEKTKVLLIDDHPLMRRGIKQLIELDEIFEVVGDAGNGNDGISL
FT                   ALQLEPDLIVLDLNMKGLSGLDTLKALRNEGVDARIVILTVSDAKNDIFALIDAGADGY
FT                   LLKDTEPDVLLVQLKRIAGGEVVLSDSIKDLLLERHASKDPIYSLTDREMDVLQQIATG
FT                   LSNKQIAGKLFISEETVKVHIRNLLRKLNVHSRVAATVLYLEHKAN"
FT   gene            413332..415170
FT                   /locus_tag="Asuc_0363"
FT   CDS_pept        413332..415170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0363"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: msu:MS0285 predicted
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73741"
FT                   /db_xref="GOA:A6VL94"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL94"
FT                   /protein_id="ABR73741.1"
FT                   /translation="MTLFIRFAAIIAGLAALLCSHAVIAEETDTEVGAEQNTAEEPFEI
FT                   PPVEDTESVAKVDVRVDGIRDDRLSENVRIYLEAMDKNEADGSERHQYLLRENISKALR
FT                   VFGYYNSQVYFDLQPRSGKKDLLIASVNVGEPVRIDSTDIEISGEAAEDEEFRKLDKNV
FT                   PAKGAVLEHEIYDDYKSSLEKLARQRGYFDADFPVHELQVMPSTNQGWWHLVFNSGQRY
FT                   HYGDISFHGSQIREDYLRNILKIQSGDPYLINDVSGMTSDYSSTNWFQSVLVKPTLHED
FT                   SKLVDLAVLLRPRKKNSMELGIGYGSDSGPHTQIGWTRPWINSRGHSVRSNLYISSPKQ
FT                   NFEATYKMPLLKNPLNYYYEFSTGFEHEDDTKTDTQSTAATVAALRFWNHPTGWQYSAG
FT                   LRARYDNFTQADVDEKTLLIYPTATVSRSRISGGTFADRADTISVTVDLGRKMWASDVN
FT                   FFRIRANAGWIKTFATNHRFLTRGDIGYLHTDEFNRIPPALRFFAGGDRSVRGYGYKKI
FT                   APKDSRNGKLVGGSRLATGTLEYQYQVVQDWWAATFFDAGFAANRFSSDELRYGAGVGV
FT                   RWASPVGPIKFDIATPVRDKDDSKNIQFYIGLGTEL"
FT   sig_peptide     413332..413409
FT                   /locus_tag="Asuc_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            415180..419094
FT                   /locus_tag="Asuc_0364"
FT   CDS_pept        415180..419094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0364"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   msu:MS0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73742"
FT                   /db_xref="GOA:A6VL95"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL95"
FT                   /protein_id="ABR73742.1"
FT                   /translation="MTHQEQKPSQSAVKKSDVSTGRKSSLAGRVIRCSLISVTVLAGLV
FT                   IAGLAGILGSESGTKWALGLADKWVDGLTLGEVSGKLQQGLTLKNTVFSTNGVDVRVPY
FT                   ARLQLDFRCLLHREICVEDIRIQQPQVAVNSALIPPSEHESEPESGPIERLNLPVFVRV
FT                   KNIGIDEASVDIDNHHLSLTQFKSAVSLNNENGLTLEPTLLDGFSFLSTTTTEDAEREA
FT                   LQAAEAAKNAPPMDWTALEQTLTPAFLGGIKQITLPFDIHIADIQGKGWSYETRRDAVA
FT                   GQNIQIPEFRIQADATGYDVVLQTLVVNSSLGTLKGDGKMRLNGEMPVDFRIRSDIEPI
FT                   IADKQILLPKSALDLTLSGALKNVTALTLNSKGALNAVLVGEVEPAKDKMPFSLRLTSS
FT                   AAQYPFSGTDPLKLSNVNLNVTGNLLDYHATLSAQAKGMGVPNTHLDFIGSGRLYEAVI
FT                   EKLQLNALEGSLNMKGNAGWKEGVTWQSAVDLSKINIGAYVKSFPAVLSGKLTSDGRVS
FT                   GENWLINVPELDINGVVSKRPLVLKGKLTANQNELLNLSDLRLVYGENNITAKGVLSEK
FT                   SDFRLDINAPDLSGLLPELSASLKGKIALTGQITAPDLDMDLTGRQIRFQDLHLANLNA
FT                   KSKISSDKLVRGNTDITLVGFRYGDGIQLKHAVLTARGDEKHHELHLRSQGEPVAANLD
FT                   LSGSFDRTSQVWKGVISQTDIYTPLGDFKNNRFNAVYDNKAVNADISAHCWTNPDIELC
FT                   FPKAFNAGKNGDITFDLKKLDLNLVNKLTESDMLKGALRSQGNVAWFSDKPLKLDVKVD
FT                   GNNIQLAQKLDYRTFKLGMPKLSLSAKMENNNLNAKSDIQLQNQSTLNADLNIQDIAQG
FT                   RKLSGNLNIRGLNLNLVNQLLSGGENVSGDVNADLKFGGSLENPLLNGDFRINRIKAMV
FT                   NAMPFRVSNGELALQFHGNRSILNGHIQTPESRLELNGDADWTSLENWHTRVHANAKNF
FT                   YLNIPSMAKLKVSPDVEMKAGPSLLELAGSVDIPWGRITIESLPESAVSVSSDEVILDG
FT                   KTARNKLTYIPAETKDGMAIRSDLKIRIGDDVNINAYGLNSRLEGLLVVKQAKGALGLY
FT                   GGIDLKNGRYASFGQDLLIRKGLITFSGLPSQPMLNIEAIRNPEAMEDSKITAGIKVIG
FT                   LADAPEVTVFSEPSMPQDQALSYILTGRSLENSGEAGSGGSIGAALLGMGLSKSGKVVG
FT                   NIGETFGISDLNLGTAGVGDSSKVVVSGNLTKDLQVKYGVGLFDGLAEVTLRYRLLPRL
FT                   YLQSVSGVNQAFDLLYQFEF"
FT   gene            419104..420648
FT                   /locus_tag="Asuc_0365"
FT   CDS_pept        419104..420648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0365"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: msu:MS0287
FT                   exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73743"
FT                   /db_xref="GOA:A6VL96"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL96"
FT                   /protein_id="ABR73743.1"
FT                   /translation="MNYENLMKKATALSLENNRHIREIAAIDLGSNSFHMIVARIVNGS
FT                   IQILSRLKQKVQLAKGLDKNGLLDQEAITRGVNCLALFGERLQGFKPENVNVVGTYTLR
FT                   SAVNNDEFLRQAKAVFPYPINIISGETEALMIYAGVSHTQPESGRKLVIDIGGGSTEMI
FT                   IGDNFKPVIAQSRDMGCVSFAKHLFPNGEITPEAFERARQTALSRIADLAESFQTLGWQ
FT                   HVLGSSGTIKTVHQVIAANLDPDGVITAGRMDFLIERVLKFNSFDQLKIAGLNEERADV
FT                   FVPGLAILSAIFDTFDISQMRYSDGALREGVMYSLDQNFQVINIRHRTAEGLAEQFNID
FT                   RLQAERVSKSVVQLAQQFHEWQASEFADEMQEIILWAALLHEVGIVINHKNMHRHSAYI
FT                   LANMELPGFDREQQRLLATLVRHQQNGFHSDEIGQFARYTPLDVLSAVRLLRLAILLNK
FT                   SRQATETAEKISLKTDRTLWQLEFEPGYLARNPLLRQDLKQEQKNLIEIGLELNVR"
FT   gene            420952..421959
FT                   /locus_tag="Asuc_0366"
FT   CDS_pept        420952..421959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0366"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: gka:GK1974 C4-dicarboxylate transport system
FT                   (C4-dicarboxylate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73744"
FT                   /db_xref="GOA:A6VL97"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL97"
FT                   /protein_id="ABR73744.1"
FT                   /translation="MKKRTFLKTLLASVMLFSLSACDDNGGSSSAKIVKVSSVVAPTHP
FT                   STIALKEVFKPMIESKTNGKYQIDIYDSGQLGDEKQSFDYTRQGIVDMSVLGTVMWSEV
FT                   PKMSVPDFPFLFRDVAHARNIYQGEVGQEIAASFEESQPIKFLAWMPNGARVFSSSKPL
FT                   SNPEQFRGQKMRMPNNPIHVKVAELLGANVAIMGLGEVFTALEQGVVDGQDNPLSTFVQ
FT                   QGFYSVNKNIYETNHMISSLELLANANFWKDLSDEEKAIFNEAAKATSDKSWDLYQNSI
FT                   EADKKLVQEKGGTITVPTEADKKALVEKMQPLYDELYKKYDWAEALVNKVRDTQ"
FT   sig_peptide     420952..421017
FT                   /locus_tag="Asuc_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.947 at
FT                   residue 22"
FT   gene            421982..422491
FT                   /locus_tag="Asuc_0367"
FT   CDS_pept        421982..422491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0367"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: gka:GK1973 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73745"
FT                   /db_xref="GOA:A6VL98"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL98"
FT                   /protein_id="ABR73745.1"
FT                   /translation="MKTFTDKLFNGIQILLGVMLAVMIALVFFNVILRFFFNSGLVWSE
FT                   EVSRYVFVYVIYLGAIVAMKENAHLGVDTFIKNAPEKLKWLLFVVGRVIIIVVMAILFK
FT                   GSLAMVVQSHTAKAAATGLPLSVVYGIGLLTGAAIILIALLNIIDVIRNPKSVHQAALM
FT                   SEADSD"
FT   sig_peptide     421982..422116
FT                   /locus_tag="Asuc_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.670 at
FT                   residue 45"
FT   gene            422501..423781
FT                   /locus_tag="Asuc_0368"
FT   CDS_pept        422501..423781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0368"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: C4-dicarboxylate anaerobic carrier; Citrate
FT                   transporter; TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: gka:GK1972 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73746"
FT                   /db_xref="GOA:A6VL99"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VL99"
FT                   /protein_id="ABR73746.1"
FT                   /translation="MTILIFLASLVGGIVIGVPIAFSLLFSGMMLMFYLGGFNSQILSQ
FT                   NLFNGADSFSMMAIPFFVVAGDLMNRGGLTNKIVDAATALVGHIRGGLGYVAIIAILLF
FT                   ASLVGSAVASTAALGAILIPMMATIGYNRDRATALIAAGNILSPIMPPSVPMIIFGVTA
FT                   GVSVTDLFMGGIAPAVYITLTLCVIWAIVSRRDSAVPLPKRSFREVVRATREALWAILM
FT                   PVGLLLGLRSGMFTPTEAGVVAVVYALIIGLFVYRELTFQAIKECFISSAKASAAIMFL
FT                   AAAAMVSSWLMTIGNIPRIVTDLLHPFIGSPILLMLVIAGLVLLVGTSMDVVPTILILT
FT                   PVLMPAVKQAGINPVYFGVVFIITCVFGLLTPPVGTVLNVAASTGKINMERIVRKVWPF
FT                   LLAIVVVLLVLIVFPSTFMIPLEFFTK"
FT   sig_peptide     422501..422572
FT                   /locus_tag="Asuc_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.329 at
FT                   residue 24"
FT   gene            423793..424812
FT                   /locus_tag="Asuc_0369"
FT   CDS_pept        423793..424812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0369"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bsu:BG13207 similar to alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73747"
FT                   /db_xref="GOA:A6VLA0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA0"
FT                   /protein_id="ABR73747.1"
FT                   /translation="MKAITVSQPFELTVADVPAPTVTKDDDVIIKVAFGGICGSDIGIY
FT                   TGGNSLAKYPAIIGHEFVGTVVETGKAVTHVKVGDYVVSDIVNSCGHCYACRTGHHNVC
FT                   KNLQVTGVHSQGGFAEYAKTRADNVYLVDTNKIPHKTACLIEPYAVGVEINTRASIAAG
FT                   DKVVVFGSGPAGLAVMQVARARGAEVLITDIFEERLQLAREMGATKAINVKDIDMRQAV
FT                   NEFTDDEGAHVVVDAVCSPQSILDALDIVAPSGRLVVLGTGAAPSEIPQVAFTKKGINV
FT                   FGTRLNNKRFPEVIRLFEEHKVTPEKMITHTYKFEDIEKAFDVIKNEKNTVCKVLLEW"
FT   gene            424843..425916
FT                   /locus_tag="Asuc_0370"
FT   CDS_pept        424843..425916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0370"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="TIGRFAM: mannonate dehydratase; PFAM: Mannonate
FT                   dehydratase; Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bcl:ABC0631 mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73748"
FT                   /db_xref="GOA:A6VLA1"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA1"
FT                   /protein_id="ABR73748.1"
FT                   /translation="MKTTFRWYGLGNDTIPLAHIKQIPSMTGVVWALHDIPAGEIWPEE
FT                   RIAEVKSQVEPYGLSIDVVESVNVHESIKLGASDRDVYIENYKTTLRSLGKYGVKVVCY
FT                   NFMPVFDWIRTDLFKEADDGSTALFYEHARIDGIDPKVLVKQFEENSKDLTLPGWEPER
FT                   LKHLDKLFDLYKGMTEDKLRENLKYFLEQIIPVAEEAGIRMAIHPDDPPFSVFGLPRIV
FT                   KCHEDFQKIVDMVDSPANGITLCSGALGPNLKNNLPEMIRTFHKRIPFAHIRNIKVFEN
FT                   GDFYETSHLTRDGSLDIAEIVKAYHEVGFDGYWRPDHGRHIWDEKCRPGYGLYDRALGI
FT                   MYVEGLWDAYEKEKGRK"
FT   gene            425916..427517
FT                   /locus_tag="Asuc_0371"
FT   CDS_pept        425916..427517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0371"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: tte:TTE1940
FT                   mannitol-1-phosphate/altronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73749"
FT                   /db_xref="GOA:A6VLA2"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA2"
FT                   /protein_id="ABR73749.1"
FT                   /translation="MKLSYDALNSKEWQEKGYQLPRFGISDVVSNTKQQPVWLHLGAGN
FT                   IFRAFLANLQQRLLNQGDAQQGIIVAEGFDYEIIEKAYQPFDNLCVFAKLKNDHSVDKI
FT                   VVASIVESLRMDPAFTQDFSRLKAIFQSPSLQMVSLTITEKGYLIKGLDGEYYPAVKAD
FT                   FEEGPAKPQSYIGKIIALLHERFAVGALPLAVVSMDNMSKNGEKLQKVILEFAEQWKKC
FT                   GHLSQDFLDYLNSDKISFPWSMIDKITPRPDTEVQQQLQNDGIENLAPVVTSKNTYVAP
FT                   FVNAEELEYLAVEDDFPNGRPALEKVGVIFADRDTVNKIETMKVTTCLNPLHTGLAIFG
FT                   CLLGFTKISTEVQDADLSALIRKLGYQEGLPVVIDPQLINPKQFLDEVINIRFSNDFIP
FT                   DTPQRIATDTSQKLAIRFGETIKSYVKAGKSTDSLVAIPLIFAGWLRYLLGIDDEGQPF
FT                   ENSPDPRLTELKAKLANITLGSVVSSATLKPILSDKSIFGVDLYEVGLAGRVEQYFNEL
FT                   LVGVGAVRTSLHKYVN"
FT   gene            427527..428207
FT                   /locus_tag="Asuc_0372"
FT   CDS_pept        427527..428207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0372"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bha:BH1062 transcriptional regulator (GntR
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73750"
FT                   /db_xref="GOA:A6VLA3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA3"
FT                   /protein_id="ABR73750.1"
FT                   /translation="MIEPKLRESSRDYAYRVIREMIVNMELVPGSKVSEIELANLLGIS
FT                   RTPVREALIDLARNGAVTIQPQKGTFISLIDSDLVEEARFLRKTLEKEVIALLCEDSYQ
FT                   KDLHILDESLSLQEFYLKQGNYEKFLELDNEFHQLFFKITHKDRIYALMKGLNIHFDRA
FT                   RTSIFKKKPSIKTLEEHKILLKAIHNQDKDTATQCIERHLYQYELDKDSFEKEYSHYFN
FT                   KSGN"
FT   gene            428208..429146
FT                   /locus_tag="Asuc_0373"
FT   CDS_pept        428208..429146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0373"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: msu:MS0545 sugar
FT                   kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73751"
FT                   /db_xref="GOA:A6VLA4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA4"
FT                   /protein_id="ABR73751.1"
FT                   /translation="MKKLALIGECMIELNGEPFGTMRQTYGGDTLNTATYVARVSSPER
FT                   IQVCYVSALGTDKLSQGMIDRWQGDGIQTDWVLRDENRSAGLYLIQLDKQGERTFLYWR
FT                   NQSAARYLLQHPDYPQVLSALKSADMIYLSGISLAILPENDRTLLIAQLRELKKAGVEI
FT                   AFDSNFRPKLWDSLAQAQACYRALLPLVDVALVTFDDEEMLWSDTDEQATITRLSAFDI
FT                   PKIIVKQGSLGATICENGTQTFVPTIPVENVTDTTSAGDSFNAGFLAGYLQGKPLTVCC
FT                   EQGNRLAGIVIQHKGAIIDPAATEALRAAFN"
FT   gene            429176..429814
FT                   /locus_tag="Asuc_0374"
FT   CDS_pept        429176..429814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0374"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.3.16"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: msu:MS0546
FT                   2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73752"
FT                   /db_xref="GOA:A6VKN5"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A6VKN5"
FT                   /protein_id="ABR73752.1"
FT                   /translation="MAYSTEQIIEKLSRLKVVPVIAVDEAKDIIPLVQTLSDNGLPVAE
FT                   ITFRSAAGEEAIRLTRQHFPDVLIAAGTVLTPAQAVAAKNAGADCIVTPGFNPNIVRLC
FT                   QALDLPVTPGVNNPMAIEAALELGVKAVKFFPAEASGGVNMIKALLGPYANLQIMPTGG
FT                   ISPSNIKDYLAVPNVVACGGSWFVDKALIKSQNWDEIGRLVREAVELVS"
FT   gene            complement(430008..431357)
FT                   /locus_tag="Asuc_0375"
FT   CDS_pept        complement(430008..431357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0375"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   msu:MS0196 glutamate dehydrogenase/leucine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73753"
FT                   /db_xref="GOA:A6VLA6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA6"
FT                   /protein_id="ABR73753.1"
FT                   /translation="MSNSVASLEEFLALVAKRDGNQPEFLQAVREVFTSIWPFLEKNPQ
FT                   YRSQALLERLVEPERAIQFRVAWTDDKGQTQVNRAFRVQFNSAIGPFKGGMRFHPSVNL
FT                   SILKFLGFEQIFKNALTTLPMGGGKGGSDFDPKGKSDGEVMRFCQALISELYRHVGPDT
FT                   DVPAGDIGVGGREVGYLAGYMKKLSNQAACVFTGRGLSFGGSLIRPEATGYGLVYFAQA
FT                   MLAEKGQSFDGKTVLVSGSGNVAQYAIEKALQLGAKVVTCSDSSGYVYDEAGFTAEKLA
FT                   ALLEIKNVQRGRVKDYAEKFGLKYVAGEKPWTVKADIALPCATQNELDLDAAKTLIANG
FT                   VQLVAEGANMPTTIEATEALQQAGVLFGPGKAANAGGVATSGLEMAQGSQREYWTAEVV
FT                   DQKLHNIMLDIHANCKKYGTDEQGNINYVAGANIAGFVKVADAMLAQGVY"
FT   gene            431928..435116
FT                   /locus_tag="Asuc_0376"
FT   CDS_pept        431928..435116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0376"
FT                   /product="CRISPR-associated protein, Csn1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csn1 family;
FT                   KEGG: pmu:PM1127 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73754"
FT                   /db_xref="GOA:A6VLA7"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA7"
FT                   /protein_id="ABR73754.1"
FT                   /translation="MNLNYILGLDLGIASVGWAVVEIDEQENPQRLIDVGVRTFDRAEV
FT                   LKTGESLALARRLARSSRRLVKRRAERIKKAKRLLKAENLLLSADEILPNEAWQLRVKG
FT                   LDQKLERQEWAAVLLHLLKHRGYLSQRKNESKSENKELGALLSGVAINHQILQSAEYRT
FT                   PAEIAVNKFQAEEGHIRNQRGAYTHTFSRLDLLAEMELLFQRQATLGNPHTSTKLLENL
FT                   TALLMWQKPALAGEAILKMLGKCTFEPTEYKAAKNSYSAERFVWLTKLNNLRILEQGAE
FT                   RALTDNERFALLDQPYEKAKLTYAQVRTLLGLSDEAIFKGLRYQGEDKKAVETKTTLME
FT                   VKAYHQIRKALEGLDLKAEWNELKNNPALLDEIGTAFSLYKTDDDIHRYLDGKLSESVL
FT                   NALLENLNFDKFIQLSLKALQQILPLMLQGQRYDEAVSAIYGDHYGKKSDEIDRLLPNI
FT                   PTDEIRNPVVLRTLTQARKVINAVVRLYGSPARIHIETGREVGKSYQDRKKLEKQQEEN
FT                   RKQRENAVKKFKEYFPNFVGEPKGKDILKMRLYELQQAKCLYSGKSLELYRLLEKGYVE
FT                   VDHALPFSRTWDDSFNNKVLVLANENQNKGNATPYEWLDGKNNSEGWQHFVARVQTSGF
FT                   SYAKKQRVLIQELDEKSFIERNLNDTRYVARFLCNHIADNMLLTGKGKRKVFASNGQIT
FT                   ALLRGCWGLQKVRENNDRHHALDAVVVACSTKSMQDKITKFVKYKEGRLFKDKKDGVYK
FT                   GERINRETGEIISLHFPTPWKFFKENVEIRIFSENPKLELENRLPDYPQYNHEFVQPLF
FT                   VSRMPTRKMTGQGHMETVKSAKRLDKGLSVLKVPLTQLKLSDLERMVNREREMALYEAL
FT                   KECLEQFGNDPAKAFAEPFYKKGGALVKAVRVEQTQKSGVLVRNGNGVADNATGSIVRV
FT                   DVFTKGGKYFLVPIYTWQVAKGILPNKAVIQGKDESEWEEMDENAVFQFSMHKNDLIKV
FT                   KTKKGEIFGYFNGLDRATGSIEIEEHDLEKSKGKNGSHRGLGVKTAFFLEKYQVDELGK
FT                   NIRPCRPTKRQHVR"
FT   gene            435171..436088
FT                   /locus_tag="Asuc_0377"
FT   CDS_pept        435171..436088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0377"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; KEGG:
FT                   pmu:PM1126 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73755"
FT                   /db_xref="GOA:A6VLA8"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA8"
FT                   /protein_id="ABR73755.1"
FT                   /translation="MTWRSILMSKGGKLSLQQNQMLIQQEGNEFTVPLEDIAIVVVESR
FT                   ETVITIPLLSAFGLHGVTFLTCDEQFLPCGQWLPFNQYHRQLKTLKLQLEASLPQKKQL
FT                   WQAIVQQKIRNQAGVLKICKFQAESDRLLKMAEKVKSGDKENLEAQSAVIYFQTLFGKG
FT                   FKRSEDESAVNSALNYGYTVMRSAVARALVLYGWLPQIGLFHRSELNAFNLADDFIEPF
FT                   RPLVDLLVVQLENEDKLSANLSPILKQRLIKVLNYQLLFKQEKVNALTAIERSVGSFQT
FT                   ALSQRNADLLKLPEIIPLAEHQYE"
FT   gene            436081..436407
FT                   /locus_tag="Asuc_0378"
FT   CDS_pept        436081..436407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0378"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; KEGG:
FT                   pmu:PM1125 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73756"
FT                   /db_xref="GOA:A6VLA9"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLA9"
FT                   /protein_id="ABR73756.1"
FT                   /translation="MSENVFMRMIVLFDLPVTTKAKMRAANQFRQFLLKDGYQMLQLSI
FT                   YSRIIRGRDSMEKHHKRLVEHLPEEGSIRCISITEKQFANMEILVGEKKLQEKKVNANQ
FT                   LLLF"
FT   repeat_region   complement(436472..436904)
FT                   /rpt_unit_range=436472..436508
FT                   /note="CRISPRs"
FT   gene            complement(436995..437462)
FT                   /locus_tag="Asuc_0379"
FT   CDS_pept        complement(436995..437462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0379"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; Redoxin domain protein; KEGG: msu:MS0264
FT                   peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73757"
FT                   /db_xref="GOA:A6VLB0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB0"
FT                   /protein_id="ABR73757.1"
FT                   /translation="MNTLKPGENAPHFTLPNQHNEPVSLTDFQGKKVLIYFYPKALTPG
FT                   CTIQACGLRDAKAELDKSGVIILGISPDSPKKLAQFEEKQALNFTLLSDEDHQVAEQFG
FT                   VWGEKKFMGKVYDGIHRISFLIDENGKIEQVFTKFKTGEHHQVVLNYLTEK"
FT   gene            437559..438134
FT                   /locus_tag="Asuc_0380"
FT   CDS_pept        437559..438134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0380"
FT                   /product="protein of unknown function DUF414"
FT                   /note="PFAM: protein of unknown function DUF414; KEGG:
FT                   msu:MS0230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73758"
FT                   /db_xref="GOA:A6VLB1"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLB1"
FT                   /protein_id="ABR73758.1"
FT                   /translation="MSRQKKSRRLTDVMPTRKADKKTEIGAVKARPGKKLTRYELDARA
FT                   REEKRKRKHKGLDSGSRHSASSDSGKNQQTEVKDPRIGSRKKVPLVVEFVNKPEKGQFI
FT                   QPIKTEKKPTALDPATELEQLENNECLNDLLDQLDAGKVLSKEDQVFVDECLARIAQLM
FT                   DELGISDDEEGEDDLLRTFEKIDINQFR"
FT   gene            438138..438569
FT                   /locus_tag="Asuc_0381"
FT   CDS_pept        438138..438569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73759"
FT                   /db_xref="GOA:A6VLB2"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB2"
FT                   /protein_id="ABR73759.1"
FT                   /translation="MMTTVLFVIGVAVMLAMAAYSVYLLAQLHKQQRLYQQARQARVAR
FT                   LKESIRIIARAMQSGECNHSEGVIRLKMLLDPLGQKTLTEYAAMWRLYETVRDMPTHDE
FT                   RRALKKNERMRLDLEREAKEIELEAAIKAEAKLLLSELP"
FT   sig_peptide     438138..438218
FT                   /locus_tag="Asuc_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.611 at
FT                   residue 27"
FT   gene            438623..439990
FT                   /locus_tag="Asuc_0382"
FT   CDS_pept        438623..439990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0382"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: msu:MS0228 coproporphyrinogen III oxidase and
FT                   related FeS oxidoreductases; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73760"
FT                   /db_xref="GOA:A6VLB3"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB3"
FT                   /protein_id="ABR73760.1"
FT                   /translation="MTDITFDLALIQKYNQSGPRYTSYPTALEFNENYSENDFETAAAR
FT                   YPDRPLSLYVHIPFCHKLCYFCGCNKVITRHQHKADIYLDFLEKEITNRAPLFKNRTAT
FT                   QIHWGGGTPTYLSEAQSARLMDMLKSNFNIAENAEISIEMDPREIELSMLEHLRNIGFN
FT                   RISMGVQDFNKEVQKAVNREQDEDFIRALLVRARELGFQSTNLDLIYGLPFQTVESFMF
FT                   TLQKVIELNPDRLSVFNYAHLPSRFAGQVKIKDKDLPSPETKLSILQNTIETLAAAGYK
FT                   FIGMDHFAKPDDELAIAQQNGVLHRNFQGYTTQEECDLLGLGVSAISLLGDSYAQNQKE
FT                   LKQYYADVDEKGIALHKGLTLTEEDCLRRDVIKALICNFKLDYAAIEQQYHIDFNTHFA
FT                   EDLALLKPLAEDGLADIRPNGITVSSKGRLLIRNICLCFDTYSRQQARRQQFSRII"
FT   gene            complement(440060..440770)
FT                   /locus_tag="Asuc_0383"
FT   CDS_pept        complement(440060..440770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmu:PM0673 hypothetical HI1326"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73761"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB4"
FT                   /protein_id="ABR73761.1"
FT                   /translation="MTLADYVETLQAEHRMERVYSFQFEGKSYWLKQPEHPKGIQRLLK
FT                   PFSRAAFKREIQRIKLLIFQKAPIPPVKIINSRCLVMEDAGRTVRSWLESDITDEQKQR
FT                   ILDDCAKTLANLHARNIVHGRPLLKDILWQNGKASFIDFEVASRSRKLAQQKTRDALLF
FT                   IYGVCRERTTPAQIQRTINTFIHYEDSRVWHYALSLVKKHRILYYVLLPFKSLAKTDLL
FT                   GFYVLFETLLTKFL"
FT   gene            complement(440861..441658)
FT                   /locus_tag="Asuc_0384"
FT   CDS_pept        complement(440861..441658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0384"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; serine
FT                   acetyltransferase domain protein; KEGG: msu:MS2212 serine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73762"
FT                   /db_xref="GOA:A6VLB5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB5"
FT                   /protein_id="ABR73762.1"
FT                   /translation="MAIKVWKQIRKEAQCLVNKEPMLASFFHSTILKHKHLGGALSYIL
FT                   ANKLATTTMPAITLREIIEDAYAAKPSIIESAACDITAVRQRDPAVDLWSTPLLYLKGF
FT                   HALQSYRITHYLWQENRRSLAIYLQNQISVAFDVDIHPAARIGCGIMFDHATGIVVGET
FT                   AVIENDVSILQGVTLGGTGKECGDRHPKIREGVMIGAGAKILGNIEVGKYAKIGANSVV
FT                   LQPVPEHATAAGVPARIIGKDHDSKPAFEMNQYFIDDAAMLNI"
FT   gene            complement(441668..442675)
FT                   /locus_tag="Asuc_0385"
FT   CDS_pept        complement(441668..442675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0385"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE domain protein; KEGG: pmu:PM1431
FT                   glycerol-3-phosphate dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73763"
FT                   /db_xref="GOA:A6VLB6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB6"
FT                   /protein_id="ABR73763.1"
FT                   /translation="MVNQSPITILGAGSYGTALAICFSRNGYPTTLWGHNREECQHLQQ
FT                   ERQNRRFLPDIAFPDSLTIEADLASAVKKSKDLLIVVPSHAFGEVIHRIKPFLRPDSRI
FT                   AWATKGLERNSGRLLQSVVEDELGKAYPLAVLSGPTFAKELAAGMPTAIALAANDERFA
FT                   REFQTRIHCSKHFRVYLNRDMIGVQLGGAIKNVIAIAAGMSDGLGFGANARTALITRGL
FT                   AEISRLGVSLGANLKTFTGMSGLGDLVLTCTDNQSRNRRFGMMLGQGVSAQAAMEQIGQ
FT                   IVEGFYNTKETMALAQRQGVEMPITEQIYAALFHGKNPQEMATALLQRERKDEY"
FT   gene            complement(442735..443235)
FT                   /locus_tag="Asuc_0386"
FT   CDS_pept        complement(442735..443235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0386"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: msu:MS2214 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73764"
FT                   /db_xref="GOA:A6VLB7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLB7"
FT                   /protein_id="ABR73764.1"
FT                   /translation="MTDENQAAPAEQAQEPVLQIQRIYVKDVSFEAPNLPDIFQQEWKP
FT                   NLNFDLGTEAKQLGENLFEVTLNVSVETTLEDSGDAAFICEVKQAGVFTIGGLTDIQLT
FT                   HALTSQCPNMLFPYARELVASLVNRGTFPPLNLAPVNFDALFLEHMRRVEEESAPEEQP
FT                   TLN"
FT   gene            complement(443246..443683)
FT                   /locus_tag="Asuc_0387"
FT   CDS_pept        complement(443246..443683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0387"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: msu:MS2215
FT                   PspE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73765"
FT                   /db_xref="GOA:A6VLB8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB8"
FT                   /protein_id="ABR73765.1"
FT                   /translation="MEEFLTLATPFIKNHTLMVVGWVAIFIAFIYVNFKAITSKVKLVS
FT                   NAEAVALINNQNAVVIDLRTIEEFKRGHIVNSKEFVPSDIKNHNLGKLEQHKDVPVILV
FT                   CASGITARSSGEILAKQGFNHVYVLQEGIAGWNAENLPLVK"
FT   gene            complement(443804..444730)
FT                   /locus_tag="Asuc_0388"
FT   CDS_pept        complement(443804..444730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0388"
FT                   /product="putative protein insertion ABC transporter, inner
FT                   membrane subunit FtsX"
FT                   /note="TIGRFAM: putative protein insertion ABC transporter,
FT                   inner membrane subunit FtsX; PFAM: protein of unknown
FT                   function DUF214; KEGG: msu:MS0007 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73766"
FT                   /db_xref="GOA:A6VLB9"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLB9"
FT                   /protein_id="ABR73766.1"
FT                   /translation="MSSTQKAPFWVQMKYVLAYVRADLIKKKYGTLLTVLVIAVSLTIP
FT                   TVSFLLWKNTHNAITRFSPDSELTVYLHKNLNEDDANGVVEKVRSQEGVESLNYVSRQE
FT                   SLKDFRAWSGFGEELDILDDNPLPAVVMIKPTEEFKASEKRQELRENLAKIKGVEEVRM
FT                   DNDWLEKLTAITWLIAHVAIFCAVLMTLAVFLVIGNSIRSDVYSSQADIQVMKLLGATD
FT                   QFILRPFLYTGIIYGFFGAFFACFFSALLIGYFTSAVKYVTDIFAVSFNLGGLDFGEML
FT                   FLLVICSIVGYASAWISATRHIRLLDK"
FT   gene            complement(444748..445398)
FT                   /locus_tag="Asuc_0389"
FT   CDS_pept        complement(444748..445398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0389"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="TIGRFAM: cell division ATP-binding protein FtsE;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   msu:MS0008 predicted ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73767"
FT                   /db_xref="GOA:A6VLC0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC0"
FT                   /protein_id="ABR73767.1"
FT                   /translation="MIHFQNVSKAYLGGKPALQGLTFHLPVGSMTYLTGHSGAGKSTLL
FT                   KLIMGMERANGGQIWFNGHDITRLSHYELPFLRRQIGMVHQDYRLLPDRSVADNVALPL
FT                   IISGMHPKTARERALSSLDRVGLYERANHLPVHLSGGEQQRVDIARAVVHKPQLLLADE
FT                   PTGNLDNALSLDLFNLFEDLNRMGMTVLIATHDVGLINQKPNPCLVLEQGRLR"
FT   gene            complement(445627..446349)
FT                   /locus_tag="Asuc_0390"
FT   CDS_pept        complement(445627..446349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0390"
FT                   /product="glutaredoxin-family domain protein"
FT                   /EC_number="1.11.1.15"
FT                   /note="TIGRFAM: glutaredoxin-family domain protein; PFAM:
FT                   alkyl hydroperoxide reductase/ Thiol specific antioxidant/
FT                   Mal allergen; glutaredoxin; Redoxin domain protein; KEGG:
FT                   pmu:PM1347 membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73768"
FT                   /db_xref="GOA:A6VLC1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC1"
FT                   /protein_id="ABR73768.1"
FT                   /translation="MSMEGKKIPQVTFHTRQGDAWVDVTTSELFDNKTVVLFSLPGAFT
FT                   PTCSSTHLPRYNELACEFKALGVDDIICMSVNDTFVMNAWKADQEAENITVIPDGNGEF
FT                   TEGMGMLVDKEELGFGKRSWRYSMLVRNGVVEKMFVEPNEPGDPFKVSDADTMIKYLKP
FT                   DWTAKPSVSIFTKPGCPFCAKAKGLLKVKGYTFEEIVLGRDASTISVRAITGKTSVPQV
FT                   FIGGEYIGGSEDLEKYFA"
FT   gene            446482..447384
FT                   /locus_tag="Asuc_0391"
FT   CDS_pept        446482..447384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0391"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: msu:MS0154 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73769"
FT                   /db_xref="GOA:A6VLC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC2"
FT                   /protein_id="ABR73769.1"
FT                   /translation="MNIRDLEYLVSLAEFKHFRRAADACNVSQPTLSGQIRKLEDELGI
FT                   TLLERTSRKVLFTQSGLLLVAQAKQVLREVKLLKEMASNQGKDMTGPLHVGVIPTVGPY
FT                   LLPYIMPVLKESFPELELFLYEAQTNQLVDQLETGRLDCAIVAMVVETEPFIQVPLFNE
FT                   KMLIAVSEAHPWAKEKNIPLDYLKGTEVLMLDDGHCLREQALGYCFAAGASENSHFQAT
FT                   SLEMLRNMIAANAGVTLMPELAVLNEGQRRGVKYIPCINPEPQRTIALIYRPGSPLRAR
FT                   YERVANAVKKAVRPILEGD"
FT   gene            447386..447985
FT                   /locus_tag="Asuc_0392"
FT   CDS_pept        447386..447985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0392"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: msu:MS0153 AcrR
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73770"
FT                   /db_xref="GOA:A6VLC3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC3"
FT                   /protein_id="ABR73770.1"
FT                   /translation="MAGVRAIQKEKTRRALVDAAFNQLNAEKSFSNLSLREVAREANIA
FT                   ATSFYRHFKDMDELGLVMVDEAGLTLRQLMRQARKRIEKGGSVIAISVETFFEFINSSP
FT                   NVFRLLLRESSGTSQAFRTAAAREIKHFADELAEYIANKHGYSQYIAYVQAEGMVTLVF
FT                   TAGANALDMNPKEREQLKERLILQLRMLARGAMHSH"
FT   gene            complement(448052..448270)
FT                   /locus_tag="Asuc_0393"
FT   CDS_pept        complement(448052..448270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0393"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   msu:MS2253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73771"
FT                   /db_xref="GOA:A6VLC4"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLC4"
FT                   /protein_id="ABR73771.1"
FT                   /translation="MSSEILDQLESKIRQAVETIQLLQLEVEELKEKNDQAQQANDALR
FT                   NENEQLKVEHNNWQERLRSLLGQIDNV"
FT   gene            448440..449453
FT                   /locus_tag="Asuc_0394"
FT   CDS_pept        448440..449453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0394"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphatase, class II;
FT                   PFAM: GlpX family protein; KEGG: pmu:PM1482 GlpX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73772"
FT                   /db_xref="GOA:A6VLC5"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC5"
FT                   /protein_id="ABR73772.1"
FT                   /translation="MNRALAIEFSRITEAAALAAFAWLGRGDKNAADDAAVKAMRFMLN
FT                   QIHMDGEIVIGEGEIDQAPMLYIGEKLGSGMGEVVSIAVDPIDGTRMTAMGQANAIAVL
FT                   AAGGKNTFLRAPDMYMEKLVVGPELNGMIDLNLPIEQNCRRVAQRLGKSVTQLTVAVLA
FT                   KPRHEEVITRIQNLGARVMCIPDGDVAASLLCCLPDGGIDILYGIGGAPEGVISAAAVR
FT                   ALHGDMQARLLPRNQVKEDTPENRKVGEQEIRRCHENGVEVNTVLKLDDLAKDDNLVFS
FT                   ATGITNGDLLKGIQRKGNLATTETLLIRGKSRTIRRIQSMHYLDRKDAEIYKLIGE"
FT   gene            complement(449641..450138)
FT                   /locus_tag="Asuc_0395"
FT   CDS_pept        complement(449641..450138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0395"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: cte:CT2067
FT                   pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73773"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC6"
FT                   /protein_id="ABR73773.1"
FT                   /translation="MTMLIKAAQTAALTLMASTVAFAADNQQSVSVQGTIINKAVGPNA
FT                   VSEQNIPGRHTVAKNATIKTVNGKTTVIPNDKADSIPLEAREDFINAKLAGRNLSNKNF
FT                   AGMDFTNANLARTNLRRANLQNAVLINADLRNADLSGANLKGADLTNARFDGAKTDGTV
FT                   WK"
FT   sig_peptide     complement(450067..450138)
FT                   /locus_tag="Asuc_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(450149..451216)
FT                   /locus_tag="Asuc_0396"
FT   CDS_pept        complement(450149..451216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0396"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: zmo:ZMO0068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73774"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC7"
FT                   /protein_id="ABR73774.1"
FT                   /translation="MSTYFRRFPLNHIVFTLSSVLVAIHCEAAIVINKPPVSSSEYVPI
FT                   QAPAAVMPNEDDESDRITALGQAFEAYKRENYSYAYNIFSHYADMSEPHGMLATGYFLF
FT                   MGYGTAPDYGQAKRYLERANGLGFVRATTLLGLLEQRTNPQPSNQTALRLLMKAANMGD
FT                   SVAANALANLYYRRGNITDAVVWNEKAIALGSYAAKRNQKNLATAPNRPQQIVSVNNNE
FT                   HLQKLRQESQAGNGQASYELATRYHKGAGVPQNFGEAIRLYRIAAQQGNEQARKILPII
FT                   LSKQNASGNSLNSLWMQETSNMVTTPPIVLAPAGQDGKSGKSSSSAAGTNSLAEDDPLE
FT                   NLLLLEPNRSMIINK"
FT   sig_peptide     complement(451130..451216)
FT                   /locus_tag="Asuc_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.608 at
FT                   residue 29"
FT   gene            complement(451230..452816)
FT                   /locus_tag="Asuc_0397"
FT   CDS_pept        complement(451230..452816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0397"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   ajs:Ajs_1969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73775"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC8"
FT                   /protein_id="ABR73775.1"
FT                   /translation="MKIHHVFLSYVAASVLAGCSTGTQLHGDRPYIESTTTHTRPVSEP
FT                   VRAMTSFSDSLNCMDNLLLQSNAGQTVVAIKTINDPSGKALVAANDMIVTALSQMSRTS
FT                   GAFRVVDFEINPMKQDTVQTLSSLLLPTGSMQIPAPQIYISGAVSYVDQNVLKKSDSAG
FT                   ISVSDDVELGISGDLITTALGMELHIGDFLTRTLYPGIDSANEIVAANKGFGLDSGAKI
FT                   RKVGIQFSFERNLSQGVGSAVRTLTDLGMIELVGKYAQVPYWQCLSLDQSHPEFQRQLL
FT                   DWFEGMGETEKVKLFQTGLRNLGYYNGRVDGKPTTAFKEALTLFQKDNNATPSGVINFE
FT                   SYERIMKNYTRVDGSGNIRKAGLQPSGKKDEDGSNEPRNGYPYFYTDKGDPISLNMSSD
FT                   KSQYRVGDKLSLAINADKEGSHVSCFYQDASNSIAQIYPNPLEAEENLSAEKTLNLPST
FT                   NAYSLDLSSAGNESVMCIASYSSLASRLSQTLGEPFNPINVKDMAELSAKLKEVFGDEI
FT                   KGMQTVSYRVK"
FT   sig_peptide     complement(452733..452816)
FT                   /locus_tag="Asuc_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.539 at
FT                   residue 28"
FT   gene            complement(452877..453251)
FT                   /locus_tag="Asuc_0398"
FT   CDS_pept        complement(452877..453251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73776"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLC9"
FT                   /protein_id="ABR73776.1"
FT                   /translation="MKMNKSFYICVTACLFVFSTSVFSASPQSQELVPRQGMSPLDKAK
FT                   VHSVQAQNWAKMGKSGYDAEEVTERTTEGSSVSGIGSKSCVTNIGTTTATSGVSSGKYG
FT                   PSKNSDNIVIIKGDVVSLCK"
FT   sig_peptide     complement(453177..453251)
FT                   /locus_tag="Asuc_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            complement(453323..453736)
FT                   /locus_tag="Asuc_0399"
FT   CDS_pept        complement(453323..453736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73777"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLD0"
FT                   /protein_id="ABR73777.1"
FT                   /translation="MKNLMKTVLTAGLIATFSVATANAKVTIKGDNKQTAELKGGAINM
FT                   AMGSGKAVQNVASNQGKVTIKGNNDQSATVTGVAMNMGMGSGKATQNLASNHGKVQIDG
FT                   NNKQSVNITGAAINMSTDGDAIQNLSSNSSEDY"
FT   sig_peptide     complement(453662..453736)
FT                   /locus_tag="Asuc_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.881 at
FT                   residue 25"
FT   gene            complement(453807..454169)
FT                   /locus_tag="Asuc_0400"
FT   CDS_pept        complement(453807..454169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73778"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLD1"
FT                   /protein_id="ABR73778.1"
FT                   /translation="MIRQLIALITLSVAMTAVSANTQNVTISGSVINKSDSAGKASINV
FT                   GSNVGRVVGSNNSQTVVVNGSLINTASGGGKAAINLGSSVNYAGSNNQVVSVGTIVNSA
FT                   SGGGESEVNIGSVVKD"
FT   sig_peptide     complement(454107..454169)
FT                   /locus_tag="Asuc_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.710 at
FT                   residue 21"
FT   gene            454489..455415
FT                   /locus_tag="Asuc_0401"
FT   CDS_pept        454489..455415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0401"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: msu:MS0146
FT                   nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73779"
FT                   /db_xref="GOA:A6VLD2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLD2"
FT                   /protein_id="ABR73779.1"
FT                   /translation="MIIVTGGAGFIGSNIVKSLNDLGRKDILVVDNLKDGTKFINLVDL
FT                   DIADYCDKEDFIAQIIAGDDFGDIDAVFHEGACSATTEWDGKYIMHNNYEYSKELLHYC
FT                   LDREIPFFYASSAATYGDKTEFVEERQFEGPLNVYGYSKFLFDQYVREILPNASSPVCG
FT                   FKYFNVYGPREQHKGSMSSVAFHLNNQILKGENPKLFAGSEHFLRDFVYVGDVAAVNIW
FT                   AWQNKISGIFNCGTGHAESFKAVAEAVIKHHGKGAIETIPFPDHLKSRYQEYTQADLTK
FT                   LRAAGCNLKFKSVAEGVAEYMAWLNRK"
FT   gene            455450..455893
FT                   /locus_tag="Asuc_0402"
FT   CDS_pept        455450..455893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0402"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   msu:MS2250 flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73780"
FT                   /db_xref="GOA:A6VLD3"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLD3"
FT                   /protein_id="ABR73780.1"
FT                   /translation="MSEEISIITGSTLGAAEYVGDHLGDLLQQKGFDVTVQNAATLDDV
FT                   IEDKIWLVVTSTHGAGDLPDNLKPLMNRIAEEKTDLSALRFAVAGLGNSDYDTFCLAVD
FT                   KVENLLLGQGATRLCDSLRIDVLTQADHEQAAENWLPNFIDAL"
FT   gene            complement(455976..457133)
FT                   /locus_tag="Asuc_0403"
FT   CDS_pept        complement(455976..457133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0403"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   msu:MS1802 alcohol dehydrogenase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73781"
FT                   /db_xref="GOA:A6VLD4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLD4"
FT                   /protein_id="ABR73781.1"
FT                   /translation="MSTYYFLPTRNVFGENAVEEVGTLMKSLGGNNPLIVTDAFLAKNG
FT                   MADQLAAVLSNAGLKPVIFGGAEPNPTDKNVEEGIVFYNEHGCDSIISLGGGSSHDCAK
FT                   GIGLIASNGGRIQDYEGVDRSHNAMVPLMAVNTTAGTASEITRFCIITDTARKVKMAIV
FT                   DWRITPQIAVNDPLLMKGMPPSLTAATGMDALTHAIEAYVSTAANPLTDAAALMAITMI
FT                   QQYLPKAVANGDYMKARDKMAYAQYLAGIAFNNASLGYVHAMAHQLGGFYNLPHGVCNA
FT                   ILLPYVEEFNLIGNLNRFRDIAKAMGENIDGLCTDDAALKAIGAIRRLSKQVGIPANLQ
FT                   LLGVKPEDFDVMAENAMKDVCMLTNPRKATKQQVIEIFQRAYDGD"
FT   gene            457509..458027
FT                   /locus_tag="Asuc_0404"
FT   CDS_pept        457509..458027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0404"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: msu:MS2248
FT                   PspE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73782"
FT                   /db_xref="GOA:A6VLD5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLD5"
FT                   /protein_id="ABR73782.1"
FT                   /translation="MMDIKKITPYQLQEKLARGALLIDIRNADEHCREYIEQSRCHPLD
FT                   SLKQDIETDAPCVVFHCQSGMRTQANIERLTKITKHVGEVYILDGGLAAWKKAGLATVI
FT                   DKAQPLPLMRQVQIAAGSLVLLGVLLGYGVSPWGFLLSGLVGAGLVFAGISGFCGMAVL
FT                   LAKCPWNKR"
FT   gene            458160..459494
FT                   /locus_tag="Asuc_0405"
FT   CDS_pept        458160..459494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0405"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: msu:MS2247 MiaB protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; MiaB-like tRNA modifying
FT                   enzyme YliG; PFAM: Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73783"
FT                   /db_xref="GOA:A6VLD6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLD6"
FT                   /protein_id="ABR73783.1"
FT                   /translation="MTHSVPNIGFVSLGCPKNLVDSERILTELRSDGYNIIPTYENADL
FT                   VIVNTCGFIDSAVQESLEAIGEALEANGKVLVTGCLGAKEDRIREVHPKVLEITGPHSY
FT                   EAVMEHVHKYVPKPAYNPYINVVPSQGVKLTPKHYAYLKISEGCDHKCTFCIIPSLRGD
FT                   LDSRPITQILDEAKRLADSGVKELLVVSQDTSAYSLDQSKETQNKTVFWNGIPIKNNLI
FT                   TLCQMLGTLGVWVRLHYVYPYPHVDDLIPLMAAGKILPYLDIPLQHASPKILKAMKRPG
FT                   SVERVLERIKNWREICPELTLRSTFIVGFPGETEEDFQLLLDFLKEAQLDRVGCFKFSP
FT                   VDGATATDMPDQVPEEVKEERFQRFMQLQQEISAARLQQKIGKTWKVIVDEIDEEGIIG
FT                   RSMADAPEIDGVVYVDNVGQSAVRIGDIIDVRITRADEYDLWGTC"
FT   gene            459515..461521
FT                   /locus_tag="Asuc_0406"
FT   CDS_pept        459515..461521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73784"
FT                   /db_xref="InterPro:IPR040542"
FT                   /db_xref="InterPro:IPR041109"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLD7"
FT                   /protein_id="ABR73784.1"
FT                   /translation="MTEQKKNPSVELFEQAVVEKNYEAACTELLNILAKIDGQFGNITG
FT                   IDCRMPIQLANENLVQDKHVYFCTRMATAITALFSDKALSVSDSGAQRFFMFQRWLSLI
FT                   FASSPYINADHILQVYNQNSEPGSSDIRIDNNPASLVKFCIMYLPESNLNVNLDILWNL
FT                   NPTLCASLCFALQSPRFIGTQAAFSKRNTILQWFPARLATLPDLNNVPSAISHDVYMHC
FT                   SYDVAANKHQVKHALNQVIRRHIELLGWQDRDVSRIGNKNGKPVMVVVLEHFHSAHSIY
FT                   RTHSTSMRAAREHFYLLGIGGEAVDQLGRDVFDEFRQIQGNSLKDKMEFVRNICEEFAA
FT                   AILYMPSIGMDLLPIFLSNTRLAPIQAIALGHPATTHSPYIEYVVVEDDYVGSEDCFSE
FT                   TLLRLPKDALPYVPSALAPKAVNYKLRENPEVVNIGIASTTMKLNPYFLEALKAIRDRA
FT                   KVKVHFHFALGQSQGITHPYVTRFIKSYLGDDATAHPHTPYHQYLEILNHCDMMVNPFP
FT                   FGNTNGIIDMVTLGLVGVCKTGPEVHEHIDEGLFKRLGLPEWLIAKTVDEYVERAVRLA
FT                   ENHTERLALRLHIIENNGLQALFTGDPSPMGRTFSAKLTEWADKNGVILAGWPVKKEKK
FT                   ITDKKSVASKSTAKKTETKKTTATKKRTTNGKA"
FT   gene            complement(461688..462005)
FT                   /locus_tag="Asuc_0407"
FT   CDS_pept        complement(461688..462005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0407"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG: pmu:PM1290
FT                   met repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73785"
FT                   /db_xref="GOA:A6VLD8"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLD8"
FT                   /protein_id="ABR73785.1"
FT                   /translation="MANWDGKYISPYVEHGKKSEQVKKITVSIPIKVLEILTNERTRRQ
FT                   IKNLRHATNSELLCEAFLHAFTGQPLPTDSDLLKERHDEIPEYAKQIMRESGVDPEEWE
FT                   Y"
FT   gene            462203..462895
FT                   /locus_tag="Asuc_0408"
FT   CDS_pept        462203..462895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0408"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: msu:MS1965 glycerol uptake
FT                   facilitator and related permeases (Major Intrinsic Protein
FT                   Family)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73786"
FT                   /db_xref="GOA:A6VLD9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLD9"
FT                   /protein_id="ABR73786.1"
FT                   /translation="MKKIFAEFFGTFWLVFGGCGSAVLAAAYPELGIGFAGVALAFGLT
FT                   VLTMAYAVGHISGGHFNPAVTLGLVAGGRFQGKDAVGYIIAQVLGGIVGAAVLYAIASG
FT                   KADFDAVAGGFASNGFGEHSPNGYSFGAVVIAEIVLTAFFLIIIHGATDKRAPAGFAPI
FT                   AIGLALTLIHLISIPVSNTSVNPARSTAVAVFQGGWALDQLWVFWVAPIVGGIIGGLIY
FT                   RALLESRD"
FT   sig_peptide     462203..462280
FT                   /locus_tag="Asuc_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.874 at
FT                   residue 26"
FT   gene            463110..464054
FT                   /locus_tag="Asuc_0409"
FT   CDS_pept        463110..464054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0409"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit; KEGG:
FT                   msu:MS1953 glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73787"
FT                   /db_xref="GOA:A6VLE0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLE0"
FT                   /protein_id="ABR73787.1"
FT                   /translation="MDAKFNVKTFQGMILALQDYWAQQGCTIVQPFDMEVGAGTSHPMT
FT                   ALRAIGPEPMAFAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLK
FT                   MLGFDPTQHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGE
FT                   VTYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFE
FT                   CFNKYEQEAKFLLKQEPRMENDKEIWVETALPLPAYERILKAAHSFNLLDARKAISVTE
FT                   RQRYILRIRALTKGVAEAYYASREALGFPGCKK"
FT   gene            464289..466358
FT                   /locus_tag="Asuc_0410"
FT   CDS_pept        464289..466358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0410"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, beta subunit; KEGG:
FT                   msu:MS1956 glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73788"
FT                   /db_xref="GOA:A6VLE1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLE1"
FT                   /protein_id="ABR73788.1"
FT                   /translation="MTTENFFAEIGTEELPPKALKKLATAFAENVENELKQAGLAFDKV
FT                   EWFAAPRRLAVKVLNLAANQPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVDQ
FT                   AERLVTDKGEWLVHRAVIEGQPTKNLMLDIIAKSLANLPIPKTMRWGDKNVQFVRPVHT
FT                   VTLLLGGELIEGEILGIASGRTIRGHRFLGEREFQISHADQYPSLLEEKGCVIADFNKR
FT                   REMILTKSQEKATALGGVADIEDDLLDEVTSLVEFPNVLTAKFEERFLAVPAEALVYTM
FT                   KGDQKYFPIYDKEGKLLPHFIFVSNINPVDPMPIIEGNEKVVRPRLSDAEFFFNTDKKQ
FT                   RLEDLLPRLQTVLFQQQLGTLLDKTKRIQSLAGEIAGQIGADKAKAERAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDNLPNSLVASSVALADKF
FT                   DTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLSLDLADLVKKSAALFGDKLTN
FT                   ANVVDDVVDFMLGRFRAWYQDGGIAVDVIQAVLARRPTKPADFDARVRAVSHFRTLDSA
FT                   EALAAANKRVSNILAKVAGEIRSEIDRTLLLEAEEKALAEQVLALQSELAPVFAKGDYQ
FT                   TALDRLACLREVVDNFFDKVMVNAEDEKLRQNRQAMLNVLRNLFLQVADISLLQ"
FT   gene            complement(466425..466805)
FT                   /locus_tag="Asuc_0411"
FT   CDS_pept        complement(466425..466805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0411"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: msu:MS2226 integral membrane protein
FT                   possibly involved in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73789"
FT                   /db_xref="GOA:A6VLE2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLE2"
FT                   /protein_id="ABR73789.1"
FT                   /translation="MWQSLLLVGGGAALGASARWVLGVWLNPLFGHLAFGTLIANYTGC
FT                   FIIGVCTACFWQFPQLSAAVKLFMITGFLGGLTTFSSFSAEVVENVLQGKIGWAFAIMN
FT                   LHLLGCLVFTFLGIFLTALCWK"
FT   sig_peptide     complement(466749..466805)
FT                   /locus_tag="Asuc_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.849 at
FT                   residue 19"
FT   gene            complement(466807..467625)
FT                   /locus_tag="Asuc_0412"
FT   CDS_pept        complement(466807..467625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0412"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: msu:MS2225 predicted hydrolases of
FT                   the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73790"
FT                   /db_xref="GOA:A6VLE3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLE3"
FT                   /protein_id="ABR73790.1"
FT                   /translation="MKQFPFRTFVSDMDGTLLNDRHVVGDFTRTTLEKLSGRGVDIILA
FT                   TGRGYTDVSFILNSMDVENAAMVTANGAEVHDLKGNLIYSNYLPEELAFDIMQESFNTD
FT                   NICLNTYQGDEWFINVDLPALMKYHKESGFSYQVADFAAHHGRQTQKVFFIGRSLEDLL
FT                   PLEKRLRAKYGEHTSIMYSTPQCLEIMNKNVSKATALSALVEQRDYELTDCIAFGDGMN
FT                   DIEMLTEVGKGCVMGNADVRMAEQVPHLERIGFNKDEAVASYARAVFGIY"
FT   gene            467787..469445
FT                   /locus_tag="Asuc_0413"
FT   CDS_pept        467787..469445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0413"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: msu:MS2223 thiamine
FT                   pyrophosphate-requiring enzymes acetolactate synthase,
FT                   pyruvate dehydrogenase (cytochrome), glyoxylate
FT                   carboligase, phosphonopyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73791"
FT                   /db_xref="GOA:A6VLE4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLE4"
FT                   /protein_id="ABR73791.1"
FT                   /translation="MNGARLVTECLKAHGVTTVFGYPGGAIMPVYDALYDSGIEHFLCR
FT                   NEQGAAIEAIGYARARGNDAVGVCIATSGPGATNLITGLGDALMDSIPVVAITGQVGRG
FT                   LIGTDAFQEADVLGLSLGCTKHSFIVRNIDELPDVFAKAFQIASSGRPGPVLIDIPKDV
FT                   QFAETQLQPVVLEKLNPAAVNADELKSAVELLKVSKRPVVYVGGGVGMAHAVPALRRFL
FT                   EISRIPSVSTLKGLGAVLPTDPYYMGMIGMHGTKAANYATQEADLLIVLGARFDDRVTG
FT                   KLTSFASDAKVIHADIDAAEIGKLRRADVALKGDLEQVLEGLAMPLDIQPWREDVLRLK
FT                   QDFDFTYQENQGDGDINPNWLLHTLSRRKAENAVVVTDVGQHQMWAAQHMRHFAPENFI
FT                   TSAGFGTMGFGLPAAIGAQKARPEDDVILVTGDGSIMMNIQELGAVKSGHVPVKILLLD
FT                   NQRLGMVRQWQSLFFHGRHSATVLDDNPDFVTLASAFGIAGERIEKANEVSDALDRLLN
FT                   AEDAYFLHVCIHEDENVWPLVPPGACNTDMIEEMS"
FT   gene            469460..469693
FT                   /locus_tag="Asuc_0414"
FT   CDS_pept        469460..469693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0414"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="KEGG: msu:MS2222 acetolactate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73792"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLE5"
FT                   /protein_id="ABR73792.1"
FT                   /translation="MIQTEMTIVANHRPEVLERILRVVRHRGFTVTCLKMLLENEKVWL
FT                   DLTVASDRDACQLMKQIAKLFDVVDVTCESCE"
FT   gene            469833..471677
FT                   /locus_tag="Asuc_0415"
FT   CDS_pept        469833..471677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0415"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase; KEGG:
FT                   hin:HI0738 dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73793"
FT                   /db_xref="GOA:A6VLE6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLE6"
FT                   /protein_id="ABR73793.1"
FT                   /translation="MPVLRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDMGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTKLSDKLIKLD
FT                   LIDAMIQSADANVSDADVDVIEKSACPTCGACSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHADRKELFLEAGRKIVEICKRHYEQDDYSVLPRSIATFEAFENAMSLDIAMGGSSNT
FT                   VLHLLAVAQEAGVDFKMADIDRLSRVVPCLSKIAPNTNKYHMEDVHRAGGIMGIVGELD
FT                   RAGLIHRKVKTILGLTMEEQLNQYDIIRNKDEKLNKFFRAGPAGIRTTEAFSQDCRWDT
FT                   VDDDRANGCIRDRAHAVTEEGGLAVLFGNIAEDGCIVKTAGVDESIWKFTGKAIVFESQ
FT                   EDAVAGILGGKVKEGHVVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFS
FT                   GGTSGLSIGHASPEAASGGAIGLVNNDDIIEIDIPNRAINLVLPDEELAVRRAAMEAKG
FT                   ARAWQPENRRREVSTALKIFGHFATSADKGAVRDKTKL"
FT   gene            471749..472579
FT                   /locus_tag="Asuc_0416"
FT   CDS_pept        471749..472579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0416"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: ssa:SSA_1413
FT                   GufA-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73794"
FT                   /db_xref="GOA:A6VLE7"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLE7"
FT                   /protein_id="ABR73794.1"
FT                   /translation="MVDYFLSLNPVCQAFVAGLFTWGCTVFGSAFVYFFKHVDRKLLDI
FT                   LMGAAAGVMIAASFWSLLNPALDYAQADYGNWAWVPVAIGFIVGGYCLRLLDKFVPHLH
FT                   LNMPVEKAEGLLEYKKKLSKSTLLFLAITIHNFPEGLAVGVTFGALASQTADMSLSLMG
FT                   AVSLAVGIGLQNIPEGAALSLPIRAEGNSRRKAFWYGSMSAVVEPVGAVLGAAFVMSVT
FT                   SILPYALAFAAGAMIFVVVEELIPESQSNGYGDSATMGLMLGFVVMMVLDVALG"
FT   gene            472687..474225
FT                   /locus_tag="Asuc_0417"
FT   CDS_pept        472687..474225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0417"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: msu:MS2218 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73795"
FT                   /db_xref="GOA:A6VLE8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLE8"
FT                   /protein_id="ABR73795.1"
FT                   /translation="MTNNLSKQPIGSEYLRAVLSSKVYDLAQVTPLQAMPKLSEKLENR
FT                   IFVKREDRQPVHSFKLRGAYAMIAGLVPEQKAAGVITASAGNHAQGVALSAKNAGIRAL
FT                   IVMPQNTPSIKVDAVRAFGGEVLLHGANFDEAKAKALELSASEHMTFIPPFDHPAVIAG
FT                   QGSIGMEIIQQNSRVDRVFVPVGGGGLAAGIAVLIKQLMPEIKVIGVEAEDSACLKAAL
FT                   EAGKPVDLERVGLFADGVAVKRIGDETFRVCRQYLDDVITVDGDEICAAMKDMFENVRA
FT                   VSEPSGALSLAGLKKYVKTHRIKGETLVNVLSGANLNFHTLRYVSERCEIGEQNEALFA
FT                   VTIPEQRGSFLKFCQILGQNAVTEFNYRYTDELQARIFVGVRITGGEEKAMILTQLKQG
FT                   GYDVQDLSDDEIAKTHVRYMIGGRSSSLLKERLYSFEFPEQKGALLKFLETLGTTKANI
FT                   SLFHYRGHGADYGDVLAGFQIEDSDLRAFNEHLQALGYGYQDVTDSPAYRYFLL"
FT   gene            complement(474314..475135)
FT                   /locus_tag="Asuc_0418"
FT   CDS_pept        complement(474314..475135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0418"
FT                   /product="aminomethyltransferase"
FT                   /note="related to GcvT; KEGG: msu:MS0254 predicted
FT                   aminomethyltransferase related to GcvT"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73796"
FT                   /db_xref="GOA:A6VLE9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLE9"
FT                   /protein_id="ABR73796.1"
FT                   /translation="MTQFIELSQYTLIRVEGDDAESYLQGQLTADVTALAAGDSTFTAH
FT                   CDPKGKMSAVFRLIRLSEKRFYALIRTCLLPAALDQLKKYAVFSKVAFTQEEAEPVGII
FT                   GETELPVQAKFNNRAILINPQSAVAFNADSALWDLADIQQGYPILTEQSQFEFIPQALN
FT                   LQAIEQAVSFHKGCYIGQETVARAKYRGANKRAMYVFKAATDSIPECGGEIEMQLESGW
FT                   RKTGTILYALHADGELWLQVVLNRFEDNPAFRLAKNQLPLELQPLPYDLDA"
FT   gene            complement(475138..476001)
FT                   /locus_tag="Asuc_0419"
FT   CDS_pept        complement(475138..476001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0419"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: msu:MS0253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73797"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLF0"
FT                   /protein_id="ABR73797.1"
FT                   /translation="MIYSMTAFARHEMKKDWGNAVWEIRSVNQRYLENFFRLPEPFRGL
FT                   ENTLREKLRQNLTRGKIECSLRIETKQAAATQLNLNKEFAEQVIQSLKWIKTAAGEGEL
FT                   SLTDVLRYPGVVEAPEQDLDAISQDLLAAFDQLLQEFIAMRGREGEKLHAVIQQRLDAI
FT                   SVEADKVRSQMPAVLQWQRERLLQRFEEIQLQPDPTRLEQEMILLAQRVDVAEELDRLQ
FT                   MHVKETASILKKGGAVGRKLDFMMQELNRESNTLASKSINADITASAVELKVLIEQMRE
FT                   QIQNLE"
FT   gene            476167..476883
FT                   /locus_tag="Asuc_0420"
FT   CDS_pept        476167..476883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0420"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   KEGG: msu:MS0252 RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73798"
FT                   /db_xref="GOA:A6VLF1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLF1"
FT                   /protein_id="ABR73798.1"
FT                   /translation="MRPNNRAINQPRPIKITRHYTKHAEGSVLVEFGDTKVLCTATVDE
FT                   SVPRFLKGQGQGWVTAEYGMLPRSTHSRMQREAAKGKQGGRTMEIQRLIARSLRAMVDL
FT                   EALGERSVTLDCDVIQADGGTRTASITGACVALIDAVNGLVDNGTLTVSPLKGLVAAIS
FT                   VGIVDGTPVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLNLAK
FT                   QGCKRIFEAQRAALAD"
FT   gene            476912..477556
FT                   /locus_tag="Asuc_0421"
FT   CDS_pept        476912..477556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0421"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: msu:MS0251 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73799"
FT                   /db_xref="GOA:A6VLF2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLF2"
FT                   /protein_id="ABR73799.1"
FT                   /translation="MQDYKIEFIKFALSRNVLRFGEFKLKSGRVSPYFFNAGLFNTGAD
FT                   LARLGEFYAAAIQANRLAYDVIFGPAYKGIPIGTTVSVALFNRFGLDKPVCFNRKEAKD
FT                   HGEGGNLIGSPLQGNVLLVDDVITAGTAIREAMDIIAANGATLSAVVIALNRKERGKGE
FT                   LSAVQEVERDYQCRVLSIIELDDLLAFLETDSEYSRYLPSMKAYREQFGVA"
FT   gene            477728..481621
FT                   /locus_tag="Asuc_0422"
FT   CDS_pept        477728..481621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0422"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase;
FT                   PFAM: AIR synthase related protein; AIR synthase related
FT                   protein domain protein; KEGG: msu:MS1806
FT                   phosphoribosylformylglycinamidine (FGAM) synthase,
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73800"
FT                   /db_xref="GOA:A6VLF3"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLF3"
FT                   /protein_id="ABR73800.1"
FT                   /translation="MFQIFRGSPALSEFRLSQLATRFQKADLPVKSCYAEYLHFAHLAT
FT                   ALDADETQELEELLHYGPTLAQHEPTGECFVVIPRVGTISSWSSKATDIAHNCGLEKVI
FT                   RLERGLAFYFEFDRTLTEDEQAKLVSHIHDRMMENVVRCAEEAAKLFDQQEPKPFTTVD
FT                   VLGGGRKALETANVELGLALADDEMDYLVENFTALGRNPNDIELYMFAQANSEHCRHKI
FT                   FNADWVIDGEKQEKSLFKMIKNTFEKTPDYVLSAYKDNAAVMEGSKVGRFFPDADGQYR
FT                   YHNENAHILMKVETHNHPTAISPFPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNL
FT                   VIPGFEQPWEAPLSKPNRIASALDIMIEGPLGGAAFNNEFGRPALLGYFRTYEEKVNSF
FT                   GGEEIRGYHKPIMLAGGIGNIRAEHVQKGEIPVGAKLIVLGGPAMNIGLGGGAASSMTS
FT                   GKSKENLDFASVQRDNPEMERRCQEVIDRCWQMGENNPIAFIHDVGAGGLSNAMPELVH
FT                   DGGRGGKFELRKILSDERGMSPLEIWCNESQERYVLAVAPENLAVFEELCRRERAPYAV
FT                   IGEATAEEHLTLHDDHFDNNPIDLPMGVLLGKTPKMTRNVQSSAVKNPPVSQDGIDLKE
FT                   ALHRVLRLPVVAEKTFLITIGDRSVTGMVARDQMVGPWQIPVSDVAVTTAALDTYHGEA
FT                   MSMGERAPVALLDFGASARLAVAESVTNIAATNIGDIKRIKLSANWMAAAGHQGEDAGL
FT                   YEAVKAVGEELCPALGLTVPVGKDSMSMKTTWHENGEQKTVTAPLSLVISAFARVEDVR
FT                   KTVTPQLRTDKGYSRLLLIDLGEGKNRLGATVLAQVYKQLGDEPADVENAATLKGFFDA
FT                   MQTLVQQGKLLAYHDRSDGGLITTLAEMAFTGHCGVSVDISALGDNDLAVLFNEELGAV
FT                   IQVKESDVNAVREVLSRHGLIHLTKEIGTVNANDEFEIVRGTKVLLSEKRSELRGIWAE
FT                   LTHQMQRLRDNPACADQEFEAKKNAEDKGFSAHLTYDINEDIAAPYIAKGAKPRIAVLR
FT                   EQGVNSHVEMAAAFDRAGFEAVDVHMSDLHAARHDLKDFNALVACGGFSYGDVLGAGGG
FT                   WAKSVLFNTALRDQFETFFNREDTLAIGICNGCQMLSNLAEIIPGTENWPRFVRNTSER
FT                   FEARAALVRINESNSVWFQGMAGSHMPIAVSHGEGRVEFKHEGQLQGLRDQGLIVAQFV
FT                   DNNIQPTDIYPANPNGSVEGITALSNANGRVAIMMPHPERVFRTVSNSWHPEDWNEDGA
FT                   WMRLFRNARVALK"
FT   gene            481650..482423
FT                   /locus_tag="Asuc_0423"
FT   CDS_pept        481650..482423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73801"
FT                   /db_xref="GOA:A6VLF4"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLF4"
FT                   /protein_id="ABR73801.1"
FT                   /translation="MLVNILFYIINGDLMNRFKIWLRDKFYKLKDDLPSIIFYILGMIF
FT                   ILAFKRDDLVGNYLGFSCFAIGAIIWLIKLYIKYSENIIARILFWVTGFLSLPLSALLS
FT                   NIGIVTRLGLPASDFTNTQLVLATILYFPCWILVALLFILLYLMINFILKYIAFLLSVS
FT                   IFGSSLKQYSDNWIISSLHMMGIFTIYVTVALSLKLFDQTNNFVPVITEYIDYAYMKNY
FT                   PNVPHDRKILIHNGNFFSEIKDVDGVKTIVTTSIE"
FT   gene            complement(482490..482651)
FT                   /pseudo
FT                   /locus_tag="Asuc_0424"
FT   gene            483418..484308
FT                   /locus_tag="Asuc_0425"
FT   CDS_pept        483418..484308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0425"
FT                   /product="Cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; Cytidine and
FT                   deoxycytidylate deaminase zinc-binding domain protein;
FT                   KEGG: msu:MS1835 cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73802"
FT                   /db_xref="GOA:A6VLF5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR013171"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLF5"
FT                   /protein_id="ABR73802.1"
FT                   /translation="MNDCIGKRLDKLINESQDEVLKRVVGQILEQNGKARISQDWVRRC
FT                   GDDFNLTAVELALRCLPVAACYASAPVSHFNVGAVAVGQSGAFYFGANQEFSGDAVQQT
FT                   VHAEQSAVSHAWLAGEVALTDMVVNYTPCGHCRQFMNELNSADRLQIHLPHSRNNRLHS
FT                   YLPDAFGPKDLNISRVLFDPQPHSFGFTHADPLVQAAADAAEQAYAPYSRALSGVALQV
FT                   GTQSITGRYAENAAFNPSFLPLQCALNYRRLSGLSDVPVSRIVMAESQGGLSHRSITEQ
FT                   LAHSYLGLEIEYFAL"
FT   gene            484571..485335
FT                   /locus_tag="Asuc_0426"
FT   CDS_pept        484571..485335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73803"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLF6"
FT                   /protein_id="ABR73803.1"
FT                   /translation="MRKFNLLLTSLLLGAATTASAHSLWALGENKEVFEADILYGHDFP
FT                   HPEKIPAKRLSLFEPLKVVSQDGTITLTQSGENYHYKHSAKLGKGTHILVANYKPTYWT
FT                   EKTDGKWEMGKTRQDVAQAKECGLYTMQGKSFVVIDDDAAFSTQPLAQGYEITPLAPLN
FT                   ALKANEVAKFKVTRDGESVEGVKVVGAPAGFDTDDLEIHAFSATTDDKGEFSFKALTSG
FT                   PWYLASEVETQGKDPKVCDKEVHEFTLSFAVK"
FT   sig_peptide     484571..484636
FT                   /locus_tag="Asuc_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 22"
FT   gene            485469..486242
FT                   /locus_tag="Asuc_0427"
FT   CDS_pept        485469..486242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0427"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine or
FT                   other phosphorylase family 1; KEGG: msu:MS2318 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73804"
FT                   /db_xref="GOA:A6VLF7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="PDB:4R31"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLF7"
FT                   /protein_id="ABR73804.1"
FT                   /translation="MSEVFHLGLTKAMLKGAKIAVIPGDPARSERIAQRMDKPEFLASS
FT                   REFTSWLGYLENEPVVVCSTGIGGPSVSICVEELAQLGVGTFLRIGTTGAIQPYINVGD
FT                   VLVTTGAVRLDGASRHFAPLEYPAVADFSCTNALYSAAVAQGITPYVGITASSDTFYPG
FT                   QERYDTFSGKVYPAYQGSLKQWQDLNVMNYEMESATLFTMCAALGLKAGMVAGVIVNRT
FT                   QQEIPNEATIKSTEQKAVAVVIEAARRLISAGRIG"
FT   gene            486380..486769
FT                   /locus_tag="Asuc_0428"
FT   CDS_pept        486380..486769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0428"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: msu:MS2189 putative
FT                   translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73805"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLF8"
FT                   /protein_id="ABR73805.1"
FT                   /translation="MTKIIHTENAPAAIGPYVQAVDLGNLVMTSGQIPVNPATGEVPAD
FT                   ITAQARQSLENIKAIILQAGLQVADIVKTTVFVKDLNDFATVNAEYERFFKENNHPNFP
FT                   ARSCVEVARLPKDVGLEIEAIAVRK"
FT   gene            486862..487971
FT                   /locus_tag="Asuc_0429"
FT   CDS_pept        486862..487971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0429"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="TIGRFAM: tRNA (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase; KEGG: msu:MS2367
FT                   SAM-dependent methyltransferases related to tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73806"
FT                   /db_xref="GOA:A6VLF9"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLF9"
FT                   /protein_id="ABR73806.1"
FT                   /translation="MQQLPIEKYDELLAEKCRKLTALLAPFDAPALTVFPSPTQHFRMR
FT                   AEFRLWHDYSENRGGNLYHIMFDKTTKQRYRVDQFPVASQLINRMMATILPLLKEQDVL
FT                   SRKLFQIDYLSTLSEQIIVSLLYHKTLTDEWQEAAQALKVRLRNLGFSVQIIGRATKQK
FT                   ICLDQDFVDEELSVGDKKYVYRQVENSFTQPNAALNCKMLEWAIDCTRDSQGDLLELYC
FT                   GNGNFSIALAQNFRKVLATEIAKPSVAAAQFNIAANQVDNLQIIRMSAEEFTQAVNGVR
FT                   AFNRLKGIDLQAYECHTIFVDPPRAGLDSDTVKLVQKYDRILYISCNPQTLCENLQILS
FT                   QTHRIERAALFDQFPYTEHMEAGVWLMRK"
FT   gene            487968..488741
FT                   /locus_tag="Asuc_0430"
FT   CDS_pept        487968..488741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0430"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   msu:MS2368 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73807"
FT                   /db_xref="GOA:A6VLG0"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLG0"
FT                   /protein_id="ABR73807.1"
FT                   /translation="MMIQLRSEIKTDENLTALFRRQCEAAGLIHDETSPLALVQAAMGE
FT                   HDWRLELRKLDEPKLGAVFVDFAGGVMAHRRKFGGGRGEAVAKAIGVKGEELPTVIDAT
FT                   AGLGRDAFVLASVGCRVRLVERHPVVRLLLQDGLRRAYDDSEIGESMRRNMQLLTVNHI
FT                   AELDPARDFADAVYLDPMYPHKQKSALVKKEMRVFQHLVGTDSDADALLEPARKLARKR
FT                   VVVKRPDYAGFLAQTPPHFSRETKNHRFDIYLPLI"
FT   gene            488757..489488
FT                   /locus_tag="Asuc_0431"
FT   CDS_pept        488757..489488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0431"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: msu:MS2342 16S
FT                   rRNA uridine-516 pseudouridylate synthase and related
FT                   pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73808"
FT                   /db_xref="GOA:A6VLG1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG1"
FT                   /protein_id="ABR73808.1"
FT                   /translation="MRTELRKNPPEKSPSADRSGEKRARNAAYRAKSAVGLRNDFHRKK
FT                   TAPDLAQTQVVLFNKPFDVLTQFTDESGRKTLKDFIPVPGIYAAGRLDRDSEGLLILTN
FT                   NGELQHRLANPKFKLPKTYWVQVEGQPTEADLERLRRGVELKDGMTKPAKVRSIAEPDL
FT                   WQRVPPIRERKNIPTAWLEIQLGEGKNRQVRRMTAHIGFPTLRLVRAATAGLTLHGLPS
FT                   GQYRELTESEIKRLFRRLGLR"
FT   gene            490160..491170
FT                   /locus_tag="Asuc_0432"
FT   CDS_pept        490160..491170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0432"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: msu:MS2292 spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73809"
FT                   /db_xref="GOA:A6VLG2"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG2"
FT                   /protein_id="ABR73809.1"
FT                   /translation="MVSAVALFSASCWAEVIRIYNWTDYIPSDLISKFTRETGIDVNYS
FT                   TFESNEEMYAKLKLLKNTGYDLVFPSSYYIGKMAGEGMLEKIDHSKLSNFKQIPVNLLY
FT                   KDFDPNNDYSLPYVYGLTGIGVNKSVIDPAKVTSWADLWRPEYKGQVLLTADAREVFHI
FT                   ALLLNGHSPNTQNEEEIKAAYEWLTKLLPNVATFNSDTPELPYIQGEVNLGMIWNGSAY
FT                   TAKRENPDIEFVYPKEGAIFWMDNYAIPKGSKHVEAAHKFIDFMLRPEHAKVVIERVGY
FT                   SMPNEGVKALLKPEDAADPLLFPPENEVKKGIFQADVGDAVDTYEKYWNRLKTDN"
FT   gene            491238..492839
FT                   /locus_tag="Asuc_0433"
FT   CDS_pept        491238..492839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0433"
FT                   /product="Tannase and feruloyl esterase"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   msu:MS2241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73810"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG3"
FT                   /protein_id="ABR73810.1"
FT                   /translation="MKKLTALATLIALAGSVQNAMAQTERNQCLALKDVVIPNTQITSV
FT                   KWFAGGMLPPDEQSSFTGTAENQTKAAAHCVVNGEIEKYQGADGKPYAIGFQLRLPQHW
FT                   NKKFLFQGGGGLDGFVAPAVGAVPVRGSGAVPALMRGYAVVTMDGGHQGAGDTAFTADQ
FT                   QARLNYAYASTGKVTTTAKQLIERMYQAQPEHSYFMGCSNGGREAMNAAMRYPLEFDGV
FT                   VAGNPGFRLSRAAMGEAWDNQQFMKFAPSNEQGEKIVANALTQADLDAVVKGVLARCDG
FT                   KDGLTDGIINAWESCDFKPEMVENEIGAEKVALLNAIFNGAKNSRGENVYSSWPYDAGI
FT                   NTQGWRQWKHGDSQTAQPNSRNFTMGAASLKEYFMTPRNPDFDTMKFDFDKDPAKVMQI
FT                   SGINDADKTDLSTFQSRGGKMVIFEGVSDPVFSAHDLRDWYKQLQTDMQNADQFARVFM
FT                   IPGMNHCGGGPAFEDIDPLTALELWVENDQAPTYLLGKAGKALPDKNKTMPICAYPQIA
FT                   TYKGGDVGKADSFECR"
FT   sig_peptide     491238..491306
FT                   /locus_tag="Asuc_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            493120..493671
FT                   /locus_tag="Asuc_0434"
FT   CDS_pept        493120..493671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0434"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, glucitol/sorbitol-specific, IIC
FT                   subunit; PFAM: PTS system protein II sorbitol-specific
FT                   factor; KEGG: hso:HS_0679 PTS system,
FT                   glucitol/sorbitol-specific IIC2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73811"
FT                   /db_xref="GOA:A6VLG4"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG4"
FT                   /protein_id="ABR73811.1"
FT                   /translation="MEYITYGAEWFIGLFQKGGETLVGMISGILPLLISLLVVMNALIK
FT                   FVGQERIERLAQHSASNPISRYLILPVIGTFVFCNPMTLSLGRFLPERYKPSYYAAASY
FT                   SCHSMNGLFPHINPGELFVYLGIASGLTTLGLPLGPLAVSYLLVGMFTNFFRGWITDFT
FT                   TAYFEKRMNIQLDREVHLGK"
FT   gene            493727..494734
FT                   /locus_tag="Asuc_0435"
FT   CDS_pept        493727..494734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0435"
FT                   /product="PTS system, glucitol/sorbitol-specific, IIBC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, glucitol/sorbitol-specific,
FT                   IIBC subunit; PFAM: Sorbitol phosphotransferase protein II
FT                   domain protein; KEGG: hso:HS_0678 PTS system,
FT                   glucitol/sorbitol-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73812"
FT                   /db_xref="GOA:A6VLG5"
FT                   /db_xref="InterPro:IPR004702"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="InterPro:IPR011638"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG5"
FT                   /protein_id="ABR73812.1"
FT                   /translation="MATKSILIEKGNGGWGGPLTLPVTDGKKILYMTAGTRPAIVDKLT
FT                   ELTGWEAVDGFKNGEPPAEEIGIAIIDCGGVLRCGLYPKRRIPTINIHATGKSGPLAEF
FT                   IVEDIYVSAVKENNIKLIEGDGTETVPTATVETESADNGKSAVKDYDSSKKITEQSDGL
FT                   LARIGMGMGSVVAVFFQAGRDTIDTVLKTILPFMAFVSALIGIIIASGLGDWIANGLTP
FT                   LAGNPIGLVTLALICSFPLLSPFLGPGAVIAQVIGVLVGTQIGLGNIPPALALPALFAI
FT                   NAQAACDFIPVGLSMAEAKQDTVRVGVPAVLVSRFLTGAPTVLIAWAVSGFIYQ"
FT   gene            494817..495185
FT                   /locus_tag="Asuc_0436"
FT   CDS_pept        494817..495185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0436"
FT                   /product="PTS system glucitol/sorbitol-specific IIA
FT                   component"
FT                   /note="PFAM: PTS system glucitol/sorbitol-specific IIA
FT                   component; KEGG: hso:HS_0677 PTS system,
FT                   glucitol/sorbitol-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73813"
FT                   /db_xref="GOA:A6VLG6"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG6"
FT                   /protein_id="ABR73813.1"
FT                   /translation="MTVIYQTTFTKVGNFARDALEEGMLITFKQGAPADLEDYCFIHSH
FT                   GVLDTDIRQGDIAEFDGVDYPVTAVGEVASFNLKELGHVTWRFDGAEHAEYPGTIHVRG
FT                   TIPSAVKEGSVLRIKRGE"
FT   gene            495233..496021
FT                   /locus_tag="Asuc_0437"
FT   CDS_pept        495233..496021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0437"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hso:HS_0676 sorbitol-6-phosphate 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73814"
FT                   /db_xref="GOA:A6VLG7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG7"
FT                   /protein_id="ABR73814.1"
FT                   /translation="MNNVKKVAVVVGGGQTLGAFLSEGLADAGYRVVVADLNGDNAGAV
FT                   AAVINGKYGADNALGAQVDATNESSVEALAKATDDKFGRVDLLVYSAGTAKASPIWDFA
FT                   LKDFNVSVNVNLIGYFLSAKHFSRLMIRDGIKGRIIQINSKSGKVGSKFNSGYSAAKFG
FT                   GVGLTQSLALDLADKGITVHSLMLGNLLKSPMFQSLIPQYAKKLGIPESEVEQVYIDKV
FT                   PLKRGCDYQDVLNVLKFYASEEASYCTGQMINITGGQVMF"
FT   gene            496077..496742
FT                   /locus_tag="Asuc_0438"
FT   CDS_pept        496077..496742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0438"
FT                   /product="putative transaldolase"
FT                   /note="TIGRFAM: putative transaldolase; PFAM:
FT                   Transaldolase; KEGG: sbo:SBO_3966 putative transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73815"
FT                   /db_xref="GOA:A6VLG8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG8"
FT                   /protein_id="ABR73815.1"
FT                   /translation="MQLYLDTANLETIKKFHRTLPLQGVTTNPSILAKEKQPVAETLQA
FT                   IQQIIGENGQLFAQTLGRSAREMIDDALALREIVPTIAVKIPVTPEGLVAIKELTRLSV
FT                   PVLGTAVYGAAQGFLAALAGAVYIAPYVNRIDAQGGSGIDVVRELQALLDQHAPDSLIC
FT                   AASFRTPRQALDCLLAGCQSITLPPDIALAFLNDPAVFAAVEKFEADWQNAYQRSTLL"
FT   gene            496844..497206
FT                   /locus_tag="Asuc_0439"
FT   CDS_pept        496844..497206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0439"
FT                   /product="Glucitol operon activator"
FT                   /note="PFAM: Glucitol operon activator; KEGG: yen:YE1094
FT                   glucitol operon activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73816"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLG9"
FT                   /protein_id="ABR73816.1"
FT                   /translation="MQNATNALILLAVIAWLLQIVLGWLQVNRFNRAFGWLSEQGNVGI
FT                   GRTRGRFKAKVVIALAFDENRRVADSIMMKGWTVFSKPRSVPPLKGLHYDDIRPQVIFP
FT                   NDKNAQEALSEALRLK"
FT   gene            497219..497986
FT                   /locus_tag="Asuc_0440"
FT   CDS_pept        497219..497986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0440"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; regulatory protein DeoR; KEGG:
FT                   msu:MS2316 transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73817"
FT                   /db_xref="GOA:A6VLH0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH0"
FT                   /protein_id="ABR73817.1"
FT                   /translation="MKPRERQQAILDYLQIHGRTPVDQLADHFKTTGTTIRKDLTVLEA
FT                   DNKVLRTYGSVVLAAASDEIDLPLTNKTTINLEIKSKIGRAAADLIKNGDSIIMDQGST
FT                   VLQMVPNLSRFENLTIMTNSLHIINALTALELDFELLMCGGTYRPKSGSFHGILAESTV
FT                   EKFTFDKLFIGTDGFDLNVGLTTFNEVHGVSKAMCHAAREIIVLADSSKFNRRSPNIVC
FT                   PLEKINVVVTDDGLDKSIHAALIEKGIRVIIVD"
FT   gene            498008..499438
FT                   /locus_tag="Asuc_0441"
FT   CDS_pept        498008..499438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0441"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   msu:MS2338 selenocysteine synthase seryl-tRNASer selenium
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73818"
FT                   /db_xref="GOA:A6VLH1"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH1"
FT                   /protein_id="ABR73818.1"
FT                   /translation="MYNAISILSKKGQKMTALFQQLPSVNKLINAPQGQRLMIKFGHMA
FT                   VVRVCRALLRQSREFIRENRQLPDFLLQDNAVFAEIERRLQQQTQVRIKSVHNLTGTVL
FT                   HTNLGRALWAESAQQAALTAMHDNVALEYDLDAGKRGHRDNYISELIRQLTGAEAACVV
FT                   NNNAAAVLLILAAFARGKEVVISRGELIEIGGAFRIPDIMAQAGCKLVEVGTTNRTHLQ
FT                   DYRNAINENTAFLMKVHSSNYQICGFTGEVSEQELAALGKEFGIPVISDLGSGALTDLS
FT                   QYNLPKEPTVQEKLAQGVDLISFSGDKLLGGPQAGIIAGKKELILQLQSHPLKRVLRCD
FT                   KVILAGLEATLRLYLQPEKLAEKLTSLYLLTQPIEQLQQQAVQLKTKLENMLKNEFSLQ
FT                   IEASSAQIGSGSQPMARIPSVAVTVAEKNSQKLTALLTRFKQLSSPIIARVENNKIWLD
FT                   LRSLASFEKLLITLDELK"
FT   gene            499454..501328
FT                   /locus_tag="Asuc_0442"
FT   CDS_pept        499454..501328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0442"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain 2
FT                   protein; Elongation factor SelB winged helix 2; Elongation
FT                   factor SelB winged helix 3; KEGG: msu:MS2339
FT                   selenocysteine-specific translation elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73819"
FT                   /db_xref="GOA:A6VLH2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH2"
FT                   /protein_id="ABR73819.1"
FT                   /translation="MIIVTSGHVDHGKTALLQALTGVSTAHLPEEKKRGMTIDLGYAYL
FT                   SVKDSEKEDKILGFIDVPGHEKFLANMLAGLGGIYYAMLIVAADEGVRAQTEEHLAILR
FT                   LLQIDKIMVVITKADRADSAQIDDLRYKIKQNYPFLAECPFFVTSAATGQGIAELREFL
FT                   TALPNPAEQNKPFRYAIDRIFTVKGAGTVVTGTAFSGKVEIDDELYFSNGAKVRVKNIH
FT                   AQNRQNAEGLAGQRLALNINADFDRALIERGDWLFSQAPWAPTDRFTVVLNAETRLNET
FT                   QPVHVYHAASHVVGKLGLLTAKSAVKTSEVLAEVLLDKPLFLTYGDKLILRSGDNKQLL
FT                   AGARVLDVYSPKRHKRSEARLNFLTDLQHAQTAGERLVLYLQSQAVNAARLMWIEQLTA
FT                   SQLDALMTEQHLTHFQEWCFNRDYQQTQIHHILTALEHYHEAHSDQAGLGKARLYRIAA
FT                   LQQPEELIYHLIGQLLADGRLQQSRGWLHLPTHRIQFNEAEQALWQQVAEKFAEQNGQA
FT                   LWVRELATALNIEETLMRNFCYKAGNLGYLTAVVKDRFFLTETVYRYAEKIKALIEAQG
FT                   AISVNQLRDELPFGRKLTVQLAEYFDRCGFLRRKGNVHLLRDRDIFAH"
FT   gene            501481..502101
FT                   /locus_tag="Asuc_0443"
FT   CDS_pept        501481..502101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0443"
FT                   /product="protein of unknown function DUF1440"
FT                   /note="PFAM: protein of unknown function DUF1440; KEGG:
FT                   msu:MS2340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73820"
FT                   /db_xref="GOA:A6VLH3"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH3"
FT                   /protein_id="ABR73820.1"
FT                   /translation="MALFTQPSKRRYGVAFFVGIIGGLISAFVKWGAEHPFPPRSPIDL
FT                   FSAACPQPVLDALNSGALAMDGALQQCSRAFLNPPHVFLRDYLGIDPTQAAFTFADQAF
FT                   NWIGVTHIIFSLVFAIGYCLVAEVFPKIKFWQGIGAGLLACIAVHYIVFPAMNLTPPVS
FT                   EWPLYEHVSEIVGHIFWFWTIEVIRRDLRNRITGQPDPEDETR"
FT   gene            complement(502154..502759)
FT                   /locus_tag="Asuc_0444"
FT   CDS_pept        complement(502154..502759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0444"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: conserved
FT                   hypothetical protein 95; KEGG: hit:NTHI0928 predicted
FT                   N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73821"
FT                   /db_xref="GOA:A6VLH4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH4"
FT                   /protein_id="ABR73821.1"
FT                   /translation="MKKHTKPRNTAAQAANPKGEVRIIAGRWRGRKLPVLNAQGLRPTG
FT                   DRIKETLFNWLMPYIAGANCLDAFAGSGSLGFEALSRQAKSVTFLELDKTVARQLSKNL
FT                   QTLNCDKTQASVYNQNSLEFLKQVQNRPHFDVVFLDPPFNFGLAEQAIRLLAENNWLRP
FT                   DALIYVETEREKQPDVPENWMLLKEKTSGQVSYRLYRI"
FT   gene            502819..504333
FT                   /locus_tag="Asuc_0445"
FT   CDS_pept        502819..504333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0445"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase; KEGG: msu:MS0140 signal
FT                   recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73822"
FT                   /db_xref="GOA:A6VLH5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH5"
FT                   /protein_id="ABR73822.1"
FT                   /translation="MAEDKKKGGFWSWLGLGKKKEEQAVADKIDDIVDEIKDTIDEAGD
FT                   KIDEVADRIEDKFEEIGDKVEEGLEQIQARLDEKLDEAEQRLSEETVEQLEHFVQSETQ
FT                   NSLQNPTALEPVQTEQLVADVHPTPVKTLNQAEEHLTSADNEAASAALTEETAAGTQES
FT                   AVDFSPVSEDEVVSGASEKDELAVPVETREKPSEGGFFSRLLKGLVKTKQNIGAGFRSF
FT                   FSGKKIDDELFEELEEQLLIADIGVPTTSKIITNLEQHATRQQLKDADLLYQQLKQEMA
FT                   EILKPVARPLVIDGSKKPYVILMVGVNGVGKTTTIGKLARQFQQQGKSVMLAAGDTFRA
FT                   AAVEQLQVWGERNHIPVVAQSTGSDSASVIFDAMQSASARNIDILIADTAGRLQNKNNL
FT                   MDELKKIVRVIKKYDESAPHEIMLTLDAGTGQNAVSQARLFNEAVGLTGISLTKLDGTA
FT                   KGGVIFAIADQFNLPIRYIGVGEKIEDLRTFDADEFIDALFTHESV"
FT   gene            complement(504412..505644)
FT                   /locus_tag="Asuc_0446"
FT   CDS_pept        complement(504412..505644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73823"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH6"
FT                   /protein_id="ABR73823.1"
FT                   /translation="MKNDKLLVIADDLTGANDTGVMFAEAGFNTLLETNIHSLESTDIA
FT                   DAEIFSVSTDSRPIAEKAKRKTKDTVLKGIEKGINRIYLKIDSTMRGSVSHQIEGALAA
FT                   WETLYPDSKAVICPAYPEMGRTIENGNLYVNGVPVNETASGKDAICPVTSSSMQDLLPE
FT                   AICLACSNSHELIKQINMVQNRQIVIDAKTEDDLSIIADTISQLGNKIIPVGSAGLAQK
FT                   LKLSAKGSVKKEKIDLGRALILVTSIHETSQNQVDQYISGVGGKSIVFNPSPSQLINHE
FT                   LSGQALISQLTALIHSGDENVIIRANPAKVVNHTFGNINEVARKIAEYLAELGLYALNN
FT                   EKFDSLILFGGDGAATLLEKMDISEMKVSYAVVPGVPLCTITGGPYKGLNVMTKSGGFG
FT                   NDSLLIDMLTS"
FT   gene            complement(505646..506644)
FT                   /locus_tag="Asuc_0447"
FT   CDS_pept        complement(505646..506644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0447"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="PFAM: 2-keto-3-deoxygluconate permease; KEGG:
FT                   hso:HS_0924 possible 2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73824"
FT                   /db_xref="GOA:A6VLH7"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH7"
FT                   /protein_id="ABR73824.1"
FT                   /translation="MATTNQTEQSIIPLYDGMNKIPGGAMVIPLILGSIVGTFFPEFLG
FT                   LGSFTTALFKSSAGPLIALLIFATGMQITVKSSGPVLAHTGVILLCKTLIPAALITILG
FT                   FFIGNDGIIGISLLAMLTVVANSNGGIWLAFTGKYGDYRDQGAYIASAVNDGPFFVLLF
FT                   LGASGLADIPLSLMLAAVIPLLVGMVIGNLDPKWTNLMKPTGSIVIPFFAFALGTGINL
FT                   QAIVTGGLTGVILGIIASLLTGFLVFIGYKTILKRGNQSGIGFAAGTTAGNAIITPEIV
FT                   AQADPNFAPFVQTATAQIAAAVLVSAILAPLFAAWVLKRQGGLAQSPTGGN"
FT   gene            complement(506676..506954)
FT                   /pseudo
FT                   /locus_tag="Asuc_0448"
FT   gene            complement(507288..508133)
FT                   /locus_tag="Asuc_0449"
FT   CDS_pept        complement(507288..508133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0449"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; KEGG:
FT                   hit:NTHI0376 RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73825"
FT                   /db_xref="GOA:A6VLH8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH8"
FT                   /protein_id="ABR73825.1"
FT                   /translation="MNKEAQMMLVPQGNLEGYIRAANEYPMLTAEQEKDYAERLYYQDD
FT                   LDAAKALILSHLRFVIHVARGYAGYGLPQADLIQEGNIGLMKAVRRFNPEMGVRLVSFA
FT                   VHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNLRKTKQRLGWFSENEVDLVANELGVS
FT                   KEDVIEMESRMTGADIGFDLPADDAEEETFAPSMYLEDKSSNFAAELENENFETQAVDQ
FT                   LTVAMETLDARSQDIIKTRWLDENKATLHDLAAKYNISAERVRQLESNALKKLKSAVNF
FT                   "
FT   gene            complement(508292..508606)
FT                   /locus_tag="Asuc_0450"
FT   CDS_pept        complement(508292..508606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73826"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLH9"
FT                   /protein_id="ABR73826.1"
FT                   /translation="MNFNTILETLPGIDHLSGLNVLNGETVIHHIPAAPGKLGSLRVYY
FT                   ALAQKFDAKLDRTSAEKGLELFAEHTVDAKIHPGKHPNIDLLMDVIAENDCYLLQPLTK
FT                   "
FT   gene            complement(508628..509665)
FT                   /locus_tag="Asuc_0451"
FT   CDS_pept        complement(508628..509665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0451"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; KEGG: msu:MS0028 UDP-N-acetylmuramate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73827"
FT                   /db_xref="GOA:A6VLI0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLI0"
FT                   /protein_id="ABR73827.1"
FT                   /translation="MRNTMKNLLSFNTFGIAANAKNIVEITELSQLHTAWQNARDVGQP
FT                   VLFLGQGSNVLFLKDFRGTVLINRLQGIEHKEDADFHYLHVNGGENWHNLVAWSLEQGI
FT                   FGLENLALIPGCAGTAPVQNIGAYGVEFKDVCDYVEVLDLVQNKIFRLTKAECRFGYRD
FT                   SVFKHQYSGDFMVIAVGLKLAKNWKPVLKYGTLSELDPSAVSAKRIFDEVCAIRRAKLP
FT                   DPQQIGNAGSFFKNPIVTEEQFRILQAEYPAIPHYPQGDGFVKLAAGWLIDQCHLKGYQ
FT                   LGGAAVHEKQALVLINKGNATGSDVVELAHHIRQAVAAKFDIYLSPEVRFIGENGEVNA
FT                   ENAIG"
FT   sig_peptide     complement(509603..509665)
FT                   /locus_tag="Asuc_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.622 at
FT                   residue 21"
FT   gene            complement(509758..510966)
FT                   /locus_tag="Asuc_0452"
FT   CDS_pept        complement(509758..510966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0452"
FT                   /product="sodium/glutamate symporter"
FT                   /note="PFAM: sodium/glutamate symporter; KEGG: msu:MS0030
FT                   Na+/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73828"
FT                   /db_xref="GOA:A6VLI1"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLI1"
FT                   /protein_id="ABR73828.1"
FT                   /translation="MIFDTYETLALACLVLLLGYFLVKRIRVLNEFNIPEPVVGGFIVA
FT                   ILLTVVHELWGTSFGFDKNLQTTMMLVFFSSIGLSANFARLVKGGKPLIVFLIIAAGLI
FT                   FIQDSVGVFGAMALGLDPAYGLIAGSVTLTGGHGTGAAWADTLSKQFGISSAMEIAMAC
FT                   ATFGLVFGGILGGPVAKFLLKRMHKDEVAEDENIDDVEEAFEKPVYRRKVNTRTIIETI
FT                   TMMSICLFVGQHLDMAAKGTAFQLPTFVWCLFTGVIIRNSLAHIFKFKVADEAVDVLGT
FT                   VGLSIFLAIALMSLKLWELAGLALPIFVVLVSQIIVMVLYSVFITYRAMGKDYDAVVLS
FT                   AGHCGFGLGATPTAVANMQAVTAHFGPSHKAFLIVPMVGAFFIDLLNATVLKIFLIIVN
FT                   YFH"
FT   gene            511164..511421
FT                   /locus_tag="Asuc_0453"
FT   CDS_pept        511164..511421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0453"
FT                   /product="DinI family protein"
FT                   /note="PFAM: DinI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73829"
FT                   /db_xref="InterPro:IPR010391"
FT                   /db_xref="InterPro:IPR036687"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLI2"
FT                   /protein_id="ABR73829.1"
FT                   /translation="MKQLDIKFVKERDSQKAAQQAVIITQLETCLAERISEVFKEVNVR
FT                   VRFSSAAGVEVTGFKDKEERERFMRFLEELWTDDGLSDMA"
FT   gene            complement(511482..512873)
FT                   /locus_tag="Asuc_0454"
FT   CDS_pept        complement(511482..512873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0454"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG: msu:MS2051 EriC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73830"
FT                   /db_xref="GOA:A6VLI3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLI3"
FT                   /protein_id="ABR73830.1"
FT                   /translation="MQHHSSVRAGFRYILHKKLRQTHRISHKTIEFTCLLIGAALVALF
FT                   SLGFAKLADLGLEWNTQWATRYPIAVWFVLPFGMAALAWFTPRYTPYVGGSGIPQVIAS
FT                   LSLPHGAQKSRLITFGQTLWKIPLTFLAMLIGASVGREGPSVQVGAAVMLAWGNLCRRY
FT                   GMAFTGLNANELMAAGAGGGLAAAFNAPLSGVIFALEELGRGILLRWERRVLFGVFAAG
FT                   VILVVIEGNNPYFPQYQGATLVNNMLLWVLLCGVICGILSGIFARLLAKGIAGVSPTFL
FT                   RGWVRRHPVIVALFLGIILAALGTYTHGQTYGTGYHVVANALAGEVIQPESLGIAKLFA
FT                   TVSTYWTGIAGGIFTPSLTIGAGIGAHISAFTQGLIDPRLLVLLCMVSFLAGATQSPLT
FT                   AGVIVMEMTGSQPILVWSLIGGLIASFVSRQIMPKPFYHFAAMRFRQRVVEESKSNSEN
FT                   NTATV"
FT   sig_peptide     complement(512721..512873)
FT                   /locus_tag="Asuc_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.785 at
FT                   residue 51"
FT   gene            513224..515113
FT                   /locus_tag="Asuc_0455"
FT   CDS_pept        513224..515113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0455"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; phosphotransferase system
FT                   EIIC; phosphotransferase system lactose/cellobiose-specific
FT                   IIB subunit; KEGG: msu:MS0411 phosphotransferase system,
FT                   mannitol-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73831"
FT                   /db_xref="GOA:A6VLI4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLI4"
FT                   /protein_id="ABR73831.1"
FT                   /translation="MLSANAKLKVQSFGRFLSNMVMPNIGAFIAWGFITALFIPTGWLP
FT                   NEELAKLVGPMVTYLLPLLIGYTGGKLAGGDRGAVVGAITTAGVIVGTDIPMFLGAMIA
FT                   GPTGGWAIKRFDKWADGKIKSGFEMLVNNFSAGIIGMILAILFFWVIGPVVKSVSQALA
FT                   AGVDVLVQNNLLPLTSIFVEPAKILFLNNAVNHGVFSPLGIQQSQEFGQSVFFLIEANP
FT                   GPGLGVLLAYMLFGKGSAKQTSGGAAIIHFFGGIHEIYFPYVLMNPRLILAVIAGGATG
FT                   VFTLVLFNAGLQAPASPGSIIAVLAMTPKASFLGVISSVVAACAVSFVIAAFFVKLQKE
FT                   EDVGDLEEAQAVSKAMKGGAAAQQPVTDYKGLSKIFVSCDAGMGSSAMGASMLRKKVKD
FT                   AGLPIEVTNCAINDLPSDARMVITHQDLTLRAKKQVPNAMHFSLTNFLDNKFYDGLVND
FT                   LKAGFDEESGTEAAVATSKGNGSEETGVTFSLMPEQIFLGLKANDKFDAIRFAGEQLVK
FT                   AGFVQPSYVDAMFEREKLVSTYLGEGVAVPHGTIEAKDAVIKTGVVVCQYPEGVRFTDE
FT                   EDGVAKLVIGIAARNNEHIQVVSAITNALDSDEAIELLTSTNDVNKVLELLKA"
FT   gene            515200..516348
FT                   /locus_tag="Asuc_0456"
FT   CDS_pept        515200..516348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0456"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: msu:MS0410
FT                   mannitol-1-phosphate/altronate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73832"
FT                   /db_xref="GOA:A6VLI5"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLI5"
FT                   /protein_id="ABR73832.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLADSGVEVIFADVNESVINLLKTNRT
FT                   YGVKIVGDSINTIERVNNVSGVNSTDEAAIVTLFNEVDLVTTAVGPNVLKIIAGTVAKA
FT                   LEARLAGGNTKPLNIIACENMVRGTTFLKEQVFTHLNPAVKDQVEQLIGFVDSAVDRIV
FT                   PPVKPDANDPLLVTVEEFSEWIVDKTQFKGTVPDIKGMEQTDNLMAFVERKLFTLNTGH
FT                   AVTSYYGKSKGYRFVKESIEDAEVKAFVKSVMQESGAVLIKRYGFDPQAHAAYIEKILK
FT                   RFANPFLVDDVDRVGREPLRKLSYNDRLIKPLRGTLEYGLPNDNLIRAVAIALSYRNEH
FT                   DPQALELAKSIADSGVAATLRKYTELEDESVIERIVATYNAQ"
FT   gene            516434..516949
FT                   /locus_tag="Asuc_0457"
FT   CDS_pept        516434..516949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0457"
FT                   /product="mannitol repressor, MtlR"
FT                   /note="PFAM: Mannitol repressor; KEGG: msu:MS0409 mannitol
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73833"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLI6"
FT                   /protein_id="ABR73833.1"
FT                   /translation="MVSEDPIYEKLNDVPSIRGFVTASVAIFDELVDLLINRVFRKNDF
FT                   AVKSVIDSLFETSGPLAALSIRLKVLLGLGVLSQEAFEDISAFMQLKDKLNEDSREYHF
FT                   SDELIVAFTHKLKLFKDKAMLPQHEMTEAPDSLVGQVKIQRREKLVRSCLILTVTEIYQ
FT                   QLQVESPL"
FT   gene            517212..517523
FT                   /locus_tag="Asuc_0458"
FT   CDS_pept        517212..517523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0458"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: yps:YPTB3699 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73834"
FT                   /db_xref="GOA:A6VLI7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLI7"
FT                   /protein_id="ABR73834.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            517540..518166
FT                   /locus_tag="Asuc_0459"
FT   CDS_pept        517540..518166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0459"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: msu:MS2048
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73835"
FT                   /db_xref="GOA:A6VLI8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLI8"
FT                   /protein_id="ABR73835.1"
FT                   /translation="MIGLVGRKVGMTRVFTEDGVSIPVTVIEIEANRVTQVKTLENDGY
FT                   TAVQVTTGSKKASRVTKPEAGHFVKAGVEAGRGLWEFRTEGEEFTLGQEINVDIFADVK
FT                   KVDVTGTSKGKGFQGGVKRWNFRTQDATHGNSLSHRVLGSIGQNQTPGRVFKGKKMAGH
FT                   LGAERVTVQSLEVVRVDAERKLLLVKGAVPGATNSDVIVKPAVKA"
FT   gene            518182..518787
FT                   /locus_tag="Asuc_0460"
FT   CDS_pept        518182..518787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0460"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: hso:HS_0060
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73836"
FT                   /db_xref="GOA:A6VLI9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLI9"
FT                   /protein_id="ABR73836.1"
FT                   /translation="MELQVVGANNALTVSETTFGREFNEALIHQVVVAYAAGARQGSRA
FT                   QKTRAEVSGSGKKPWRQKGTGRARSGDIKSPIWRSGGITFAAKPQDHSQKVNKKMYRGA
FT                   IKSILSELVRQDRLVVVEKFEIDAPKTKVLAQKLKDMALNDALIITASLDENLFLAARN
FT                   LYKVDVRDVQGIDPVSLIAFDKVVVTVDAVKQIEEMLA"
FT   gene            518784..519089
FT                   /locus_tag="Asuc_0461"
FT   CDS_pept        518784..519089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0461"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: hso:HS_0061
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73837"
FT                   /db_xref="GOA:A6VLJ0"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLJ0"
FT                   /protein_id="ABR73837.1"
FT                   /translation="MIQQERLLKVLKAPHISEKATNNAETSNTIVFKVALDANKVDIAN
FT                   AIEQLFEVKVDSVRTVVVKGKTKRRGNKMGRRSDWKKAYVTLQEGQSLDFVEGAAE"
FT   gene            519110..519931
FT                   /locus_tag="Asuc_0462"
FT   CDS_pept        519110..519931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0462"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: hit:NTHI0941 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73838"
FT                   /db_xref="GOA:A6VLJ1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ1"
FT                   /protein_id="ABR73838.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKIVNPELHKGKPYAPLLDTKSKTGGRNN
FT                   LGRITTRHIGGGHKQHYRLVDFKRNKLDIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLSVGDEIQAGVNAPIKVGNSLPMRNIPVGSTVHNVELKPGKGGQIARSAGAYVQ
FT                   IIAREGNYVTLRLRSGEMRKVLAECVATIGEVGNSEHMLRVLGKAGANRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRHNKRTDKYIVRRRGK"
FT   gene            519956..520231
FT                   /locus_tag="Asuc_0463"
FT   CDS_pept        519956..520231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0463"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: msu:MS2044 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73839"
FT                   /db_xref="GOA:A6VLJ2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ2"
FT                   /protein_id="ABR73839.1"
FT                   /translation="MPRSLKKGPFLDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPSMI
FT                   GLTIAVHNGRQHVPVYVSDEMIGHKLGEFAPTRTYRGHAADKKAKK"
FT   gene            520243..520575
FT                   /locus_tag="Asuc_0464"
FT   CDS_pept        520243..520575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0464"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: msu:MS2043 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73840"
FT                   /db_xref="GOA:A6VLJ3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ3"
FT                   /protein_id="ABR73840.1"
FT                   /translation="METIAKHRYARTSAQKARLVADLIRGKKVAAALEILTYTNKKAAA
FT                   LVKKVLESAIANAEHNDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            520593..521300
FT                   /locus_tag="Asuc_0465"
FT   CDS_pept        520593..521300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0465"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; KH type 2 domain protein;
FT                   Ribosomal protein S3 domain; SMART: KH domain protein;
FT                   KEGG: msu:MS2042 ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73841"
FT                   /db_xref="GOA:A6VLJ4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ4"
FT                   /protein_id="ABR73841.1"
FT                   /translation="MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLDGDFKVRKFLNK
FT                   ELMNASVSRITIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRTAVAKIAGVPAQINIA
FT                   EVKKPELDAKLVADSIASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAIAQQPEQQP
FT                   AAPKKAPRGKGRK"
FT   gene            521314..521724
FT                   /locus_tag="Asuc_0466"
FT   CDS_pept        521314..521724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0466"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: pmu:PM1408 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73842"
FT                   /db_xref="GOA:A6VLJ5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ5"
FT                   /protein_id="ABR73842.1"
FT                   /translation="MLQPKRTKFRKVHKGRNRGLAAGTEVSFGTFGLKAVGRGRLTARQ
FT                   IEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYE
FT                   MDGVSEEIARNAFALAAAKLPIKTTFVTKTVM"
FT   gene            521724..521915
FT                   /locus_tag="Asuc_0467"
FT   CDS_pept        521724..521915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0467"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: hdu:HD1975 50S
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73843"
FT                   /db_xref="GOA:A6VLJ6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ6"
FT                   /protein_id="ABR73843.1"
FT                   /translation="MKAQELRNKNVEELNAELNNLLGEQFKLRMQAATGQLQQTHQLKQ
FT                   VRRNIARVKTVLNQKAGE"
FT   gene            521915..522172
FT                   /locus_tag="Asuc_0468"
FT   CDS_pept        521915..522172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0468"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: msu:MS2039
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73844"
FT                   /db_xref="GOA:A6VLJ7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ7"
FT                   /protein_id="ABR73844.1"
FT                   /translation="MTDKIRTVQGRVISDKMDKSFTIAIERKVKHPLLGKFIRRTTKLH
FT                   VHDENNEARLGDWVEIKECRPVSKTKSWTLVRVVEKATIA"
FT   gene            522380..522751
FT                   /locus_tag="Asuc_0469"
FT   CDS_pept        522380..522751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0469"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: pmu:PM1405 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73845"
FT                   /db_xref="GOA:A6VLJ8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ8"
FT                   /protein_id="ABR73845.1"
FT                   /translation="MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNTEQPIGTRIFGPVT
FT                   RELRSEKFMKIISLAPEVL"
FT   gene            522762..523073
FT                   /locus_tag="Asuc_0470"
FT   CDS_pept        522762..523073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0470"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW (Kyrpides Ouzounis Woese) domain
FT                   protein; KEGG: msu:MS2037 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73846"
FT                   /db_xref="GOA:A6VLJ9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLJ9"
FT                   /protein_id="ABR73846.1"
FT                   /translation="MAAKIRQNDEVIVLAGKDKGKRGKVTQVLPNGKVIVEGVKIITKH
FT                   EKPVPALGKEGGLVKKEAPIDASNVAIFNPKTNKADRVGFRFEDGKKVRFFKSNNEII"
FT   gene            523091..523630
FT                   /locus_tag="Asuc_0471"
FT   CDS_pept        523091..523630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0471"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: msu:MS2036
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73847"
FT                   /db_xref="GOA:A6VLK0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK0"
FT                   /protein_id="ABR73847.1"
FT                   /translation="MAKLHDYYRDQVVNELKTKFNYASVMQVPRIEKITLNMGVGEALT
FT                   DKKLLDNAVADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKND
FT                   EEGQALLAAFNFPFRK"
FT   gene            523642..523947
FT                   /locus_tag="Asuc_0472"
FT   CDS_pept        523642..523947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0472"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: hit:NTHI0954 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73848"
FT                   /db_xref="GOA:A6VLK1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK1"
FT                   /protein_id="ABR73848.1"
FT                   /translation="MAKQSMKARDVKRVKLAEKFYAKRMELKKIISDANSSDEDRWDAV
FT                   LKLQSLPRDASPSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW"
FT   gene            523985..524377
FT                   /locus_tag="Asuc_0473"
FT   CDS_pept        523985..524377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0473"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: hit:NTHI0955 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73849"
FT                   /db_xref="GOA:A6VLK2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK2"
FT                   /protein_id="ABR73849.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAISMPSSKLKVAIANVLAAEGY
FT                   IESVKVLEGAKPELEITLKYFQGKPVVESIQRVSRPGLRIYKRKDELPKVMGGLGVAVV
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            524393..524926
FT                   /locus_tag="Asuc_0474"
FT   CDS_pept        524393..524926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0474"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: pmu:PM1400 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73850"
FT                   /db_xref="GOA:A6VLK3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK3"
FT                   /protein_id="ABR73850.1"
FT                   /translation="MSRVAKAPVNIPAGVQVSLNGQLLTVKGKNSELSRTIHNSVEVKE
FT                   DNGALTFAPREGFAGADAQAGTARALVNAMVIGVTEGFTKKLQLVGVGYRAQVKGNSIS
FT                   LNLGFSHPVEHTLPAGITAECPSQTEIVLKGADKQLIGQVAADIRAYRKPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   gene            524941..525294
FT                   /locus_tag="Asuc_0475"
FT   CDS_pept        524941..525294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0475"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: msu:MS2032 ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73851"
FT                   /db_xref="GOA:A6VLK4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK4"
FT                   /protein_id="ABR73851.1"
FT                   /translation="MDKKSARIRRAARARHMMREQGVTRLVVHRTPRHIYAQVIAPNGS
FT                   EVLAAASTVEKEISAQVKYTGNKDAAAVVGKLVAERALAKGVKDVAFDRSGFKYHGRVQ
FT                   SLADAAREAGLQF"
FT   gene            525309..525809
FT                   /locus_tag="Asuc_0476"
FT   CDS_pept        525309..525809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0476"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   hit:NTHI0958 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73852"
FT                   /db_xref="GOA:A6VLK5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK5"
FT                   /protein_id="ABR73852.1"
FT                   /translation="MSNIEKQTGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMINVALNDGTLQHPVKGVHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPETVAAKRGKTVDE
FT                   ILG"
FT   gene            525816..525995
FT                   /locus_tag="Asuc_0477"
FT   CDS_pept        525816..525995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0477"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: msu:MS2030
FT                   ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73853"
FT                   /db_xref="GOA:A6VLK6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK6"
FT                   /protein_id="ABR73853.1"
FT                   /translation="MAKTIKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVR
FT                   GMINQVSYMVKVEE"
FT   gene            526000..526434
FT                   /locus_tag="Asuc_0478"
FT   CDS_pept        526000..526434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0478"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: hin:HI0797 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73854"
FT                   /db_xref="GOA:A6VLK7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK7"
FT                   /protein_id="ABR73854.1"
FT                   /translation="MRLNTLSPAEGAKHSAKRLGRGIGSGLGKTGGRGHKGQKSRTGGK
FT                   VRRGFEGGQMPLYRRLPKFGFTSKIAAVTAEIRLNDLTKVDGNIVTLEALKAANVITKD
FT                   IQFAKVILAGEINNAVTIRGLRVTQGAKAAIEAAGGSVEE"
FT   gene            526442..527767
FT                   /locus_tag="Asuc_0479"
FT   CDS_pept        526442..527767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0479"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: msu:MS2028 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73855"
FT                   /db_xref="GOA:A6VLK8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLK8"
FT                   /protein_id="ABR73855.1"
FT                   /translation="MAKKPGYQNRSTQNGGNELKSRLLFVLGALIVFRIGSFIPVPGID
FT                   AAVLSQLIEQQKGTIIDMFNMFSGGALSRASIFALGIMPYISASIIIQLLATVSPTLGE
FT                   LRKEGESGRRKISKYTRYATLGLATLQAIGISTGLPNMLPGLVPNLGFGFYFTAVVSLV
FT                   TGTMFLMWLGEQITERGIGNGISLIIFAGIVAGLPSAIGQTIEQARQGQMHPLVLLLIA
FT                   AVVFAVTYFVVFVERGQRRIKVEYAKRQQGRQILGGHSTHLPLKVNMASVMPAIFASSI
FT                   ILFPATLVSWFGESSSLEWLTNLSMMLQPGQPIYLIVYAIAIMFFSFFYSAMQFNPRDT
FT                   ADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGLYVVFVCLVPYIMMSAWNVQFYF
FT                   GGTSLLIVVVVIMDFIAQIQSHLMSSKYESALKKANLKGFGQ"
FT   gene            527795..527908
FT                   /locus_tag="Asuc_0480"
FT   CDS_pept        527795..527908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0480"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36; KEGG: msu:MS2027
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73856"
FT                   /db_xref="GOA:A6VLK9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLK9"
FT                   /protein_id="ABR73856.1"
FT                   /translation="MKVRASVKRICRNCKIVKREGVVRVLCTDPKHKQRQG"
FT   gene            528047..528403
FT                   /locus_tag="Asuc_0481"
FT   CDS_pept        528047..528403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0481"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: msu:MS2026
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73857"
FT                   /db_xref="GOA:A6VLL0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLL0"
FT                   /protein_id="ABR73857.1"
FT                   /translation="MARIAGINIPDHKHAVIALTAIYGIGKTRSQTICAAAGIAENVKI
FT                   SELSEEQIDKLRDEVGKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            528419..528808
FT                   /locus_tag="Asuc_0482"
FT   CDS_pept        528419..528808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0482"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: pmu:PM1392 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73858"
FT                   /db_xref="GOA:A6VLL1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLL1"
FT                   /protein_id="ABR73858.1"
FT                   /translation="MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEMVKEFGLKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            528838..529458
FT                   /locus_tag="Asuc_0483"
FT   CDS_pept        528838..529458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0483"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: msu:MS2024 ribosomal protein S4 and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73859"
FT                   /db_xref="GOA:A6VLL2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLL2"
FT                   /protein_id="ABR73859.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTAPGQHGARK
FT                   PRLSDYGSQLREKQKVRRIYGILERQFRNYYKEANRLKGNTGENLLVLLEGRLDNVVYR
FT                   MGFAATRAEARQLVSHKAIVVNGRVVNIPSFQVSVDDVVAIREKSKKQARIKASLELAE
FT                   QKEKPTWLEVDSAKMEGVFKRVPERSDLSADINEHLIVELYSK"
FT   gene            529491..530480
FT                   /locus_tag="Asuc_0484"
FT   CDS_pept        529491..530480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0484"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase alpha subunit domain protein; RNA
FT                   polymerase dimerisation; RNA polymerase insert; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type; KEGG: msu:MS2023 DNA-directed
FT                   RNA polymerase alpha subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73860"
FT                   /db_xref="GOA:A6VLL3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLL3"
FT                   /protein_id="ABR73860.1"
FT                   /translation="MQGSVTEFLKPHLVDIEQISSTHAKVILEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIEGVLHEYSSKEGVQEDILEVLLNLKGLAVKVQNKDDVFLTLNK
FT                   SGIGPVVAGDITHDGDVEIVNPEHVICHLTDENASISMRIRVQRGRGYVPASARAHSQD
FT                   EERPIGRLLVDACYSPVDRIAYNVEAARVEQRTDLDKLVIELETNGTLDPEEAIRRAAT
FT                   ILAEQLDAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAETIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASIAED"
FT   gene            530521..530910
FT                   /locus_tag="Asuc_0485"
FT   CDS_pept        530521..530910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0485"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: pmu:PM1389 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73861"
FT                   /db_xref="GOA:A6VLL4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLL4"
FT                   /protein_id="ABR73861.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMASALVSHEIIKTTLPKAKELR
FT                   RVVEPLITLAKEDSVANRRLAFARTRNVETVAKLFNELGPRFAQRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPEVSTETATTE"
FT   gene            complement(530984..531667)
FT                   /locus_tag="Asuc_0486"
FT   CDS_pept        complement(530984..531667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0486"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pmu:PM1388
FT                   hypothetical HI0762"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73862"
FT                   /db_xref="GOA:A6VLL5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR017056"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLL5"
FT                   /protein_id="ABR73862.1"
FT                   /translation="MILFAGDPHGRYDHLYPFLQRKNEEIALIILGDLQLTDCNELDKL
FT                   SKWCEVWYIHGNHDSKTPAAYDSLWNSQWKTRNLHGKVVEIQGKRIAGLGGVFRGQIWM
FT                   PPNKPLYFDPIHYCQYCPPEKLWRRGIPLRHRTSIFPLDIEILEQQQADILVCHEAPEP
FT                   HPAGFYAINNLATKMGVTQVFHGHHHENFDYHGINKNKFEIINVGFRSLADSMGNYLIK
FT                   GLDDR"
FT   gene            complement(531676..532953)
FT                   /locus_tag="Asuc_0487"
FT   CDS_pept        complement(531676..532953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0487"
FT                   /product="nicotinamide-nucleotide adenylyltransferase"
FT                   /note="TIGRFAM: cytidyltransferase-related domain;
FT                   nicotinamide-nucleotide adenylyltransferase; PFAM:
FT                   helix-turn-helix domain protein; KEGG: pmu:PM1387
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73863"
FT                   /db_xref="GOA:A6VLL6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLL6"
FT                   /protein_id="ABR73863.1"
FT                   /translation="MSSEYAYLQEKRKQLKLKVNEVCEQAGITRAYFNQLVSGKIKNPS
FT                   ANKLSALHRVLQISAQKDKRVGVIFGKFYPVHTGHINMIYEAFSKVDEVHVVVCSDTER
FT                   DLKLFYDSKMKRMPTVQDRLRWMQQIFKYQKNQIFIHHLVEDGLPSYPNGWESWSNAVK
FT                   KLLKEKNVNPTLVFSSEIQDKAPYEKYLGLEVSLVDPQRQFFNVSATKIRTNPFHYWKF
FT                   IPKEVRPFFAKTIAILGGESSGKSVLVNKLATVFNTTSAWEYGREYVFEQLGGDEQAMQ
FT                   YSDYPQMALGQQQYINYAVRHAHKVAFIDTDFITTQAFCIQYEGKAHPFLDSMIREYPF
FT                   DVTILLNNNTQWVDDGLRSLGDAKERQRFQQLLKKLLDKYNVPYIEIDSPSYLDRYNQA
FT                   KLIVEKILNEEEISDLTHDNNSDFEK"
FT   misc_binding    533105..533234
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 106.73"
FT   gene            533309..533944
FT                   /locus_tag="Asuc_0488"
FT   CDS_pept        533309..533944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0488"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: msu:MS0172 3, 4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73864"
FT                   /db_xref="GOA:A6VLL7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLL7"
FT                   /protein_id="ABR73864.1"
FT                   /translation="MNQSLLAQFGTAEERVIKAINAFKQGNGVLVLDDENRENEGDLIF
FT                   PAETITTEQMAKLIRFGSGIVCLCITDELCQQLDLPPMVQNNSSVNKTAFTVTIEAAQG
FT                   VSTGVSAADRVTTVKAAVADNAKPSDLHRPGHIFPLRAAKGGVLTRRGHTEAAVDLALL
FT                   AGYKPAGVICEITNDDGTMARAPQLVKFAQEFNYAVVTIEDLVAYLTK"
FT   gene            534275..535288
FT                   /pseudo
FT                   /locus_tag="Asuc_0489"
FT   gene            535345..536847
FT                   /locus_tag="Asuc_0490"
FT   CDS_pept        535345..536847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0490"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: msu:MS0062 ABC-type sugar (aldose) transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73865"
FT                   /db_xref="GOA:A6VLL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017917"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLL8"
FT                   /protein_id="ABR73865.1"
FT                   /translation="MQVPYLEFDNVSKSFPGVKALQNISFKCYEGRVHALMGENGAGKS
FT                   TLLKILSGNYLPSEGKLSIGGRQLVFRNTKEALLAGVAIIYQELNIVPEMTVAENLCLG
FT                   QFPHSFGIVDKSELVKRTQKYLDKLDLNISPDTPLKELSIGQWQMIEIAKALSRGAKII
FT                   AFDEPTSSLSAPEIEKLFSVINELRDEGKVILYVSHRMEEIFRISDEITVLKDGQYVET
FT                   FSSLSKITNDDLVRSMVGRNLGDIYHYRPRDVGKERLKISRLSGHKLKGDFNLTVRAGE
FT                   VLGLFGLVGAGRSELLKVIFGADPNIEGTIELDGKTVCIRNPKEAIEQGIVLCPEDRKK
FT                   EGIIPTATVAENINISARRSHNFFKFIINEKWEKENAERQRRQMNVKTPSIQQLIVNLS
FT                   GGNQQKAILGRWLSEDIKVLLLDEPTRGIDVGAKSEIYDLIFKLADEKLAIIVVSSDLP
FT                   EVIGVSDRIMVMRGHQITGVVTREEATEEKILKLAMVESKAA"
FT   gene            536863..537831
FT                   /locus_tag="Asuc_0491"
FT   CDS_pept        536863..537831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0491"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: msu:MS0061
FT                   ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73866"
FT                   /db_xref="GOA:A6VLL9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLL9"
FT                   /protein_id="ABR73866.1"
FT                   /translation="MTSITQEKTVGSFGRIWNSYGMLLIFAVIFIGSCLFIPNFATVVN
FT                   MRGLGLAISMSGIVACGMLFCLAAGEIDLSVASVIACAGVVTAVAINMTQSVTVGILAG
FT                   LGLGVAVGLINGFVIAKLKINSLITTLATMQIARGFGYIISDGKAVGITKEEFFELGYQ
FT                   DIFGVPLPIIFTVICIAVFGFLLSKTTYGRNTLAIGGNQEASRLAGINVDRTKLIIFVV
FT                   SGFVSALAGVILAARMTSGQPMTSVGFELVAISACVLGGVSLNGGVAKISFIIAGVLIL
FT                   GTIENAMNLLNISPFAQYVVRGLILLIAVIFDKYKQKIIKS"
FT   gene            537841..538698
FT                   /locus_tag="Asuc_0492"
FT   CDS_pept        537841..538698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0492"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: msu:MS0060 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73867"
FT                   /db_xref="GOA:A6VLM0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM0"
FT                   /protein_id="ABR73867.1"
FT                   /translation="MKRRHEVQSETNPLLPGYQFGSYLVAGCTPIERGSEIDFTIRRPN
FT                   GMKGYIINLTTQGEGAVFEGERAFTCSKGDLLLFPPNAEHLYHRSESASSWHHQWIYFR
FT                   PRSFWASWLQWSRVTDHVGRLKITDLTTYREIETLFKQIEREYGNKDMFSQAMSMCLLE
FT                   QLLIKCIKLDPVNIQRMLDPRILETCHFISANLHLNHKITEIAEHVHISPSRLTHLFVQ
FT                   QTGSSIIRWREEQRMIKAQHLLHTSGAPIYAIARQLGYDDQLYFSRIFKRYVGLSPSDY
FT                   RNSR"
FT   gene            538911..540515
FT                   /locus_tag="Asuc_0493"
FT   CDS_pept        538911..540515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0493"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: msu:MS0059
FT                   XylB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73868"
FT                   /db_xref="GOA:A6VLM1"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM1"
FT                   /protein_id="ABR73868.1"
FT                   /translation="MRDVQAVITSGEASIGIEFGSTRIKAVLINVQGDILATGGFTWEN
FT                   HFVDGIWTYPQDEIWQGLQAAYRALTDNVKEKYGLSVTKAKAIGISGMMHGYMPFDQRG
FT                   GLLVPFRTWRNNITAKSSQKLTALFNYNIPQRWSVSHLYQAILNREQHVGEIDFFTTLA
FT                   GYVHWRLTDEKVLGVGEASGMFPIDPKTGSYYQSMLNRFDELVAPYSYPWKITEILPKV
FT                   LTAGQFAGKLTEQGAKLLDPTGQLQAGIPLCPPEGDAGTGMVATNSIKVNTGNISAGTS
FT                   AFAMIVLEKELTRVYEQLDSVTTPAGKLVAMAHANNCTSDINAWINLFGENLKVFGLEV
FT                   EPDKLYETLFLKALEGEANCGNLLAYGFYSGEHSVGLSEGCPTFMHPANSNFTLANFIR
FT                   SHLYSAFGAMKLGVDILIQREKVKIARILAHGGIFKTPNVASKILASAINVPVAVMKTA
FT                   NEGGAWGIALLANYLAAYQAGESLEDYLDNRIFVRSEIQITRPDAEMAKGYAEFIRTYQ
FT                   KGIPVVRAAVDAFHYEI"
FT   gene            540536..542023
FT                   /locus_tag="Asuc_0494"
FT   CDS_pept        540536..542023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0494"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="PFAM: L-arabinose isomerase; KEGG: msu:MS0058
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73869"
FT                   /db_xref="GOA:A6VLM2"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLM2"
FT                   /protein_id="ABR73869.1"
FT                   /translation="MEFIKKLEVWFIVGSQDLYGDEALKQVYANAKQITQYLNSRNPFI
FT                   QIKLKPLATTPEDILAICRAANYEENCAGVIAWMHTFSPAKMWIAGLTRLDKPLLQFHT
FT                   QFNKYIPWNEIDMDYMNLHQTAHGDREFGFMVSRLRKPRTIVVGHWQSESVKQKLDRWM
FT                   RVLAAIYDQQHLKVARFGDNMREVAVTEGDKVEAQIKFGYSVNGYGIYQLVNSINAIKE
FT                   EDIATLVKEYEADYQLVDSLKEGGEKRQSLIDSARIELGLKAFLDKGGFKAFTDTFQNL
FT                   YGMKQLPGLPVQRLMAQGYGFGAEGDWKTAALVRAIKVMSYGLPNGCSFMEDYTYNLED
FT                   HNEVVLAAHMLEVCPSIAEDKPILDIKPLGIGGKEDPTRLIFTSKAGCATASTIVDLGN
FT                   RFRMITAELQAIAKPQDMPNLPVGHAFWKLEPDFDTGTQAWILAGGAHHNVFSLDIDAD
FT                   MLRTFAEYFGIEFIHIHAKTELADLKNELRWNDVAYK"
FT   gene            complement(542127..543305)
FT                   /locus_tag="Asuc_0495"
FT   CDS_pept        complement(542127..543305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0495"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: msu:MS2375 transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73870"
FT                   /db_xref="GOA:A6VLM3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM3"
FT                   /protein_id="ABR73870.1"
FT                   /translation="MAVDQEYYRVALLFNANKVYDRGVIEGVGQYLQASQCTWDIFLED
FT                   DFIYHKEEIKNLSIDGIIGDFDDLETAAILANIDVPVVAVGGSYQNADYYPDLPYIATD
FT                   NEKLVEMAFLHLKEKGLTRFAFYGLPVTTKKHWANERLATFQRLMDKYEYKSEIYLGDK
FT                   TNSRNWLTAQANLCQWLQTLPKYTGIIAVTDARARHLLQACEYLKIAVPEELCIMGIDN
FT                   EDLIQHLSRISLSSVEQGTTQIGYQAAKQLHRLLGGQTVPHRPLIVPPGKVIARRSTDY
FT                   RSLQDPVVIQAMHYIHHRASQGIKTEQVLDHLRISRSNLEQRFKAEMNKTIHQVIHEEK
FT                   LDRAKNMLKFTDVPIQEIAEICGYPSLQYFYAVFKKEHRQTPKEFREQFLAY"
FT   gene            complement(543404..544843)
FT                   /locus_tag="Asuc_0496"
FT   CDS_pept        complement(543404..544843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0496"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1; KEGG:
FT                   msu:MS2374 permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73871"
FT                   /db_xref="GOA:A6VLM4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM4"
FT                   /protein_id="ABR73871.1"
FT                   /translation="MARTNSYVIGVTLVATLGGLLFGYDTAVISGTVSSLDTVFIQPKG
FT                   LPEISANSLLGFCVASALIGCIIGGACGGYLSSKYGRKKALVIAAVLFLLSAFGSAYPE
FT                   FGLTEINRTNDVPYYLSNFLTQFVIYRIIGGIGVGIASMISPMYIAEIVPAHIRGKMVS
FT                   FNQFAIIAGQLVVYFVNYFIALNGDNTWLNMLGWRYMFLSEMVPAGLFLTLLFFVPESP
FT                   RWLVLQNKLTQAEVTLLKLLGEKSGKKELQNIVSSLEHRVAKGSPLLSFGIGIILIGIA
FT                   LSVFQQFVGINVALYYAPEIFKSLGASTDSALLQTIIMGAINLSCTTIAIFTVDKYGRK
FT                   PLQIVGALGMAVGMCVLGTAFYANLSGSIALTGMLFYVASFAISWGPVCWVLLAEIFPN
FT                   AIRSQALAIAVATQWIANYIVSWTFPMMDKSSYLLEHFNHGFAYWVYAFMSILAALFMW
FT                   KFVPETKGRTLEEVELLWRKK"
FT   sig_peptide     complement(544772..544843)
FT                   /locus_tag="Asuc_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.611 at
FT                   residue 24"
FT   gene            complement(545183..546310)
FT                   /locus_tag="Asuc_0497"
FT   CDS_pept        complement(545183..546310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0497"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: hin:HI1109
FT                   D-xylose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73872"
FT                   /db_xref="GOA:A6VLM5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM5"
FT                   /protein_id="ABR73872.1"
FT                   /translation="MSKFKSINLQVYIMFIAIVVIMAFFFVTTDGAYLSARNISNLLRQ
FT                   TSITGILAIGMIFVIISAEIDLSVGSMMGLLGGFAAIADVWWGWPLPLTIVVTLAAGVL
FT                   FGTFTGWWVAYRKVPSFIVTLAGMLIFRGMLVGATNGTTVSPISKEMTAIGQGYLSDTT
FT                   GMILGIVAVVCFFLWGSYQRKARKNLNLTVPNAGKETMKYGLFTICVLGAIYLLNDYRG
FT                   IPFPVLLLALLAVIGMFIARKTAFGRHIYAIGGNIEAARLSGINVEKIKLMIFSMNGFM
FT                   VAIAGLILSSRLGAGAPSAGQNAELDAIAACVIGGASLAGGIGSVYGVVIGALIIALLD
FT                   NGMSMLDVPTFWQYIVKGSILLLAVWMDTVSKKKM"
FT   sig_peptide     complement(546221..546310)
FT                   /locus_tag="Asuc_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.380 at
FT                   residue 30"
FT   gene            complement(546314..547828)
FT                   /locus_tag="Asuc_0498"
FT   CDS_pept        complement(546314..547828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0498"
FT                   /product="D-xylose ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: D-xylose ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   hso:HS_0585 D-xylose ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73873"
FT                   /db_xref="GOA:A6VLM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM6"
FT                   /protein_id="ABR73873.1"
FT                   /translation="MAQLLEMKNITKKFGDVTALNNISISLETGEILSLCGENGSGKST
FT                   LMKVLCGIYPYGDFSGEITFSGEPLIAKGIKDTEEKGISIIHQELTLVKNMTVLENMFL
FT                   GNEIVKSGITDDNEMYLRCKTLLQQVQLDIDPNTKVGELGLGQQQLVEIAKALNKQVRL
FT                   LILDEPTASLTEKETAVLLALVKDLSAHNIACVYISHKLNEVKAISDKICVIRDGEHIG
FT                   TRPAESVSEDDIITMMVGREITSLYPYQEHQIGEEVLRVANITAWHPINTHIKRVDNAN
FT                   FKLHAGEILGVAGLVGSGRTEMAQCIFGSYQGKSQGDIFIRNQKVKIRNCEEAIKNQIV
FT                   MVPEDRKKHGIIPIMGVGKNITLSSLRQFCFGGKIINEPLEETIINQSIERLKVKTSSS
FT                   ELAIGRLSGGNQQKAILAKCLLLNPQILILDEPTRGIDVGAKYEIYKLINRLAQEGMAV
FT                   IVISSELPEVLGISDRVLVMHQGQIKADLINNNLTQEQVMEAALKE"
FT   gene            complement(547914..548912)
FT                   /locus_tag="Asuc_0499"
FT   CDS_pept        complement(547914..548912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0499"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="TIGRFAM: D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: hin:HI1111
FT                   D-xylose transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73874"
FT                   /db_xref="GOA:A6VLM7"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:4YWH"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM7"
FT                   /protein_id="ABR73874.1"
FT                   /translation="MKLKTTLLTLAAAIAVCAIPAQAKDLTIGMSIDDLRLERWQKDRD
FT                   IFVKKAESLGAKVLVQSANGDDSAQISQIENMLNKNVDVLVIIPHNGDVLSNVISEAKK
FT                   EGVKVLAYDRLINNADLDFYVSFDNEKVGELQADAIIKEKPEGNYFLMGGSPVDNNAKL
FT                   FRKGQMKVLQPLIDSGKIKVVGDQWVDSWLAEKALQIMENALTANKNNIDAVVASNDAT
FT                   AGGAIQALSAQGLSGKVAISGQDADLAAIKRIVEGTQTMTVYKPITNLADKAAELSVAL
FT                   GKEEKLEPNAKLNNGLKEVDAYLLDPIVVTKDNIDSTVIKDGFHSKEAVYK"
FT   sig_peptide     complement(548841..548912)
FT                   /locus_tag="Asuc_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            549164..550477
FT                   /locus_tag="Asuc_0500"
FT   CDS_pept        549164..550477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0500"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="TIGRFAM: xylose isomerase; PFAM: Xylose isomerase
FT                   domain protein TIM barrel; KEGG: msu:MS2373 xylose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73875"
FT                   /db_xref="GOA:A6VLM8"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLM8"
FT                   /protein_id="ABR73875.1"
FT                   /translation="MTNYFDKIEKVNYEGADSINPFAYKYYNANEVILGKTMADHLRLA
FT                   VCYWHTFCWNGNDMFGVGSLDRSWQKQTDPLAGAKQKADIAFEFLTKLGVPYYCFHDVD
FT                   IAPEGNSYQEYVNNFNTIVDVLEQKQAETGIKLLWGTANCFTNPRYMSGAATNPNPEIF
FT                   ARAGAQVFNAMNATKRLGGENYVLWGGREGYETLLNTDLRREREQIGRFMQMVVEHKHK
FT                   IGFKGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQH
FT                   EIATAAALDILGSIDANRGDPQLGWDTDQFPNSVEENTLAIYEILKAGGLTTGGLNFDA
FT                   KIRRQSIDPYDLFHAHIGAIDVLALSLRRAAKMLEDQTLQHIVEQRYAGWNGELGQQIL
FT                   NGKSSLEALAQAAQHLEPQPVSGQQEYLENLVNSYIYR"
FT   gene            550545..551990
FT                   /locus_tag="Asuc_0501"
FT   CDS_pept        550545..551990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0501"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: msu:MS2372 sugar (pentulose and hexulose)
FT                   kinases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73876"
FT                   /db_xref="GOA:A6VLM9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLM9"
FT                   /protein_id="ABR73876.1"
FT                   /translation="MYIGIDLGTSGVKVVLLDESQQILATVQQALPISRPHPLWSEQDP
FT                   KDWWDAANLAMLALSREQNLSAVKAIGLTGQMHGATLLDNRDNVLRPAILWNDGRSAAE
FT                   CAELEKLVPNSREITGNLMMPGFTAPKLKWVDNHEPEVAEKVSKVLLPKDYLRLKMTGE
FT                   YASDMSDASGTMWLDVAKRDWDKSLLNACGLDENAMPKLFEGNQITGYLRAELAKSWKM
FT                   NIVPVVAGGGDNAAGAIGIGLYKSGQAMLSLGTSGVYFVVTDKFTANPQKAVHSFCHAL
FT                   PDRWHLMSVILSAASAVDWVQKVTGIANIQTLFEQAEKSAVDSETVFLPYLSGERTPHN
FT                   DAYAKGVFWGLNHNDNQASMAKAVVEGVSFALADGIDVLHETGVTADNIALIGGGAKSA
FT                   YWRQLLADISGRTMEYRTGGDVGPALGAAKLAQIALNPNENIADLCQPLPLEAVYRPRA
FT                   ERAAYYAEKRAKYAQLYQRLKGL"
FT   gene            552142..553122
FT                   /locus_tag="Asuc_0502"
FT   CDS_pept        552142..553122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0502"
FT                   /product="TIM-barrel protein, yjbN family"
FT                   /note="TIGRFAM: TIM-barrel protein, yjbN family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: pmu:PM1418
FT                   tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73877"
FT                   /db_xref="GOA:A6VLN0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLN0"
FT                   /protein_id="ABR73877.1"
FT                   /translation="MQNPSYFYRGRFSVAPMLDWTTRHCRYFHRQFSRHALLYTEMVTT
FT                   QAIVHAGYDHLAFDTAENPVALQLGGSDPVQLAHCAKLAEERGYREINLNVGCPSDRVQ
FT                   NGMFGACLMAKADLVAECVTKMQAAVSIPVTVKTRIGIDELDSYEFLYDFVHKITNAGC
FT                   QELIVHARKAWLSGLSPKENREIPPLDYERVYQLKRDFPHILISINGGIKTIEEMTAHL
FT                   QQVDGVMVGREAYQNPSLLGYIDQALFDPTARIVTAREAVENMFPYIEQQLNRGVYLNH
FT                   IVRHILGAFQGCKGARQWRRYLSENAYKPGADAEVVRTALSFVEA"
FT   gene            complement(553275..554267)
FT                   /locus_tag="Asuc_0503"
FT   CDS_pept        complement(553275..554267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0503"
FT                   /product="Aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="PFAM: aspartate--ammonia ligase; KEGG: msu:MS0036
FT                   asparagine synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73878"
FT                   /db_xref="GOA:A6VLN1"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLN1"
FT                   /protein_id="ABR73878.1"
FT                   /translation="MKKSFILQQQEISFAKNTFTTKLAEHLGLVEVQGPILSQVGNGIQ
FT                   DNLSGKEKPVQVNVKMIEDATFEVVHSLAKWKRHTLARFGFAEGEGLFVHMKALRPDED
FT                   SLDQTHSVYVDQWDWEKVIPAGRRNLNYLKETVRSIYAAIVETQEAVEQKFGLKAFLPK
FT                   EITFIHSEDLARDYPHMTDKERENEICKKYGAVFLIGIGGDLPDGKPHDMRAPDYDDWT
FT                   TSSEGEYKGLNGDILVWNPVLNRAFELSSMGIRVDETALRRQLALTHDEERLNFAWHQD
FT                   LINGRMPLSIGGGIGQSRLAMLLLQKHHIGEVQSSVWPKTVMEQFENIL"
FT   gene            554454..554906
FT                   /locus_tag="Asuc_0504"
FT   CDS_pept        554454..554906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0504"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   msu:MS0035 transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73879"
FT                   /db_xref="GOA:A6VLN2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLN2"
FT                   /protein_id="ABR73879.1"
FT                   /translation="MQTIDALDQQILRVLTKDARTPYAEMAKNFGVSPGTIHVRVEKMR
FT                   QSGIIEGTKVRINERKLGYDVCCFIGIILKSAKDYDKVIKQLEAFDEVVEAYYTTGNYS
FT                   IFIKVMTHTIAELHSVLATKIQLIDEIQSTETLISMQNPILRDIRP"
FT   gene            complement(554985..556520)
FT                   /locus_tag="Asuc_0505"
FT   CDS_pept        complement(554985..556520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0505"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   hit:NTHI1282 competence protein ComM"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73880"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLN3"
FT                   /protein_id="ABR73880.1"
FT                   /translation="MSLAIVYSRASIGVQAPLVTIEVHISNGKPAFVLVGLPEKTVKEA
FT                   QDRVRSALINAQFKYPAKRITVNLAPADLPKEGGRFDLPIALGILAASGQIEANHLRRF
FT                   EFLGELALTGNLRGVQGIIPAILEAQKAKRQMIIAPQNANEASLISNQETYYAGSLLDV
FT                   VQFLNNQTALPSTDQLAQQSAVNFFKGNQADLTDIIGQQHAKRALTIAAAGQHNLLFLG
FT                   PPGTGKTMLASRLTGLLPEMSDQEAIETAAVASLVQNELNFSNWKQRPFRAPHHSASLP
FT                   ALVGGGTIPRPGEISLAHNGVLFLDELPEFERRVLDALRQPLESGEIIISRAMGKIRFP
FT                   ARFQLIAAMNPSPTGNYQGTHNRTTPQQIIRYLNKLSGPFLDRFDLSIEVPLLPQGALQ
FT                   SKDDRGESSLEVRSKILKVREIQLNRQDKVNAHLGSKEIDRFCQLNEADAVFLEQALNK
FT                   LGLSVRAYHRILKVSRTIADLADEERINRMHLAEALGYRAMDRLLMKLHDGRE"
FT   gene            complement(556628..557248)
FT                   /locus_tag="Asuc_0506"
FT   CDS_pept        complement(556628..557248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0506"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   hit:NTHI1283 probable GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73881"
FT                   /db_xref="GOA:A6VLN4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLN4"
FT                   /protein_id="ABR73881.1"
FT                   /translation="MSEIKLNYHKTRFLTSAANIKQLPEDSGIEIAFAGRSNAGKSTAL
FT                   NALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKLQWQKSLGEY
FT                   LQKRECLGGVVILMDIRHPLKALDQQMIEWAVSADLPLLLLLTKADKLSQSARSKTVKM
FT                   VREAILPFQGDIQVETLSAQNKLGVDRLSAKLDAWFAPNFATE"
FT   gene            complement(557303..557716)
FT                   /locus_tag="Asuc_0507"
FT   CDS_pept        complement(557303..557716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0507"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   msu:MS2245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73882"
FT                   /db_xref="GOA:A6VLN5"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLN5"
FT                   /protein_id="ABR73882.1"
FT                   /translation="MTALERLFHAILFELLAIIISILAVKLVTDYSTVETGIVIVLISV
FT                   IAVFWNILFNWGFDKLFPGAREKRRTLLRIFHTLAFEGGLLFFTLPLVAFVLKISWLDA
FT                   FIMDIGLTLLIVVYTFFFNLIYDHLRAAILRQS"
FT   gene            complement(557786..559150)
FT                   /locus_tag="Asuc_0508"
FT   CDS_pept        complement(557786..559150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0508"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: msu:MS0151 uncharacterized BCR"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73883"
FT                   /db_xref="GOA:A6VLN6"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLN6"
FT                   /protein_id="ABR73883.1"
FT                   /translation="MDGLLFFILDILKVPSVLVGLIALVGLIAQKKSLPDTIKGTVKTI
FT                   LGFIVLSGGATVLLTSLTPLGNMFEYAFNVQGIIPNNEAIVSMAIEKYGTATALIMAFG
FT                   MAANIIVARFTRLKFIFLTGHHTFYMACMIGVILTVAGFEGVQLIFVGALTLGLIMAFF
FT                   PALIHRYTRRVTGTDEVGFGHFGTLGYVLSAVIGSAVGKDSKSTEEMDLPKNLSFLRDS
FT                   SISISLTMMVIYFILAVASGSEYVTVHLSNGQHYLVYAMIQAITFAAGVFIILQGVRLI
FT                   LAEIVPAFTGFSEKLVPNAHPALDCPIVFPYAPNAVLIGFLASFVGGVVGLVLLGQLNW
FT                   VLILPGVVPHFFCGATAGVFANATGGRRGAIIGAFAHGLLITFLPVFLLPVLGSLGFAN
FT                   TTFSDADFGGVGIVLGYMAQYLSPNMITSVIVGIFALLVIYNYVAKQPQPPESDE"
FT   gene            complement(559181..559450)
FT                   /locus_tag="Asuc_0509"
FT   CDS_pept        complement(559181..559450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0509"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: msu:MS0150
FT                   phosphotransferase system component IIB of unknown
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73884"
FT                   /db_xref="GOA:A6VLN7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLN7"
FT                   /protein_id="ABR73884.1"
FT                   /translation="MKIMAVCGHGIGSSFMMDMNIKKVLKKLNIEAEVEHTDLASVNAN
FT                   DADLFIMANDIANSSGLPKDKILVIKNIVGTKELEEKLSAYFNQ"
FT   gene            complement(559648..559887)
FT                   /locus_tag="Asuc_0510"
FT   CDS_pept        complement(559648..559887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0510"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: msu:MS0173
FT                   predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73885"
FT                   /db_xref="GOA:A6VLN8"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLN8"
FT                   /protein_id="ABR73885.1"
FT                   /translation="MNNNIIHYTLDTLGLRCPEPVMLVRKQIRHMQNGEMLLVIADDPA
FT                   TTRDIPGFCQFMEHTLVRAEMERPPFRYWVKKGK"
FT   gene            559966..560574
FT                   /locus_tag="Asuc_0511"
FT   CDS_pept        559966..560574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0511"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: msu:MS0174 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73886"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLN9"
FT                   /protein_id="ABR73886.1"
FT                   /translation="MQYLIPKSTVVFEEEIKKSRFITYLQHTDGLERARTFWAEVRNNH
FT                   PNGRHHCWAAVAAQPTNSQALGFSDDGEPAGTAGKPMLAALLGSKLGEISAVVVRYYGG
FT                   ILLGTGGLVRAYGNGVQQALKLLETELKVERQYYVLRCDYGQINWLQFLCEKYDIVIEN
FT                   QNFQEKVQFILAISDDRLAAFNQELTERSAGQLVLNQIK"
FT   gene            560592..562055
FT                   /locus_tag="Asuc_0512"
FT   CDS_pept        560592..562055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0512"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: msu:MS0175 trk-type K+
FT                   transport systems, membrane components"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73887"
FT                   /db_xref="GOA:A6VLP0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLP0"
FT                   /protein_id="ABR73887.1"
FT                   /translation="MHIFTIIRIVGILVMCFSFAMLAPAFIALIYGDGGGTAFIQSFFI
FT                   SLAVGASLWWSCHLHKEELRSREGFLIVVSFWVVLGSLAALPFMLFDEPNLTLASAFFE
FT                   AFSGLTTTGATTITGLDNLPKAILFYRQFLQWLGGMGIIVLAIAIIPLLGIGGMQLYRA
FT                   EMSGPMKEQKMQPRIAETAKTLWFIYASLTVLCALSYYWAGMSGFDAISHSFSTVSIGG
FT                   FSTHDASMGYFDSPTINMITVVFLLISACNFALHFRAFSEIREGNFFKIYLRDPEFRFF
FT                   IRIQIVLIALCSFALVRHHTADDWWVNVEQAVFQAVSISTTTGYTTADFTHWPSFIPML
FT                   LIIASFIGGCAGSVGGGLRVARVLVLSLQGLRELKLFVHPNLVYPIKWGKVILDNRVIS
FT                   SIWSFFSAYVLLFVICLLSVIACGLEPFDAFNAVLACLNNLGPGMGIVSSNFVDVPDSA
FT                   KWILTGAMVCGRLEIFTLLALFSPAFWRT"
FT   sig_peptide     560592..560660
FT                   /locus_tag="Asuc_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.377 at
FT                   residue 23"
FT   gene            562055..562564
FT                   /locus_tag="Asuc_0513"
FT   CDS_pept        562055..562564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0513"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: pmu:PM1499 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73888"
FT                   /db_xref="GOA:A6VLP1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLP1"
FT                   /protein_id="ABR73888.1"
FT                   /translation="MKTLIIYSSYDGQTKKIAEFIAQKINAEVIALEQSAVKNLDDFER
FT                   IIIGASIRYGHFNKALYKFIEKQTALLNRKTTAFFGVNLTARKAEKNTPETNVYVRKFL
FT                   QRISWQPTLSAVFAGALRYPRYNFFDRTMIRLIMKITGGETDPSAEIEYTDWNKVAIFA
FT                   AEFADV"
FT   gene            562856..564391
FT                   /locus_tag="Asuc_R0019"
FT   rRNA            562856..564391
FT                   /locus_tag="Asuc_R0019"
FT                   /product="16S ribosomal RNA"
FT   gene            564543..564618
FT                   /locus_tag="Asuc_R0020"
FT                   /note="tRNA-Glu1"
FT   tRNA            564543..564618
FT                   /locus_tag="Asuc_R0020"
FT                   /product="tRNA-Glu"
FT   gene            564837..567832
FT                   /locus_tag="Asuc_R0021"
FT   rRNA            564837..567832
FT                   /locus_tag="Asuc_R0021"
FT                   /product="23S ribosomal RNA"
FT   gene            567939..568053
FT                   /locus_tag="Asuc_R0022"
FT   rRNA            567939..568053
FT                   /locus_tag="Asuc_R0022"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(568259..568960)
FT                   /locus_tag="Asuc_0514"
FT   CDS_pept        complement(568259..568960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0514"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   hit:NTHI0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73889"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLP2"
FT                   /protein_id="ABR73889.1"
FT                   /translation="MSDLTLTPIAVIHTPYKEKFSVPRQPDLIQDGTGVLELLPPYNIP
FT                   ESVRGLEQFSHLWLIFQFDRIERGKWNPTVRPPRLGGNRRMGVFATRSTHRPNPLGLSK
FT                   VALKKIECENGNVKLYLGAVDLVDGTPILDIKPYIAYADQEPNAISGFAQHKPKNNLAV
FT                   TFTEEAKNILTRIQQKYPFIQRFITEVLQQDPRPAYHQEKNSKKIYGIKLYDYNIRFQF
FT                   DGHIVKVIDII"
FT   gene            569042..569947
FT                   /locus_tag="Asuc_0515"
FT   CDS_pept        569042..569947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0515"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   msu:MS1840 1, 4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73890"
FT                   /db_xref="GOA:A6VLP3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLP3"
FT                   /protein_id="ABR73890.1"
FT                   /translation="MAKTSFKAWLDTARPKTLPLALAIILTGSALSQWRGSFSWSVTLL
FT                   CLLTATLLQIVSNFANDYGDYQKGSDTAERIGPLRGIQQGEMTAAQLRKGLIVAITISF
FT                   VSGVLLIAIAYEDIKDLIVFGGLGLLAILAAITYTVGKKPYGYLGLGDISVFLFFGLLS
FT                   VCGTYYLQTHELSGDIFLPASACGLLSTAVLNINNLRDIEQDKKAGKNTLIVRIGPEKG
FT                   RIYHCFLLLGAVLCYALFALKYKPILLSVIGVIAFLLARHAKFVVTHKDPSALRPMLAK
FT                   MSMLALISTVLFSLGLLMLP"
FT   sig_peptide     569042..569140
FT                   /locus_tag="Asuc_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.990 at
FT                   residue 33"
FT   gene            569992..570492
FT                   /locus_tag="Asuc_0516"
FT   CDS_pept        569992..570492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0516"
FT                   /product="Ribonuclease E inhibitor RraA"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A;
FT                   Ribonuclease E inhibitor RraA; PFAM: Dimethylmenaquinone
FT                   methyltransferase; KEGG: msu:MS1839 regulator of
FT                   ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73891"
FT                   /db_xref="GOA:A6VLP4"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLP4"
FT                   /protein_id="ABR73891.1"
FT                   /translation="MRIDTSELCDIYLDQVDVVDPIFSSFGGVQAFYGKVTTVKCFETN
FT                   GLIEEILEENGEGRVLVIDGGGSIRRALIDAELARLAADNHWEGIIVYGAIRQLSELEN
FT                   IEIGIHALAPIPVSADESNYGESDIPVNFGGVTFFPEDYIYADLTGIILSQEPLDLDEL
FT                   NAE"
FT   gene            complement(570621..570971)
FT                   /locus_tag="Asuc_0517"
FT   CDS_pept        complement(570621..570971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0517"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: msu:MS0443
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73892"
FT                   /db_xref="GOA:A6VLP5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLP5"
FT                   /protein_id="ABR73892.1"
FT                   /translation="MSNIIKQLEEEQLKQNVPSFRPGDTLEVKVWVVEGAKRRLQAFEG
FT                   VVIAIRNRGLHSAFTLRKVSNGTGVERVFQTHSPVIDSITVKRKGAVRKAKLYYLRERS
FT                   GKSARIKERLGA"
FT   gene            complement(571005..571742)
FT                   /locus_tag="Asuc_0518"
FT   CDS_pept        complement(571005..571742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0518"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="TIGRFAM: tRNA (guanine-N1)-methyltransferase; PFAM:
FT                   tRNA (guanine-N1-)-methyltransferase; KEGG: msu:MS0442
FT                   tRNA-(guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73893"
FT                   /db_xref="GOA:A6VLP6"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLP6"
FT                   /protein_id="ABR73893.1"
FT                   /translation="MFIGIVTLFPEMFKAITEFGVTGRAVKQNLLQVRCYNPRDFTHDK
FT                   HKTVDDRPYGGGPGMLMMVQPLRDAIHSAKAEAGEGVKVIYLSPQGRKLEQSGVTELAQ
FT                   NKKLILVCGRYEGIDERLIQTEVDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQ
FT                   ASADEDSFAAGLLDCPHYTRPEELDGLTVPPVLMSGNHEQIRKWRLTQSLERTWLRRPE
FT                   LLEKLALTDEQKKILNQIKSETV"
FT   gene            complement(571790..572317)
FT                   /locus_tag="Asuc_0519"
FT   CDS_pept        complement(571790..572317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0519"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: msu:MS0441
FT                   RimM protein, required for 16S rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73894"
FT                   /db_xref="GOA:A6VLP7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLP7"
FT                   /protein_id="ABR73894.1"
FT                   /translation="MEQQRIEVVGKLGSTYGIRGWLRIYSSTEYAESIFDYQPWFLKIK
FT                   GQWQPAELESWKHHNHELIAKLKNVDDRDAAQALTNVEIGVDLSVFPKLEEGDYYWHDL
FT                   IGCQVVNLQGYTMGTVSEMMETGSNDVLVVRANVKDAFGKQERLIPFLYEKVVKRVDLT
FT                   TKTIEVDWDAGF"
FT   gene            complement(572348..572596)
FT                   /locus_tag="Asuc_0520"
FT   CDS_pept        complement(572348..572596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0520"
FT                   /product="ribosomal protein S16"
FT                   /note="PFAM: ribosomal protein S16; KEGG: pmu:PM1294a 30S
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73895"
FT                   /db_xref="GOA:A6VLP8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLP8"
FT                   /protein_id="ABR73895.1"
FT                   /translation="MVTIRLSRGGAKKRPFYQIVVADSRSPRDGRFIERVGFFNPLATG
FT                   KAERLRLDLDRVNAWVEKGASLSDRVSALVKEVQKAA"
FT   gene            complement(572771..574339)
FT                   /locus_tag="Asuc_0521"
FT   CDS_pept        complement(572771..574339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0521"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   hhe:HH0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73896"
FT                   /db_xref="GOA:A6VLP9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLP9"
FT                   /protein_id="ABR73896.1"
FT                   /translation="MTMNKIPVSVTMLVKNAEKYLRTVLTALADFDEIILLDNGSTDST
FT                   LAIAEQFENVKIHFHEFNGFGPMKNLAASFARHDWIINIDSDEVFPAELVEEIRRLDFN
FT                   DVNKVYAMLRINHYRGKPIKTCGWYPDYVKRLYNRTVVNFNDKQVHEGLDIPRNVELIK
FT                   LQNAFNHYSFESAVGLIDKMQQYTTLFAEQQKFRKRASVPSAISHGFSAFCKNYLLKRG
FT                   FMSGADGFVISFANACGAYYKYVKLAEANQTLTASLIVTTYNRPDALQLVLNSVSAQRV
FT                   LPDEVIVADDGSTQETKAVIDAFAARCPVPVKHAWQPDDGFRLAESRNRALSMATGDYI
FT                   VIIDGDMVMHPEFIADHKKAAKKGVYIQGGRIVLPEGKTAELLTAPDSYRALKWYEKGL
FT                   EKRFEKRFSAIHCPLLANLLLKKEKRHFYKNIRGCNMGFFREEALAINGFNNDFVGWGR
FT                   EDSEFVARFFNNGGKIATIKFAAIAYHLWHNEAPRAALPENDRLLANAMKSNVIRVENG
FT                   VAQIR"
FT   gene            574477..575004
FT                   /locus_tag="Asuc_0522"
FT   CDS_pept        574477..575004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0522"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: pmu:PM1191
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73897"
FT                   /db_xref="GOA:A6VLQ0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ0"
FT                   /protein_id="ABR73897.1"
FT                   /translation="MGLEIVPAGKELPDDIYVVIEIPANSDPIKYEVDKETGTLFVDRF
FT                   MATAMFYPANYGYVNHTLSLDGDPVDVLVPTPYPLQPGAVIRCRPVGVLKMTDESGQDA
FT                   KVIAVPHTKLSKEYDHIKDVNDLPALLKAQIQHFFESYKALEAGKWVKVDGWEGVESAR
FT                   KEILDSFERAKK"
FT   gene            575062..575820
FT                   /locus_tag="Asuc_0523"
FT   CDS_pept        575062..575820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0523"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: msu:MS0437 HtpX
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73898"
FT                   /db_xref="GOA:A6VLQ1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ1"
FT                   /protein_id="ABR73898.1"
FT                   /translation="MMKLLRKLAVLSFVAALVVGCASSAEINRQSASQYAQVVRQAKAK
FT                   KLVDTTSATAVRIKNVFNRMVPYATAENHTGERFDWEITVVKSNELNAWAMPGGKMMFY
FT                   TGLVDRLKLTDDEIAVVMGHEMAHALREHGKASHNVGIATGILGAVAEIGVSAALGADT
FT                   GGLASGTVDLMTNKPFSRSNETEADEIGLILMAKSGYNPQAAPGLWKKMQTAGGSNGAS
FT                   IFSTHPSDEFRQENLQRLLPEAMKYYKPRK"
FT   sig_peptide     575062..575136
FT                   /locus_tag="Asuc_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.673 at
FT                   residue 25"
FT   gene            complement(575877..576944)
FT                   /locus_tag="Asuc_0524"
FT   CDS_pept        complement(575877..576944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0524"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ngo:NGO2072 lipooligosaccharide glycosyl transferase G"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73899"
FT                   /db_xref="GOA:A6VLQ2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ2"
FT                   /protein_id="ABR73899.1"
FT                   /translation="MKVAINTLNFRRGGGVERYILDIINGFHQQNLRPRIYTGKADCSL
FT                   PENQWIDLIKANISFIPRKLRHRFLSSFVRKNRRDDEVIFSLFFLYCDIFVCGGNHQGY
FT                   LNALHKTPNCYERFIKIPYEYKVLKECQTVIAHSRLMKDELIKFYGVPAQKIQVVYPPA
FT                   DTQKFIPPPPRQRQLLRRKFGFADDEVIYLFPSTGHKRKGFELLKNFFNASDLPIKLVV
FT                   AGTPVENSRNVRSLGFRQDMPELYQAADFTIMASFYEPFGLVGLESVLSGTPIIFSENM
FT                   ACLEVFQNRFGFTFNRHDPGSLKSAVEKSVDLVKGGQARIENPKHCLNYDPELSTHIAR
FT                   LLEIAKTVKKTTALS"
FT   gene            complement(577022..577237)
FT                   /locus_tag="Asuc_0525"
FT   CDS_pept        complement(577022..577237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0525"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: msu:MS0448
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73900"
FT                   /db_xref="GOA:A6VLQ3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLQ3"
FT                   /protein_id="ABR73900.1"
FT                   /translation="MKQGIHPEYKEITATCSCGNVIKTRSTLGKDINLDVCGNCHPFYT
FT                   GKQRVVDTGGRVERFNKRFSIPGTKK"
FT   gene            complement(577383..578180)
FT                   /locus_tag="Asuc_0526"
FT   CDS_pept        complement(577383..578180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0526"
FT                   /product="glycosyl transferase family 25"
FT                   /note="PFAM: glycosyl transferase family 25; KEGG:
FT                   hso:HS_0638 Lob1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73901"
FT                   /db_xref="GOA:A6VLQ4"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ4"
FT                   /protein_id="ABR73901.1"
FT                   /translation="MQGKGADYGNQSINQSINILIINLKKSTQRRQFMQKQFDELQKCF
FT                   PDFHLNYQFFTGVNGNEEANHPLFKKYNSKKRLARKGQDMSLSQLGCFASHYLLLEKCV
FT                   QLNEPVIILEDDAILLDGFYDVLKYAPTVANYFEFFRLSNRSGGNNVKSAPLFQIPNTN
FT                   LIISQVYKGWANTTGYFVTPRAAKKFLTQMKEWIYNVDITMDRYWENKVHFCALLPNVV
FT                   RPQDEFLSQIQMNKTKRSISVKLKREIFAAYDRVNKCLFDLLH"
FT   gene            578181..580421
FT                   /locus_tag="Asuc_0527"
FT   CDS_pept        578181..580421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0527"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases; KEGG: msu:MS0449 primosomal protein N'
FT                   (replication factor Y) - superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73902"
FT                   /db_xref="GOA:A6VLQ5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ5"
FT                   /protein_id="ABR73902.1"
FT                   /translation="MVKIYFWNYKLKMKFVRVALAVPLMRFFDYLLPDGLSLEIGSRVV
FT                   VPFGRQKRVAIAVDFPLQSELPAEQLKQILAVLDEKTIFNAPLWSLLNWAAGYYQAPLG
FT                   EALFSALPVKLRNGESAVEKSKIFWKLTALGEQALTDGALNRAKKQLEAARSLILAPLE
FT                   KGNNPFAASIWSALKEKALITEFEQAVESVDWQKKLGELALTKTENRLTLNKQQALALS
FT                   RLLFQQGFQAFLLDGVTGSGKTEIYLQFIEETLKKNRQVLVLVPEIGLAPQTVRRFRAR
FT                   FNVEIDVLHSNLNDSQRLQVWRRAKNGQSAIVIGTRSALFTPFRDLGAILLDEEHEASF
FT                   KQQDGWRYHARDLAVVYAKQLDIPVVLGSATPSLESLHNVNQGKYTHIVLSQRAGQAKT
FT                   AESQLIDLKKQSVVNGLSGTLLRKMDEHLQKGNQVLLFLNRRGFAPVLLCHECGWMCCC
FT                   PHCDKPFTYHQRQRVMRCHHCASQRPIPMQCADCGSTHLITTGLGTEQLEQTLKERFPH
FT                   YGITRIDRDSTARKGTLESHLDDIKQGKSRILIGTQMLAKGHHFPDVTLVALINVDGSL
FT                   FSMDFRAEERLAQLYVQVAGRAGRAEKPGEVLLQTHYPEHPLLRRLLNDGYAAFAREAL
FT                   DMRRTMGLPPFSFQALFKAQSRQSAAAERLLTQIADYFQRWKQAKNQPHLQILGAMPAP
FT                   FAKKADQFRWQLLLQHPSRAWLQRALADFYRNWENKPSQVRLNLDVDPQDLT"
FT   gene            580563..581384
FT                   /locus_tag="Asuc_0528"
FT   CDS_pept        580563..581384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0528"
FT                   /product="cell division protein FtsN"
FT                   /note="TIGRFAM: cell division protein FtsN; PFAM:
FT                   Sporulation domain protein; KEGG: msu:MS0450 cell division
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73903"
FT                   /db_xref="GOA:A6VLQ6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ6"
FT                   /protein_id="ABR73903.1"
FT                   /translation="MAQRDYAARSTKKKKSAGLGKSVLLTIACVVVLGFALGLYFLTTK
FT                   APEPQSRELAVEQVKPKSQLPSRPEESWSYIKELERRTVPTDNSQASLEKVAQLSEKQK
FT                   EDLRRLEEAEKKAALERATKAAENGAQQTVPVTDATSVAATATSPAAGIADEAGAKAEA
FT                   EKRAVEQAKKEEERKKAELAKQQAAKKAETAKSNSAKASGGKFGLQCGAFNDRAKAEAL
FT                   QAKLAMTGLNARITESGKWNRVLVGPIGDRQAAAGAQQQAGSVASCVIIGM"
FT   gene            581553..582119
FT                   /locus_tag="Asuc_0529"
FT   CDS_pept        581553..582119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0529"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: msu:MS0453 AcrR
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73904"
FT                   /db_xref="GOA:A6VLQ7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ7"
FT                   /protein_id="ABR73904.1"
FT                   /translation="MHQSDKDMAEQILVATEQLIADRGLQNLSMQKIAKQAKISAGTIY
FT                   LYFESKDKLLEQLARRVFTLFNQELEKNYDEDVSYFEQYRTMWWNVWHYLLNNPIQLKN
FT                   MSQYWSLPTFIDICAELDQESHWAIFCQKAIAANEMCDLPIKVLFSLGLEHLVNLAKDK
FT                   IYFKLELADDVLENIIERSWRSLKK"
FT   gene            582147..583343
FT                   /locus_tag="Asuc_0530"
FT   CDS_pept        582147..583343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0530"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   msu:MS0454 AcrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73905"
FT                   /db_xref="GOA:A6VLQ8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ8"
FT                   /protein_id="ABR73905.1"
FT                   /translation="MSQLQTNKPKRSHTFFLKVGLAVAVLVFALVIGLNKFKEIMIGKA
FT                   IANMPETASPVTAMTVAPREWTPVINTTGLVRPNQGSMLSAQASGTIKKILVKSGQIVK
FT                   KGDVLVEFDNDVEVASLRAAEAQVPAARLTYQRYANLIKSQSVSQTELDNAKATLDQLV
FT                   ANVNSLKATIERRKIVAPYDGVTGIVQVNEGQYISTGAEIVRVEDVSSMKVDFSVSQND
FT                   LENLHIGQKVTATSDARLGETFAAKVTAIEPAINKSTGLIDVQATFEPEDGKKLLSGMF
FT                   TRLRLALPTEREQIVIPQVAITYNMYGEMAYVLRPLSDEDKEKLKDNENLSKMYRAQQI
FT                   TVFTKDRQGIYAQLKGDEVKAGDIIVTGGQQRLGNGSLVTVADKEGVGTVQPATKTNL"
FT   gene            583360..586449
FT                   /locus_tag="Asuc_0531"
FT   CDS_pept        583360..586449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0531"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   msu:MS0456 cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73906"
FT                   /db_xref="GOA:A6VLQ9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLQ9"
FT                   /protein_id="ABR73906.1"
FT                   /translation="MKFTDIFIKRPVMAICISLLIVILGLQAISKLSVREYPKMTTTVI
FT                   TVSTTYAGADAGLIQAFVTSKLEEAIAQADNIDYLSSSSAPSSSTITVKMKLNTDPASA
FT                   LADVLSKVQSVRSELPSGIEDPTLTSSTGGSGIMYISFRSDKLHPSQVTDYIERVVKPQ
FT                   LFTVEGVAKVNVYGAAEYAMRIWLDPQKLAAQNLSASQIATALANNNVQTAAGNDKGYF
FT                   NVYRNKVETTTNTVEDLGNLIVYSDGEKLVRLRDVADVELNKESDNTRAAANGSDAVVL
FT                   GIEPTSNANPLDVADKIRPLYDTIKKNLPNSIESDILYDRTVAINSSINDVIHTIVEAV
FT                   VIVLVVIMMFIGSLRAILIPIITIPISLIGVVFLLQALDFSLNLMTLLAMILAIGLVVD
FT                   DAIVVLENVDRHIKEGETPFRAAIIGTREIAVPVISMTIALVAVYSPMALMGGITGTLF
FT                   KEFALTLAGAVFISGIIALTLSPMMSGKMLKHESSKFEEKVNRTLTKITNIYTYILGLV
FT                   MQTRKAILLFAVIIFATLPVLFTALSSELTPTEDKGGFLGMVTAPSNVNVDYVQQATKP
FT                   YEEILDNTPEKQYSQVIAGAPNTNQALVITTLKDWSERSRTQAEVMAELTAKAAEIPEV
FT                   SISAFAFPEIETGEQGPPVVIVLSSPGSTKELAQVAETFLDKIRKSGKFVYSNLTLKYD
FT                   VAQMRIKVDKEKAGTYGITMQQIASTLGYYLSEATITRVDIDGRAYKVISQVKRENRLS
FT                   PESLKNYYISASNGESVPLSSLLDVTLEPQPYSLPRFSQLNAAEIQMVPSPTTTTGDAI
FT                   AWLQEAAKDLPQGYSYDWKGEARQLVQEGNALATTFILAVLIIFLVLAIQFESIRDPMV
FT                   ILVSVPLAISGALLVLNLLSFFGVTGVTLNIYSEVGLITLVGLITKHGILMCEVAKEEQ
FT                   LNHGKNKMEAIMTAAQLRLRPILMTTAAMIAGLVPLLYASGAGAVMRFSMGVVVVAGLA
FT                   IGTLFTLFVLPVIYTYLGSDHEPLPEFDENAPRISQGESH"
FT   sig_peptide     583360..583446
FT                   /locus_tag="Asuc_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.584 at
FT                   residue 29"
FT   gene            complement(586591..587175)
FT                   /locus_tag="Asuc_0532"
FT   CDS_pept        complement(586591..587175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0532"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG: hin:HI1181
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73907"
FT                   /db_xref="GOA:A6VLR0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLR0"
FT                   /protein_id="ABR73907.1"
FT                   /translation="MYLDQIKTELLEAQDVLQKFIADENNIKLIQQAALLISDSFKQGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYDYVFSRY
FT                   VEAVGKPGDVLFGLSTSGNSKNVLNAIQAAKQKDMKVIAMTGKDGGEMAGLADVEIRVP
FT                   HFRYADRIQEIHIKVIHILMMLIEFEMAKDV"
FT   gene            complement(587362..587622)
FT                   /locus_tag="Asuc_0533"
FT   CDS_pept        complement(587362..587622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0533"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: msu:MS0247 NapF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73908"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLR1"
FT                   /protein_id="ABR73908.1"
FT                   /translation="MALLITDKCTNCDMCLPECPNDAISVGDEIYVIDPALCTECVGHY
FT                   DTPTCQKVCPITKCIIADPQHVESNDELWEKFVLIHHADKL"
FT   gene            587690..588520
FT                   /locus_tag="Asuc_0534"
FT   CDS_pept        587690..588520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0534"
FT                   /product="ribonuclease T2"
FT                   /note="PFAM: ribonuclease T2; KEGG: hit:NTHI0652 probable
FT                   ribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73909"
FT                   /db_xref="GOA:A6VLR2"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLR2"
FT                   /protein_id="ABR73909.1"
FT                   /translation="MNQKYLKWIRIGAVALLAAYFYFSQRLIPNETTPENLPQQQQKQD
FT                   KTRQKTQSAVRKNDVFSAADSIDSNDATTNRRQTDTRKQANVSADYDYNMRDDAIGQNA
FT                   HAPVDYYMLVLSWSPAFCDSQTKKFGGNLPPSVQQQCGMQRQYGWVIHGLWPQNRAARG
FT                   TADHPRFCRGDLPPVDSRVIEKYLSDSPSAVLLQGEWEKHGACAFQSADAYFQKQRQLF
FT                   RSLTLPTQNMDRKALFRWMKQHNPPLKNVFMQASRQELFICYDLNWNAINCPSR"
FT   gene            588650..589825
FT                   /locus_tag="Asuc_0535"
FT   CDS_pept        588650..589825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0535"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: msu:MS0245
FT                   3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73910"
FT                   /db_xref="GOA:A6VLR3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLR3"
FT                   /protein_id="ABR73910.1"
FT                   /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVASDARIRATIPTLK
FT                   LALEKGAKVMVTSHLGRPTEGEFKPEDSLQPVVDYLNNAELGVPVRLVQNYLDGVDVQA
FT                   GEIVVLENVRVNKGEKKNDPELGKKYAALCDVFVMDAFGTAHRAQASTYGVAEYAPVAC
FT                   AGPLLAAELDALGKALKEPQRPMLAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTF
FT                   IAAEGHNVGKSLYEEDLIPEAKRLAAATNIPVPVDVRVGTEFSESAPATEKSVTEVRAD
FT                   ESIFDIGDKSAEELAKIIKSAKTILWNGPVGVFEFPNFRKGTEVVSNAIAEATANGAFS
FT                   IAGGGDTLAAIDLFGIKDKISYISTGGGAFLEFVEGKVLPAVEILEKRANG"
FT   gene            589929..591008
FT                   /locus_tag="Asuc_0536"
FT   CDS_pept        589929..591008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0536"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase class-II; KEGG: msu:MS0244
FT                   fructose/tagatose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73911"
FT                   /db_xref="GOA:A6VLR4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLR4"
FT                   /protein_id="ABR73911.1"
FT                   /translation="MAKLLDIVKPGVLTGDDVSKVFAYAKENGFAIPAVNCVGSDSVNA
FT                   VLETAARVKAPVIIQFSNGGASFYAGKGVKPASGIRPDVLGAIAGAKHVHTLAAEYGVP
FT                   VILHTDHCAKKLLPWVDGLLDAGEKHFAETGKPLFSSHMLDLSEEPMEENMAICRKYLE
FT                   RMDKMGMTLEIEIGITGGEEDGVDNSDVDESRLYTQPEDVLYVYDQLNPVSSRFTVAAA
FT                   FGNVHGVYKPGNVKLKPSILGASQEFVAKERNLAAKPINFVFHGGSGSSTEEIREAIGY
FT                   GAIKMNIDTDTQWAAWDGILQFYKANEAYLQGQLGNPEGPDAPNKKYYDPRVWLRKMEE
FT                   SMSKRLEKSFQDLNCVDVL"
FT   gene            591086..592333
FT                   /locus_tag="Asuc_0537"
FT   CDS_pept        591086..592333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0537"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: msu:MS0243 RfaL
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73912"
FT                   /db_xref="GOA:A6VLR5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLR5"
FT                   /protein_id="ABR73912.1"
FT                   /translation="MQLLRFKKLPIWLNVLTAAFILTVFVLKPVHNAAFIALVLLGLAY
FT                   SFTLLKNKQSFALTKEDKWFCYAVLFYIIVRLITFGFHDDRWRHVDVVSQLLAFLPTYF
FT                   LLRKFKICLNALFIAIPCSAVIGFVVAAYDRLYLGLRLPFGNMIHIQAGDMALSLGWLS
FT                   FPLFFYALKKKQKILTALCLLGILGGLGASVLSTARGGWISLPPVLLVLIYIFRQQLSK
FT                   KFLAGLCTLVVVGAVVLFMIPQTQVSQRIHQAHSDIVNYFEKNNPNTSIGARFEMWKGA
FT                   LMIAQEHPLAGVGEDAFKTHFKRYATEGKMAKSASIYAHAHNLYLDSLAKNGIFGLLSL
FT                   LLVFFVPLRKFWRTAKSADLNQKTIGALGVVHVVAVLFYGMSEAFFSLHATQMFYFFLA
FT                   FVLYSMTESAQTESPK"
FT   sig_peptide     591086..591184
FT                   /locus_tag="Asuc_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.525 at
FT                   residue 33"
FT   gene            complement(592395..592739)
FT                   /locus_tag="Asuc_0538"
FT   CDS_pept        complement(592395..592739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0538"
FT                   /product="protein of unknown function DUF469"
FT                   /note="PFAM: protein of unknown function DUF469; KEGG:
FT                   msu:MS0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73913"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLR6"
FT                   /protein_id="ABR73913.1"
FT                   /translation="MAIKRNARQRKKMHLAEFQELGFLVNWQFAEGTAIETVDEVVDRF
FT                   IRELIQPNGLAYEGSGYLRWEGLVCLEKLGKCDESHRKLVKDWLEANGVQQVEISELFD
FT                   IWWDYPVKNA"
FT   gene            complement(592763..593521)
FT                   /locus_tag="Asuc_0539"
FT   CDS_pept        complement(592763..593521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0539"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase;
FT                   PFAM: putative methyltransferase; KEGG: pmu:PM1317 tRNA
FT                   (guanine-N7-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73914"
FT                   /db_xref="GOA:A6VLR7"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLR7"
FT                   /protein_id="ABR73914.1"
FT                   /translation="MTELKKTFADQKRKTVETAEFTEDGRYKRKIRSFVLRTGRLSEYQ
FT                   RQMMNDNWSNYGLDYQTEPFDFPAIYGNHNPVILEIGFGMGKSLVEMAQQNPDKNYLGI
FT                   EVHTPGVGACLAYALEKGIKNLRVICHDATEILRDCIADRSLGGLQLFFPDPWHKAKHH
FT                   KRRIVQPQFVKTVTQKLTSGGFIHFATDWQNYAEHMLNVLQSVQSAVGIRNISETGDFI
FT                   PRPDFRPLTKFEQRGQKLGHGIWDLYFIKN"
FT   gene            593663..594784
FT                   /locus_tag="Asuc_0540"
FT   CDS_pept        593663..594784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0540"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD family protein; SMART: iron-sulfur cluster loop;
FT                   KEGG: hso:HS_1667 A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73915"
FT                   /db_xref="GOA:A6VLR8"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLR8"
FT                   /protein_id="ABR73915.1"
FT                   /translation="MQAQSFSSSLFARAVLAWFEQFGRKHLPWQQHKTLYGVWLSEVML
FT                   QQTQVATVIPYFERFIETFPNVTALADASQDEVLHLWMGLGYYARARNLHKAAQQIRDE
FT                   FRGEFPTEFEQVWSLAGIGRSTAGAILSSVLGQPYPILDGNVKRVLARYFLVEGWAGDK
FT                   KVEDRLWGLSAEVTPRDRTADFNQAMMDLGALVCTRSKPKCALCPLREKCGARLTEAWK
FT                   DYPAKKPKKSLPERTGYFLLLEHEGKIALEQRPSTGLWGGLYCFPQFDSKSELLDYLRQ
FT                   QGVTTYREWTGFRHTFSHFHLDIYPIYAELTPKKRDEDRSDWKKIEENPREYQSSVSSA
FT                   VKYWYDLQNPDQIGLATPVKNLLLQFKKGHSYG"
FT   gene            594777..595049
FT                   /locus_tag="Asuc_0541"
FT   CDS_pept        594777..595049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0541"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="PFAM: Fe(II) trafficking protein YggX; KEGG:
FT                   hit:NTHI0920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73916"
FT                   /db_xref="GOA:A6VLR9"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLR9"
FT                   /protein_id="ABR73916.1"
FT                   /translation="MARTVFCEHLKQEAEGLDFQLYPGELGKRIFEHISKQAWGDWLKK
FT                   QTMLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYVPPEK"
FT   gene            595059..596135
FT                   /locus_tag="Asuc_0542"
FT   CDS_pept        595059..596135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0542"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   msu:MS0315 soluble lytic murein transglycosylase and
FT                   related regulatory proteins (some contain LysM/invasin
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73917"
FT                   /db_xref="GOA:A6VLS0"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLS0"
FT                   /protein_id="ABR73917.1"
FT                   /translation="MKITLKKLLILAIVPFLYACSSDRANYDDVFAKDTHGLDLLTGQF
FT                   SQNIDQIWGVNELLVASRKDYVKYNDSYYTRSHISFDEGMITIETLADVNRLHSAIVHT
FT                   LLMGSDAKGIDLFASGDTPISSRPFLVGQVVNNFGQSITNVNVANNFATYLIQNKLQQR
FT                   RLNNGRTVQFVSIQMIANHVNIRARKYLPFVRKASRQYGIDESLILGIMQTESSFNPYA
FT                   ISYANAIGLMQVVPHSAGRDIFKMKGRSGQPSKSYLFDPAKNVDAGTSYLWLLRNEYLA
FT                   GIQNPTSMRYAMISAYNSGAGAVLRVFSDDPDEAIYIINRMQPEQVYRILTTGHPSAQA
FT                   RNYLVKVDKAQRSYRRVR"
FT   sig_peptide     595059..595118
FT                   /locus_tag="Asuc_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.408 at
FT                   residue 20"
FT   gene            596425..596500
FT                   /locus_tag="Asuc_R0023"
FT                   /note="tRNA-Phe1"
FT   tRNA            596425..596500
FT                   /locus_tag="Asuc_R0023"
FT                   /product="tRNA-Phe"
FT   gene            596506..596581
FT                   /locus_tag="Asuc_R0024"
FT                   /note="tRNA-Asn1"
FT   tRNA            596506..596581
FT                   /locus_tag="Asuc_R0024"
FT                   /product="tRNA-Asn"
FT   gene            complement(596732..597226)
FT                   /locus_tag="Asuc_0543"
FT   CDS_pept        complement(596732..597226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0543"
FT                   /product="YfbU family protein"
FT                   /note="PFAM: YfbU family protein; KEGG: pmu:PM1500
FT                   hypothetical E.coli"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73918"
FT                   /db_xref="InterPro:IPR005587"
FT                   /db_xref="InterPro:IPR023145"
FT                   /db_xref="InterPro:IPR023146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLS1"
FT                   /protein_id="ABR73918.1"
FT                   /translation="MEMTTTQRLILANQYKLMGLLDPANAKTYARSEAIVRGGFSLELK
FT                   ALDNEFNNLSVEECQTVLDTLEMYKALQVSYNNLTDKAEVTEHRLKFAGYCAVREKKYL
FT                   NYLRFITGTEGKYQEFMHCEHGCDSQTPMWDKYTKMLDVWRNCPHGYHLSIQEIQKILN
FT                   A"
FT   gene            complement(597238..597987)
FT                   /locus_tag="Asuc_0544"
FT   CDS_pept        complement(597238..597987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0544"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: msu:MS2239
FT                   surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73919"
FT                   /db_xref="GOA:A6VLS2"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLS2"
FT                   /protein_id="ABR73919.1"
FT                   /translation="MKKTLLLITALLGAVTLTGCSNTLDPVTGERNDPLQGFNRTMWDF
FT                   NYKVLDPYLLKPAAKGWDALPAPLTTGLSNVADNLDEPVSFVNRLWEGEGQKAMVHLNR
FT                   FIINSTFGLGGLIDWASYSDPLKIEHQRTFGDTLGSYGVNPGTYIVLPVYNATTPRELT
FT                   GAAVDSAYTYPFWHWVGGAWSLAKYGVQAVDNRAKAMDKEALLEQATDPYITFREAYYQ
FT                   NLEYRATDGNVKAKESGLSEEDLNSID"
FT   sig_peptide     complement(597916..597987)
FT                   /locus_tag="Asuc_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.537 at
FT                   residue 24"
FT   gene            598347..599474
FT                   /locus_tag="Asuc_0545"
FT   CDS_pept        598347..599474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0545"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: msu:MS2237
FT                   carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73920"
FT                   /db_xref="GOA:A6VLS3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLS3"
FT                   /protein_id="ABR73920.1"
FT                   /translation="MSEPAILVLADGSVFHGTSIGAAGHTIGEVVFNTAMTGYQEILTD
FT                   PSYFRQIVTLTYPHIGNTGTNVEDLESDGVYAAGLIIRDLPMIHSNFRSNQSLSDYLKD
FT                   NNVVAIADIDTRRLTRLLRDKGAMAGCIMTGEVDETKALELALSFGSMAGKDLAQEVTT
FT                   KETYQWTQGEWQLGKGYVEQQQAKFNVVAYDFGVKRNILRMLAERGCHVTVVPAKTSAK
FT                   KVLALNPDGVFLSNGPGDPEPCDYAINAIKEILATKKPVFGICLGHQLLGLASGGKTKK
FT                   MAFGHHGANHPVQDLANQKVMITSQNHGFEVDEYSLPKNVRVTHRSLFDNSVQGIELTD
FT                   QAAYSFQGHPEASPGPHDVAYLFDKFIDAMRAAKA"
FT   gene            599586..602795
FT                   /locus_tag="Asuc_0546"
FT   CDS_pept        599586..602795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0546"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain oligomerisation;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   MGS domain protein; KEGG: pmu:PM1505 caramoylphosphate
FT                   synthetase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73921"
FT                   /db_xref="GOA:A6VLS4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLS4"
FT                   /protein_id="ABR73921.1"
FT                   /translation="MPKRNDIKTILIIGAGPIVIGQACEFDYSGAQACKALREEGYKVV
FT                   LVNSNPATIMTDPDMADVTYIEPIQWQIVEKIIEKERPDAILPTMGGQTALNCALDLSK
FT                   NGVLKKYGVELIGATEDAIDKAEDRGRFKEAMAKIGLNTPKSFVCHTFDEAWKAQEKVG
FT                   FPTLIRPSFTMGGSGGGIAYNRDEFQAICERGFDASPTHELLIEQSVLGWKEYEMEVVR
FT                   DKADNCIIVCSIENFDPMGVHTGDSITVAPAQTLTDKEYQIMRNASLAVLREIGVDTGG
FT                   SNVQFAVNPANGEMIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLNELRNDIT
FT                   GGLIPASFEPSIDYVVTKVPRFAFEKFPQADDRLTTQMKSVGEVMAMGRTFQESLQKAL
FT                   RGLETGICGFNLLSEEPEKIRTELGNPGPNRILYVADAFGAGFSLEEVHHYSKIDPWFL
FT                   IQVQDLVLEELALEKRSFAELDYAELRRLKRKGFSDKRIAQLTNVSEDQVRAKRHELNL
FT                   HPVYKRVDTCAGEFKSDTAYLYSTYEEECEANPSDRKKVMILGGGPNRIGQGIEFDYCC
FT                   VHAALALRESGFETIMVNCNPETVSTDFDTSDRLYFEPLTLEDVLEIVHTERPWGVIVH
FT                   YGGQTPLKLANALHDNGVNIIGTSADSIDAAEDRERFQKILQDLNLKQPNNRTARNAQE
FT                   AVTLADEVGYPLVVRPSYVLGGRAMQIVYNVDELNKYMREAVSVSNDSPILLDHFLNNA
FT                   IEVDVDCICDGTDVVMGGIMQHIEQAGIHSGDSACSLPPYSLPKGVQDEIRRQTAAMAR
FT                   ALNVVGLMNVQFAVQNDVIFVLEVNPRASRTVPFVSKATGRPLAKIAARVMAGINLKEQ
FT                   GITGEIIPQYCSVKEAVFPFIKFPGVDTILGPEMRSTGEVMGVGTTFSEAFLKAQLGAN
FT                   ERIPKTGKVFLSVDDADKERLLPVARTLQEQGYGLCATMGTAKFLRENGVTTQIVNKVR
FT                   EGRPNIVDAIKNGEIAMVINTSGSLPESIADSHSIRHSALQQRVFLQTTMAAAEALAEG
FT                   VKSLDGCDVYSVQSLHAKLLA"
FT   gene            602893..604257
FT                   /locus_tag="Asuc_0547"
FT   CDS_pept        602893..604257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0547"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: msu:MS1949
FT                   N-acetylglucosamine-1-phosphate uridyltransferase (contains
FT                   nucleotidyltransferase and I-patch acetyltransferase
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73922"
FT                   /db_xref="GOA:A6VLS5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLS5"
FT                   /protein_id="ABR73922.1"
FT                   /translation="MSKLSVVILAAGKGTRMYSDLPKVLHKVAGKPMVKHVIDTAKQLS
FT                   AEQIHLIYGHGADLLKERLADEPVNWVFQAEQLGTGHAMQQAAPFFKDDENIVMLYGDA
FT                   PLITKETLERLVAAKPENGIALLTVELENPTGYGRIIRENGSVVAIVEQKDATPEQLKI
FT                   TEVNTGVMVSDGASFKKWLARLDNDNAQGEYYMTDVIGLANQDGFKVAAVTADDMMEVE
FT                   GANNRLQLAALERYFQRKQATALLLAGVSLADPERFDLRGELEHGKDVEIDVNVIIEGK
FT                   VKLGNGVKIGAGCVLKNAIIGDNTEIKPYSVLEDSSVGEQAAIGPFSRLRPGAELAAET
FT                   HVGNFVEIKKAVVGKGTKVNHLTYVGDAEIGSGCNIGAGVITCNYDGANKFKTLIGDNV
FT                   FVGSDVQLVAPVKVNNGATIGAGSTITKDVAAGELVTTRVPQRHTADWERPSKKK"
FT   gene            complement(604441..606477)
FT                   /locus_tag="Asuc_0548"
FT   CDS_pept        complement(604441..606477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0548"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: msu:MS0227 choline-glycine
FT                   betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73923"
FT                   /db_xref="GOA:A6VLS6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLS6"
FT                   /protein_id="ABR73923.1"
FT                   /translation="MSVLQQFRATSTLKSPIFVPTVIFVAIVAIFCSVFPEQAQTTLNA
FT                   VKLSVFANFSWFYIFAGSIFFLFLMFLCVSSLGGIRLGADTDEPEFSFPSWIAMLFAAG
FT                   MGIGLMYFGVAEPVLHYLQPLEQGLTESERMKDAMMMTFYHWGIHAWAIYAVIALALAY
FT                   FGFRYKLPLTVRSGFYPLMKNRISNFWGHVIDVVALCSTIFGLTTTLGYGAMQVNAGFN
FT                   NLGLLDGNSFNVLAMIVIVAMTLAVISAISGVGKGVKILSEINLVFAGLLLVFVITAGP
FT                   TLLLFSGLTENLGYYFSSLLEVSFRTFAYEPENQEWLSNWTVLYWAWWASWAPFVGMFI
FT                   AKISKGRTIREFVLGVLFVPSLFNILWMTSFGGSAIWVDQQTNGALAAISSNTEALLFG
FT                   FFDQLPFGIIASVIAVIIISIFFVTSADSGIFVLNTIASQGEEKAPKWQSILWGILLTV
FT                   LGLSLLYSGGLASLQTMTLIIALPFMAIMIALCFGLWKGLMVDSQYSSKAFSQGSATWT
FT                   SGDWKVRLEKIVNPTNRKDIRRFLIKTARPAFKELVEEFETHDLTARMNFIDGKNPKIE
FT                   FEVVKENLRNFLYGIECQSRELSDLVVEDGNVPNMDENKIYEPITYFFDGRQGYDVQYM
FT                   TKDELIADVLKQYERFMNLAMDDSHDLMTADVENMGESTDPEQ"
FT   sig_peptide     complement(606358..606477)
FT                   /locus_tag="Asuc_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.759 at
FT                   residue 40"
FT   gene            606927..607967
FT                   /locus_tag="Asuc_0549"
FT   CDS_pept        606927..607967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0549"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   pmu:PM0652 hypothetical E.coli"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73924"
FT                   /db_xref="GOA:A6VLS7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLS7"
FT                   /protein_id="ABR73924.1"
FT                   /translation="MNTLNLAIAGSGYSARLFHVPFFKADPRFNIKKFFERSTERGKEW
FT                   VADAEIVHDYAQLLTPDIDLIVITTPNQTHYDMVKSALSAGKHVLVEKPLVATSSEAME
FT                   LAELADKQNVVLYVYQNRRWDSHILAAQQILAQGLVGEPVDCEIRIERFAKTKNPKAWK
FT                   ETGDAGTGLVYDLGVHLIDQAVCLFGKPQAVFADIRYQHEGALVDDNFDIHLYYDGGLK
FT                   VSVMASKYAREPAPAFSLHGKLGSYVKRGVDIQEARLAKGIVPTGDWYREAEELWGVLH
FT                   TEIEGEIVCKPYPNINVSYQGLIDNLYDAVVNDAAPIVTVEQVAFVLHIIEKAFESAWQ
FT                   GKKLAL"
FT   gene            608065..608682
FT                   /locus_tag="Asuc_0550"
FT   CDS_pept        608065..608682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0550"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   msu:MS0257 Gst protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73925"
FT                   /db_xref="GOA:A6VLS8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLS8"
FT                   /protein_id="ABR73925.1"
FT                   /translation="MKLWYSTTSPFARKVLITLKYQQLEGKTELLKIGSSFDPNSPHNR
FT                   DNPLGRVPALQRNCGNWLFGSLLICEYLDQKGHRPKLIPESGKPRWAALALHNLADGIM
FT                   ENTMPMTAERMFRPENEWWRSRHEQLMARNIRSFSQLEKAIEPFGTELNIGTLTAVCLI
FT                   DWWQFRADTLGYNLAEHFPNLTAWTSEMNGKYEVLAETKPTN"
FT   gene            complement(608737..609648)
FT                   /locus_tag="Asuc_0551"
FT   CDS_pept        complement(608737..609648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0551"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: sab:SAB0109
FT                   probable cation-efflux system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73926"
FT                   /db_xref="GOA:A6VLS9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLS9"
FT                   /protein_id="ABR73926.1"
FT                   /translation="MSDIDFHYHHAHHYKIQHYSRKTLWLSLVLTFIFALVELAGGMIS
FT                   GSLALISDSFHMFSDVLALTLSMIAIYYSAKQPTDKFTYGYVRVEIIAAFLNGAALVFI
FT                   ALGVAFEGIRRLLHPTPVDFRSMLAVASIGLLINILLTLMLMNSLKHEKNLNIQSAFWH
FT                   FFGDLLNSVGILVAALLIYWTGIIIIDAIASLVISIIIFWGGYKICRRAGIILMEAVPP
FT                   ELKTTAIHQSVLAIPNVKEIHEFHLWSIADGLYSLSFHVILERYRGVNDYELIKNISNM
FT                   LKHKYHIEHVTIQIENPQVNAH"
FT   gene            complement(609738..610607)
FT                   /locus_tag="Asuc_0552"
FT   CDS_pept        complement(609738..610607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0552"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: nmc:NMC1504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73927"
FT                   /db_xref="GOA:A6VLT0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT0"
FT                   /protein_id="ABR73927.1"
FT                   /translation="MQQINTREVGWIGLGQMGEPMAAHLLEHGVKVGVYNRTAEKCQNV
FT                   AAKGASVYSSVLELVKAYDVIFVMVADFPVIESLLSEEVLTALKGKLVVNMSTVSPTQN
FT                   QQLEFLLAKHGAEFIEAPVSGSSKVAEAGKLLVLAAGKEEIVEQLKPLFAAFSTQTFYY
FT                   GEVGKAGGVKLMINSLLGIFIQAYGEALLFAEQFGIPKDQVIEMISGSFMNSQIFQAKV
FT                   PMYRQNDFSPAFMMKHMTKDFNLAKSEIAKMGKAFPLIQQATVSYNQANQSGLSEVDMA
FT                   AIYQYLAK"
FT   gene            complement(610970..612112)
FT                   /locus_tag="Asuc_0553"
FT   CDS_pept        complement(610970..612112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0553"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   msu:MS2097 NemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73928"
FT                   /db_xref="GOA:A6VLT1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT1"
FT                   /protein_id="ABR73928.1"
FT                   /translation="MNPQFNPLFQSYTLNNQVEIKNRLVVAPMTHFGSNPDGTLGEAER
FT                   EFISNRAQDMGMFILAATLVQDGGKAFYGQPEAVSAEQLPSLKATADIIKAQGAKAILQ
FT                   LHHGGKLAVTELLNGKDKISASADEASGTRAATAEEIHALIDAFAHAADLAVQAGFDGV
FT                   EIHGANNYLIQQFYSGHSNRRTDEWGGSREKRMRFPLAIVDRVLEVKAKHGKDDFIVGY
FT                   RFSPEEPEELGLTMEDTFALIDALKGKALQYLHISLHEFYKKARRGADSNAFRMQLVHD
FT                   RIGGKLPLIGVGNLFTAEQILQAYNTGWAEFIALGKTVMINPTIATLIKQGKEAEIVTE
FT                   LDPNKADQYGIKGLLWDLCVKGGAWLPPLKGDQNWHAVDI"
FT   gene            612381..613406
FT                   /locus_tag="Asuc_0554"
FT   CDS_pept        612381..613406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0554"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /note="TIGRFAM: lipoyltransferase and lipoate-protein
FT                   ligase; PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   msu:MS1058 lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73929"
FT                   /db_xref="GOA:A6VLT2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT2"
FT                   /protein_id="ABR73929.1"
FT                   /translation="MYFVSANNEITDASLNIALETYLVENRLVDEPILLFYINAPSIII
FT                   GRHQNTVAEVNQPYLEQKHIQVVRRMSGGGAVYHDSGNLNFCFIQDNQGGIGDFAGFTK
FT                   PIIQALHQLGATGAELKGRNDLLIDGKKFSGNAMYVKGRRMTAHGTILFDSDLEEVTRA
FT                   LKPRKEKIQSHGIQSIRKRITNIKPYLAAEYQALNTFEFRDRLLLQIFGVAKREDVKEY
FT                   VLTDEEWQKVYKLREERFANWDWNYGKSPEFTLEYAHKFPAGLVEYKLNVEQGHIKAIR
FT                   IYGDFFGMGEMAELEQALTGVKYEKNAVLAIFERMNVKHYFGDIAADALAELLVNGVYE
FT                   G"
FT   gene            complement(613532..613607)
FT                   /locus_tag="Asuc_R0025"
FT                   /note="tRNA-Ala2"
FT   tRNA            complement(613532..613607)
FT                   /locus_tag="Asuc_R0025"
FT                   /product="tRNA-Ala"
FT   gene            complement(613689..615131)
FT                   /locus_tag="Asuc_0555"
FT   CDS_pept        complement(613689..615131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0555"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: msu:MS0490
FT                   glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73930"
FT                   /db_xref="GOA:A6VLT3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLT3"
FT                   /protein_id="ABR73930.1"
FT                   /translation="MKLEPLFDLDPNVTVRTRFAPSPTGYLHVGGARTALYSWLFAKHH
FT                   HGEFVLRIEDTDLERSTPEATAAIIEGMEWLNLAWEHGPYFQTKRFTRYNQVIDQMIEQ
FT                   GLAYRCYCTKERLEELRHSQEANKEKPRYDRHCLHDHSHSPDEPHVVRFKNPQEGSVIF
FT                   DDAVRGRIEISNSELDDLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQI
FT                   NILNALGAPIPTYAHVSMINGDDGQKLSKRHGAVSVMQYRDDGYLPEALVNYLVRLGWG
FT                   HGDQEIFSREEMINLFELEHVSKSASAFNTEKLQWLNQHYMRELPADYVANHLAWQYRD
FT                   LGIDTANGPALTDIVSMLAERSKTLREMALSSRYFFEEFETFDETAAKKHLKAAAVQPL
FT                   EKVKEKLTALSVWDAHSTHEAIEQTAADLDVGMGKVGMPLRVAVTGAGQSPSMDVTLAA
FT                   IGRERVLARIDKAIAFIKAKAA"
FT   gene            615299..615374
FT                   /locus_tag="Asuc_R0026"
FT                   /note="tRNA-Val1"
FT   tRNA            615299..615374
FT                   /locus_tag="Asuc_R0026"
FT                   /product="tRNA-Val"
FT   gene            615426..615501
FT                   /locus_tag="Asuc_R0027"
FT                   /note="tRNA-Val2"
FT   tRNA            615426..615501
FT                   /locus_tag="Asuc_R0027"
FT                   /product="tRNA-Val"
FT   gene            615616..615691
FT                   /locus_tag="Asuc_R0028"
FT                   /note="tRNA-Val3"
FT   tRNA            615616..615691
FT                   /locus_tag="Asuc_R0028"
FT                   /product="tRNA-Val"
FT   gene            615853..617757
FT                   /locus_tag="Asuc_0556"
FT   CDS_pept        615853..617757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0556"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: vfi:VF0131 phosphoglycerol
FT                   transferase MdoB and related proteins, alkaline phosphatase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73931"
FT                   /db_xref="GOA:A6VLT4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT4"
FT                   /protein_id="ABR73931.1"
FT                   /translation="MMNAFIPRDVRRSVQYQSALSRMLKRGAQFDAKVIAIILAPFFLF
FT                   GAASFSFLSVNSTALIWSMYVFVFAFALIGIVVGNFYYFKTYNNYYDMFMFGLMEDDTQ
FT                   AVLKNIYDDYPVITGFSAVFALAFIPGWLTHYALINWQPDLNPWWSSLLFIGTLCILVF
FT                   FARGTIHSTPLGKNHAQVASLAVINKLVPNGVIAMEWAFGDRKRNIRFEPVDLSEGKAL
FT                   MQRVFGTESLIDRTPHNDALAALKPNVFLAVMESFGTNYLLSDDPQSNDLLGNFRPHFE
FT                   RDMVFKRFISDYDGTAPTLASLYFYSPIQNISQSSAQQTALPYSPFLTYKRQGYRTIFI
FT                   TSGGMMWRNFGNYLPLQGVDELYDQNDIIEAFPEAKSSLSYWGIADEYALALAEKLLRE
FT                   AQEPLFINFLSITNHPPYDVPPHYQAKRINPAVLDGKFGSEQENRKSLTTYQYANNALG
FT                   DFITNLNKSENGKNTVVAVTGDHHVRCVRFEAPKENFMAKGVPFYLRVPEAVKYAVPLR
FT                   FEPNRLGSHKDIMPTLYALSLSDAEYWNLGGRNLLAQQDDEKYAFAVNESLWADADGVV
FT                   EGVADSGFQFPWQNATALYPDNLWVNPPVPLPESKRQHIQAYRKLLHWQINYLVAGEK"
FT   gene            617785..621231
FT                   /locus_tag="Asuc_0557"
FT   CDS_pept        617785..621231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0557"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   helicase domain protein; transcription factor CarD; TRCF
FT                   domain protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases; KEGG: msu:MS0216 transcription-repair coupling
FT                   factor - superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73932"
FT                   /db_xref="GOA:A6VLT5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT5"
FT                   /protein_id="ABR73932.1"
FT                   /translation="MTTKYFTLDIPTQSNDHKILGNVLAGADCLAIAEIAAQHKGLTVI
FT                   VTQDSKSAVRLEKVLREITATEICLFPDWETLPYDAFSPHQEIISARLSALFYLQQANR
FT                   GILLLPVTTLMQRVCPPSFLQQNVLLIKNGDRFNIERLRLQLENAGYRTVEQVLEPGEF
FT                   AVRGSLLDLFPMGSPLPFRLDFFDDEIDSIRTFDVETQRTLAEIPQINLLPAHEFPTDS
FT                   KGIEFFRARFRATFGEIRRDPEHIYQQVSKGTLVSGIEYWQPLFFEQMGTLFDYLPANS
FT                   LLVESEQNAEQAIRFYADAEQRFESRKVDPMRPLLPPETLWLRADELNRHLKQYSRMTF
FT                   KTEKVRSSVRRKNLPLVPLPPLQIQAQQKEPLQALRRFIESFDGKIVFSVETEGRRETL
FT                   LDLLSPGKLKPKQIKRLEEAEEQHISLWISSLDHGFILESQSAVKIAVICETELLGDRV
FT                   QQRRRDKRKTVNPDALIRNLAELKIGQPVVHLEHGVGRYGGLVTLENGGVKAEYLLLTY
FT                   ANDAKLYVPVAGLHLISRYVGGNEETAPLHKLGSDAWSKARRKAAEKIRDVAAELLDVY
FT                   AQREAQKGFAFQYEREEFQAFSATFPFEETFDQALAINAVISDMCQPKAMDRLICGDVG
FT                   FGKTEVAMRAAFLAVMNHKQVAVLVPTTLLAQQHYENFRDRFANLPVNVEVLSRFKTAK
FT                   EQKRVLADLADGKVDILIGTHKLIQSDVKFHDLGLLIIDEEHRFGVRQKERIKQLRANI
FT                   DILTLTATPIPRTLNMAMNGIRDLSIISTPPARRLTIKTFVRQQDDLTVREAILREILR
FT                   GGQVYYLHNDVASIENCAEKLTALVPEARVTVGHGQMRERELERVMTDFYHQRFNVLVC
FT                   STIIETGIDVPTANTIIIERADNFGLAQLHQLRGRVGRSHHQAYAYLLTPPPKLMTKDA
FT                   LKRLEALESLDNLGAGFVLATHDLEIRGAGELLGSEQSGQIESIGFSLYMELLEAAVTA
FT                   MKEGREPSLDELTQQQVEIDLRVSALLPEDYLGDVNMRLSFYKRIAGAENKTALDELKV
FT                   ELIDRFGLLPEAAQNLMRIAELRTLAKQLKIIKIDGTATGGFIEFNPTADIEPMKFLNL
FT                   IQQQPAVFKFDGPTKFRFSHNLEQPKVRLEFVLNLLNSLSD"
FT   gene            621449..621769
FT                   /locus_tag="Asuc_0558"
FT   CDS_pept        621449..621769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0558"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   hso:HS_0462 ribosome-associated protein Y"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73933"
FT                   /db_xref="GOA:A6VLT6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT6"
FT                   /protein_id="ABR73933.1"
FT                   /translation="MTLNIASKQMDITPAIRSHIEERLAKLEKWQTQLINPHFVLSKLP
FT                   QGFGVEATIGTPFGNLFATAESDDMYVAINNVEEKLEKQLNKLQHKGEARRADERLKDS
FT                   FR"
FT   gene            complement(621893..623152)
FT                   /locus_tag="Asuc_0559"
FT   CDS_pept        complement(621893..623152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0559"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B;
FT                   KEGG: hit:NTHI0830 outer membrane antigenic lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73934"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT7"
FT                   /protein_id="ABR73934.1"
FT                   /translation="MKKSFLLLPLAAAVLAGCSSSTPAPVDSVDGTLSPSIPQPVDGSS
FT                   NSTWEPQVQQSAMPENMNSPVAPQPVANQAGTLPTAATTAQPSLQQTQQQPAMTTKTVC
FT                   KTVEVPAAGNKASNQSQTVEIPRNAETNAPDYSKIDKGFYKATEYTVKKGDTMFLIAYI
FT                   AGIDVKELAALNGMSEPYNLKVGQTLKVSSGTATAATTTQQQCTEVQVPAEPQVSYTAG
FT                   PNGTQYGSDGTVTGPVKAASGTVAPTAGVTAGTGTAPTTPTGGIVAGVGTAGATTGTVV
FT                   AGTAGSPASVTAPASNLKWQWPTTGKITQGFSAGDGGNKGIDIGGSKGQAVYAAAPGRV
FT                   VYAGNALRGYGNLIIIKHDDDFLSAYAHNDSISVRDQQEVKAGQQIAKMGSSGTNRVKL
FT                   HFEIRYKGKSVDPTRYLPRR"
FT   sig_peptide     complement(623066..623152)
FT                   /locus_tag="Asuc_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.696 at
FT                   residue 29"
FT   gene            complement(623172..623363)
FT                   /locus_tag="Asuc_0560"
FT   CDS_pept        complement(623172..623363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73935"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT8"
FT                   /protein_id="ABR73935.1"
FT                   /translation="MKKIIFLLSIMTILTACSSERSAEKDPNVLPDGIMQPVAGTGAME
FT                   GGGFIPTVEQSDMPDNMK"
FT   sig_peptide     complement(623295..623363)
FT                   /locus_tag="Asuc_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.575 at
FT                   residue 23"
FT   gene            complement(623374..623949)
FT                   /locus_tag="Asuc_0561"
FT   CDS_pept        complement(623374..623949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0561"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   msu:MS2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73936"
FT                   /db_xref="GOA:A6VLT9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLT9"
FT                   /protein_id="ABR73936.1"
FT                   /translation="MNVFGAMYDKTMAWSKHRLATYWLAFVSFIEAIFFPIPPDVMLIP
FT                   MAMSKPQSAVRFAIICTIASIVGGMIGYSVGYYAFDFVQQYIVKWGYQTQWDKAISWFE
FT                   QWGILVVFVAGFSPIPYKIFTIAAGVMQMMFIPFVLTATISRAARFLLIAKLAAWGGTK
FT                   FADKLRRSIEVIGWSVVALAIIAYLVLK"
FT   gene            complement(623990..624730)
FT                   /locus_tag="Asuc_0562"
FT   CDS_pept        complement(623990..624730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0562"
FT                   /product="stationary-phase survival protein SurE"
FT                   /EC_number="3.1.3.6"
FT                   /note="TIGRFAM: stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE; KEGG: hin:HI0702 acid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73937"
FT                   /db_xref="GOA:A6VLU0"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLU0"
FT                   /protein_id="ABR73937.1"
FT                   /translation="MNILLSNDDGYHAEGIQTLATYLRKFANVVIVAPDRNRSAASSSL
FT                   TLVEPLRPRQLDNRDYCINGTPADCVHLALNGFLSGRVDLVVSGINAGVNLGDDTLYSG
FT                   TLAAALEGRHLGLPAIAVSLDGRQHYESAAKIVCDLIPKLHGQLLKSREILNINVPDLP
FT                   YENLKGLKVCRLGHRSSAAEVIKQADPRGEAIYWIGPAGLPEDEAEGTDFHAVQQGYVS
FT                   ITPIQPDLTAHHSLRSLQTWLEQE"
FT   gene            complement(624817..626298)
FT                   /locus_tag="Asuc_0563"
FT   CDS_pept        complement(624817..626298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0563"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; PFAM:
FT                   acetohydroxy acid isomeroreductase; Acetohydroxy acid
FT                   isomeroreductase catalytic domain protein; KEGG: msu:MS0045
FT                   ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73938"
FT                   /db_xref="GOA:A6VLU1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLU1"
FT                   /protein_id="ABR73938.1"
FT                   /translation="MSNYFNTLNLREKLDQLGRCRFMDRSEFSDGCNFLKGKKIVIVGC
FT                   GAQGLNQGLNMRDSGLDISYALRKAAIEEKRPSFQRATENGFKVGTYEELIPTADLVIN
FT                   LTPDKQHSKVVSDVMPLMKQGAAFGYSHGFNIVEVGEQIREDITVVMSAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPANDPKGEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSIVCYDKLIADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNAA
FT                   KLRAFELSEQIKEKLGFLYLKHMDDIISGEFSRVMMEDWANGDKDLLAWREATGKTAFE
FT                   NAPKADGIKISEQEYFDNGVLMVAMVKAGVEMAFDAMVASGIYEESAYYESLHELPLIA
FT                   NTIARKRLYEMNVVISDTAEYGNYLFSNVATPILAKEIIPALQKGDLGEPTPAVDIDNV
FT                   TLRDVNDEIRNHPVELIGLELRGYMTDMKRISSQG"
FT   gene            626418..626810
FT                   /locus_tag="Asuc_0564"
FT   CDS_pept        626418..626810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0564"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: msu:MS0611 lactoylglutathione
FT                   lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73939"
FT                   /db_xref="GOA:A6VLU2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU2"
FT                   /protein_id="ABR73939.1"
FT                   /translation="MSNPILGFHHIAVIVSDYEKSKVFYTQILGARILAETYRNARQSY
FT                   KLDLAFADGSQIELFSFPAPPARPNRPEACGLRHLAFRVADVQSAVDFLQENQVECEPI
FT                   RIDELTGKQFTFFKDPDGLPLEIYQI"
FT   gene            626820..627668
FT                   /locus_tag="Asuc_0565"
FT   CDS_pept        626820..627668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0565"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: msu:MS0044 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73940"
FT                   /db_xref="GOA:A6VLU3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU3"
FT                   /protein_id="ABR73940.1"
FT                   /translation="MNFNDLSLFLQLSETKNFSKTARQSHMSPSTLSRQIQRMEQELGG
FT                   VLFLRDNRQVQLTELGEQFAQFAKRSRADWQNFQSQVRSNSAELSGELKLFCSVTAAYS
FT                   HLPQVLKNFRLRYPKVEIQLTTGDAASAIQLVQTQQVDLALAGKPLNLPNAVVFHPIDE
FT                   VSLALIAPRVACPATQLLQQEPVNWQEMPFILPVEGPVRQRIDQWFRQKKIKHPKIYAT
FT                   VSGHEGIVPMVALGCGLALLPDVVIKNSPMNTQISSLTFDTAIAPLELGFCAQKKVWNY
FT                   R"
FT   gene            627828..628958
FT                   /locus_tag="Asuc_0566"
FT   CDS_pept        627828..628958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0566"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: hit:NTHI1157 smf"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73941"
FT                   /db_xref="GOA:A6VLU4"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU4"
FT                   /protein_id="ABR73941.1"
FT                   /translation="MDKYTETLLRLLQVPRLGANTVSQILTTIELNTLLSYDADAFYAI
FT                   GWTTYQIKRWFKPERKYIDPALEWGQKRGNQIIHCFHLDYPYLLKQIESSPPVLFVQGN
FT                   TGLLIHPQIAIVGSRYCSDYGSYWAKYFAAELCAAGFAVTSGLAKGIDAYSHQAALDVQ
FT                   GKTVAVLGNGLNQIYPAVNRKLAQAILDNDGTLVTEFIPDQPPLPANFPRRNRIISGLS
FT                   LATLVVEASARSGSLITARFALEQNREVFAIPGNLNNDFSRGCHKLIKQGAMLVENAKD
FT                   VIENIPYYGFTNMQLRDVKDVLKATVPCPNPRPPSARHPDPQHPDLFKLIGHDLISVDE
FT                   LATQTGLGVEALLIQLLDLELQDLILCEDGGYRRQW"
FT   gene            629120..629857
FT                   /locus_tag="Asuc_0567"
FT   CDS_pept        629120..629857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0567"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="TIGRFAM: pyruvate formate-lyase activating enzyme;
FT                   PFAM: Radical SAM domain protein; KEGG: hso:HS_1147
FT                   pyruvate formate-lyase 1 activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73942"
FT                   /db_xref="GOA:A6VLU5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU5"
FT                   /protein_id="ABR73942.1"
FT                   /translation="MSVLGRYHSFESCGTVDGPGIRFILFLQGCLMRCLYCHNRDTWDL
FT                   HGGKEISVEELMKEVVTYKPFMRASGGGVTASGGEAILQPKFVLEWFRACKAEGIDTCL
FT                   DTNGFVRHYELIDELLDVTDLVLLDLKEMNDRVHQSLIGVPNKRVLDFAKYLEKRNQRT
FT                   WIRHVVVPGYTDNDEDLHLLGQFTQNMRNIEKIELLPYHRLGAHKWAVLGDKYQLEDVK
FT                   PPTKESMEHIKALLESYGHEVKY"
FT   gene            630071..630703
FT                   /locus_tag="Asuc_0568"
FT   CDS_pept        630071..630703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0568"
FT                   /product="protein of unknown function DUF533"
FT                   /note="PFAM: protein of unknown function DUF533; KEGG:
FT                   msu:MS2177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73943"
FT                   /db_xref="InterPro:IPR007486"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU6"
FT                   /protein_id="ABR73943.1"
FT                   /translation="MDFNKILNQVLTTAQEQVSKTMSGNSTMDKITKAGGGAAAIGILS
FT                   MIFGRSGGASLTKLGSLAALGSLAYQAYQSYQAKQGQQAPQVEETDFTESARNSDAGQV
FT                   ILQAMIAAAAADGAISEEEKQAILNEADNDAEVQLWLEQAINSPATPAQIAAQVGNDAA
FT                   LAAQVYLAARVVCKELDRKEIVFLANLAQALGLDEQLVEELEKRAGF"
FT   gene            complement(630827..631333)
FT                   /locus_tag="Asuc_0569"
FT   CDS_pept        complement(630827..631333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msu:MS2317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73944"
FT                   /db_xref="GOA:A6VLU7"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU7"
FT                   /protein_id="ABR73944.1"
FT                   /translation="MADPHIRSPMDFLDKLTVCLYRSGFIVAACALALLPYSAQWGYFG
FT                   LLVAAALCASSLHIYLKSFRLLLQMATWLALLCHAFGQTELALGGVLLTLGGLAFKEYF
FT                   CFRVWALNFMPLLVALLWLCTVISLSLPQKILSAACALLFTVLFIRKIRMPLHFDIGDK
FT                   TKYQV"
FT   gene            complement(631363..632247)
FT                   /locus_tag="Asuc_0570"
FT   CDS_pept        complement(631363..632247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0570"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   msu:MS2319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73945"
FT                   /db_xref="GOA:A6VLU8"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU8"
FT                   /protein_id="ABR73945.1"
FT                   /translation="MSRLFPLPSVKSAVKKITVFSTALFSLSVSAQPARFVAAQPHKLA
FT                   IVIDDIGYHPKEDAQILAMPKAVSVAIIPVAPYAAQRNRQAWQQGRDILIHMPMQPVNN
FT                   MKIEEGGLSVGMSQQEVEQRVQRAKQIVSHAIGMNNHMGSAATADPTLMTRLMRILQRQ
FT                   GLFFLDSRTIGKSVAGKIAKLEGVSVLERHVFLDDSDNFGDVQRQFQRALQHARQHGVA
FT                   IVIGHPRKNTIAVLQAELRHLPADIQLVGMGQLWRNEKVTPPKPFILLFSDLPAPTSQP
FT                   PFKYEPLLRGVPQ"
FT   sig_peptide     complement(632152..632247)
FT                   /locus_tag="Asuc_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 32"
FT   gene            complement(632247..633464)
FT                   /locus_tag="Asuc_0571"
FT   CDS_pept        complement(632247..633464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0571"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: msu:MS2320 NlpD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73946"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLU9"
FT                   /protein_id="ABR73946.1"
FT                   /translation="MLCFSPFKTAKNLTALLCGCVLLSFFARAADLNQIQSQIKQQEQK
FT                   IASQKREQNKLQSSLKFQENKINDLVGSLRETESSLQETKKIIADTNKQIRLLEQQERQ
FT                   QKNKLARQLDAIYRSGNPNSVIEHLLSDDAKNNDRMMVYSKHMNKTRLALIDKLKATRT
FT                   QLEEQKNYLAEQQAEQQQQLSEQKKQRQALQKVRNERQSTLTQLNRTLQRDQNRLETLK
FT                   ANENALRAEINRAAQAARQQEKREREQLAQKKQAEEKRTNKTYQPTVREKQLMRSGNGL
FT                   AGKYPFPVAGKILHKFGSVQAGEVKWKGIVIAAGTGTAVKAITGGRVILASWLAGYGQV
FT                   VVIDHGKGDMSLYGYNQAVFVRSGSLVNAGQKIAEVGNSGGQGRSSLYFEIRRQGNAVN
FT                   PMNWLR"
FT   sig_peptide     complement(633375..633464)
FT                   /locus_tag="Asuc_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            633618..634301
FT                   /locus_tag="Asuc_0572"
FT   CDS_pept        633618..634301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0572"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase; KEGG: msu:MS2321 phosphoglycerate
FT                   mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73947"
FT                   /db_xref="GOA:A6VLV0"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VLV0"
FT                   /protein_id="ABR73947.1"
FT                   /translation="MQLVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKLKAA
FT                   GFEFDIAFTSVLTRAIKTCNLVLEESDQLWVPQIKTWRLNERHYGGLQGLNKAEAAAEH
FT                   GDEQVRIWRRSYDVLPPVLDPKDPNSAHNDRRYAHLPADVVPDCENLKVTLDRVLPFWE
FT                   DQIAPAIKAGKRVLVAAHGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYELDDNLKVL
FT                   SKRYL"
FT   gene            634412..635458
FT                   /locus_tag="Asuc_0573"
FT   CDS_pept        634412..635458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Asuc_0573"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: msu:MS2260
FT                   ADP-heptoseLPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Asuc_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR73948"
FT                   /db_xref="GOA:A6VLV1"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A6VLV1"
FT                   /protein_id="<