(data stored in ACNUC7421 zone)

EMBL: CP000749

ID   CP000749; SV 1; circular; genomic DNA; STD; PRO; 5100344 BP.
XX
AC   CP000749; AAVH01000000-AAVH01000052;
XX
PR   Project:PRJNA17445;
XX
DT   06-JUL-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Marinomonas sp. MWYL1, complete genome.
XX
KW   .
XX
OS   Marinomonas sp. MWYL1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Oceanospirillales;
OC   Oceanospirillaceae; Marinomonas.
XX
RN   [1]
RP   1-5100344
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Johnston A.W.B., Todd J.D., Rogers R., Wexler M., Bond P.L., Li Y.,
RA   Richardson P.;
RT   "Complete sequence of Marinomonas sp. MWYL1";
RL   Unpublished.
XX
RN   [2]
RP   1-5100344
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Johnston A.W.B., Todd J.D., Rogers R., Wexler M., Bond P.L., Li Y.,
RA   Richardson P.;
RT   ;
RL   Submitted (27-JUN-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 3cc837fe6a027796a1d8d27e129ea24a.
DR   BioSample; SAMN02598388.
DR   EnsemblGenomes-Gn; EBG00001152545.
DR   EnsemblGenomes-Gn; EBG00001152546.
DR   EnsemblGenomes-Gn; EBG00001152547.
DR   EnsemblGenomes-Gn; EBG00001152548.
DR   EnsemblGenomes-Gn; EBG00001152549.
DR   EnsemblGenomes-Gn; EBG00001152550.
DR   EnsemblGenomes-Gn; EBG00001152551.
DR   EnsemblGenomes-Gn; EBG00001152552.
DR   EnsemblGenomes-Gn; EBG00001152553.
DR   EnsemblGenomes-Gn; EBG00001152554.
DR   EnsemblGenomes-Gn; EBG00001152555.
DR   EnsemblGenomes-Gn; EBG00001152556.
DR   EnsemblGenomes-Gn; EBG00001152557.
DR   EnsemblGenomes-Gn; EBG00001152558.
DR   EnsemblGenomes-Gn; EBG00001152559.
DR   EnsemblGenomes-Gn; EBG00001152560.
DR   EnsemblGenomes-Gn; EBG00001152561.
DR   EnsemblGenomes-Gn; EBG00001152562.
DR   EnsemblGenomes-Gn; EBG00001152563.
DR   EnsemblGenomes-Gn; EBG00001152564.
DR   EnsemblGenomes-Gn; EBG00001152565.
DR   EnsemblGenomes-Gn; EBG00001152566.
DR   EnsemblGenomes-Gn; EBG00001152567.
DR   EnsemblGenomes-Gn; EBG00001152568.
DR   EnsemblGenomes-Gn; EBG00001152569.
DR   EnsemblGenomes-Gn; EBG00001152570.
DR   EnsemblGenomes-Gn; EBG00001152571.
DR   EnsemblGenomes-Gn; EBG00001152572.
DR   EnsemblGenomes-Gn; EBG00001152573.
DR   EnsemblGenomes-Gn; EBG00001152574.
DR   EnsemblGenomes-Gn; EBG00001152575.
DR   EnsemblGenomes-Gn; EBG00001152576.
DR   EnsemblGenomes-Gn; EBG00001152577.
DR   EnsemblGenomes-Gn; EBG00001152578.
DR   EnsemblGenomes-Gn; EBG00001152579.
DR   EnsemblGenomes-Gn; EBG00001152580.
DR   EnsemblGenomes-Gn; EBG00001152581.
DR   EnsemblGenomes-Gn; EBG00001152582.
DR   EnsemblGenomes-Gn; EBG00001152583.
DR   EnsemblGenomes-Gn; EBG00001152584.
DR   EnsemblGenomes-Gn; EBG00001152585.
DR   EnsemblGenomes-Gn; EBG00001152586.
DR   EnsemblGenomes-Gn; EBG00001152587.
DR   EnsemblGenomes-Gn; EBG00001152588.
DR   EnsemblGenomes-Gn; EBG00001152589.
DR   EnsemblGenomes-Gn; EBG00001152590.
DR   EnsemblGenomes-Gn; EBG00001152591.
DR   EnsemblGenomes-Gn; EBG00001152592.
DR   EnsemblGenomes-Gn; EBG00001152593.
DR   EnsemblGenomes-Gn; EBG00001152594.
DR   EnsemblGenomes-Gn; EBG00001152595.
DR   EnsemblGenomes-Gn; EBG00001152596.
DR   EnsemblGenomes-Gn; EBG00001152597.
DR   EnsemblGenomes-Gn; EBG00001152598.
DR   EnsemblGenomes-Gn; EBG00001152599.
DR   EnsemblGenomes-Gn; EBG00001152600.
DR   EnsemblGenomes-Gn; EBG00001152601.
DR   EnsemblGenomes-Gn; EBG00001152602.
DR   EnsemblGenomes-Gn; EBG00001152603.
DR   EnsemblGenomes-Gn; EBG00001152604.
DR   EnsemblGenomes-Gn; EBG00001152605.
DR   EnsemblGenomes-Gn; EBG00001152606.
DR   EnsemblGenomes-Gn; EBG00001152607.
DR   EnsemblGenomes-Gn; EBG00001152608.
DR   EnsemblGenomes-Gn; EBG00001152609.
DR   EnsemblGenomes-Gn; EBG00001152610.
DR   EnsemblGenomes-Gn; EBG00001152611.
DR   EnsemblGenomes-Gn; EBG00001152612.
DR   EnsemblGenomes-Gn; EBG00001152613.
DR   EnsemblGenomes-Gn; EBG00001152614.
DR   EnsemblGenomes-Gn; EBG00001152615.
DR   EnsemblGenomes-Gn; EBG00001152616.
DR   EnsemblGenomes-Gn; EBG00001152617.
DR   EnsemblGenomes-Gn; EBG00001152618.
DR   EnsemblGenomes-Gn; EBG00001152619.
DR   EnsemblGenomes-Gn; EBG00001152620.
DR   EnsemblGenomes-Gn; EBG00001152621.
DR   EnsemblGenomes-Gn; EBG00001152622.
DR   EnsemblGenomes-Gn; EBG00001152623.
DR   EnsemblGenomes-Gn; EBG00001152624.
DR   EnsemblGenomes-Gn; EBG00001152625.
DR   EnsemblGenomes-Gn; EBG00001152626.
DR   EnsemblGenomes-Gn; EBG00001152627.
DR   EnsemblGenomes-Gn; EBG00001152628.
DR   EnsemblGenomes-Gn; EBG00001152629.
DR   EnsemblGenomes-Gn; EBG00001152630.
DR   EnsemblGenomes-Gn; EBG00001152631.
DR   EnsemblGenomes-Gn; EBG00001152632.
DR   EnsemblGenomes-Gn; EBG00001152633.
DR   EnsemblGenomes-Gn; EBG00001152634.
DR   EnsemblGenomes-Gn; EBG00001152635.
DR   EnsemblGenomes-Gn; EBG00001152636.
DR   EnsemblGenomes-Gn; EBG00001152637.
DR   EnsemblGenomes-Gn; EBG00001152638.
DR   EnsemblGenomes-Gn; EBG00001152639.
DR   EnsemblGenomes-Gn; EBG00001152640.
DR   EnsemblGenomes-Gn; EBG00001152641.
DR   EnsemblGenomes-Gn; EBG00001152642.
DR   EnsemblGenomes-Gn; EBG00001152643.
DR   EnsemblGenomes-Gn; EBG00001152644.
DR   EnsemblGenomes-Gn; EBG00001152645.
DR   EnsemblGenomes-Gn; EBG00001152646.
DR   EnsemblGenomes-Gn; EBG00001152647.
DR   EnsemblGenomes-Gn; EBG00001152648.
DR   EnsemblGenomes-Gn; EBG00001152649.
DR   EnsemblGenomes-Gn; EBG00001152650.
DR   EnsemblGenomes-Gn; EBG00001152651.
DR   EnsemblGenomes-Gn; EBG00001152652.
DR   EnsemblGenomes-Gn; EBG00001152653.
DR   EnsemblGenomes-Gn; EBG00001152654.
DR   EnsemblGenomes-Gn; EBG00001152655.
DR   EnsemblGenomes-Gn; EBG00001152656.
DR   EnsemblGenomes-Gn; EBG00001152657.
DR   EnsemblGenomes-Gn; EBG00001152658.
DR   EnsemblGenomes-Gn; EBG00001152659.
DR   EnsemblGenomes-Gn; EBG00001152660.
DR   EnsemblGenomes-Gn; EBG00001152661.
DR   EnsemblGenomes-Gn; EBG00001152662.
DR   EnsemblGenomes-Gn; EBG00001152663.
DR   EnsemblGenomes-Gn; EBG00001152664.
DR   EnsemblGenomes-Gn; EBG00001152665.
DR   EnsemblGenomes-Gn; EBG00001152666.
DR   EnsemblGenomes-Gn; EBG00001152667.
DR   EnsemblGenomes-Gn; EBG00001152668.
DR   EnsemblGenomes-Gn; EBG00001152669.
DR   EnsemblGenomes-Gn; EBG00001152670.
DR   EnsemblGenomes-Gn; EBG00001152671.
DR   EnsemblGenomes-Gn; EBG00001152672.
DR   EnsemblGenomes-Gn; EBG00001152673.
DR   EnsemblGenomes-Gn; EBG00001152674.
DR   EnsemblGenomes-Gn; EBG00001152675.
DR   EnsemblGenomes-Gn; EBG00001152676.
DR   EnsemblGenomes-Gn; EBG00001152677.
DR   EnsemblGenomes-Gn; EBG00001152678.
DR   EnsemblGenomes-Gn; EBG00001152679.
DR   EnsemblGenomes-Gn; EBG00001152680.
DR   EnsemblGenomes-Gn; EBG00001152681.
DR   EnsemblGenomes-Gn; EBG00001152682.
DR   EnsemblGenomes-Gn; EBG00001152683.
DR   EnsemblGenomes-Gn; EBG00001152684.
DR   EnsemblGenomes-Gn; EBG00001152685.
DR   EnsemblGenomes-Gn; EBG00001152686.
DR   EnsemblGenomes-Gn; Mmwyl1_R0001.
DR   EnsemblGenomes-Gn; Mmwyl1_R0002.
DR   EnsemblGenomes-Gn; Mmwyl1_R0003.
DR   EnsemblGenomes-Gn; Mmwyl1_R0004.
DR   EnsemblGenomes-Gn; Mmwyl1_R0005.
DR   EnsemblGenomes-Gn; Mmwyl1_R0006.
DR   EnsemblGenomes-Gn; Mmwyl1_R0007.
DR   EnsemblGenomes-Gn; Mmwyl1_R0008.
DR   EnsemblGenomes-Gn; Mmwyl1_R0009.
DR   EnsemblGenomes-Gn; Mmwyl1_R0010.
DR   EnsemblGenomes-Gn; Mmwyl1_R0011.
DR   EnsemblGenomes-Gn; Mmwyl1_R0012.
DR   EnsemblGenomes-Gn; Mmwyl1_R0013.
DR   EnsemblGenomes-Gn; Mmwyl1_R0014.
DR   EnsemblGenomes-Gn; Mmwyl1_R0015.
DR   EnsemblGenomes-Gn; Mmwyl1_R0016.
DR   EnsemblGenomes-Gn; Mmwyl1_R0017.
DR   EnsemblGenomes-Gn; Mmwyl1_R0018.
DR   EnsemblGenomes-Gn; Mmwyl1_R0019.
DR   EnsemblGenomes-Gn; Mmwyl1_R0020.
DR   EnsemblGenomes-Gn; Mmwyl1_R0021.
DR   EnsemblGenomes-Gn; Mmwyl1_R0022.
DR   EnsemblGenomes-Gn; Mmwyl1_R0023.
DR   EnsemblGenomes-Gn; Mmwyl1_R0024.
DR   EnsemblGenomes-Gn; Mmwyl1_R0025.
DR   EnsemblGenomes-Gn; Mmwyl1_R0026.
DR   EnsemblGenomes-Gn; Mmwyl1_R0027.
DR   EnsemblGenomes-Gn; Mmwyl1_R0028.
DR   EnsemblGenomes-Gn; Mmwyl1_R0029.
DR   EnsemblGenomes-Gn; Mmwyl1_R0030.
DR   EnsemblGenomes-Gn; Mmwyl1_R0031.
DR   EnsemblGenomes-Gn; Mmwyl1_R0032.
DR   EnsemblGenomes-Gn; Mmwyl1_R0033.
DR   EnsemblGenomes-Gn; Mmwyl1_R0034.
DR   EnsemblGenomes-Gn; Mmwyl1_R0035.
DR   EnsemblGenomes-Gn; Mmwyl1_R0036.
DR   EnsemblGenomes-Gn; Mmwyl1_R0037.
DR   EnsemblGenomes-Gn; Mmwyl1_R0038.
DR   EnsemblGenomes-Gn; Mmwyl1_R0039.
DR   EnsemblGenomes-Gn; Mmwyl1_R0040.
DR   EnsemblGenomes-Gn; Mmwyl1_R0041.
DR   EnsemblGenomes-Gn; Mmwyl1_R0042.
DR   EnsemblGenomes-Gn; Mmwyl1_R0043.
DR   EnsemblGenomes-Gn; Mmwyl1_R0045.
DR   EnsemblGenomes-Gn; Mmwyl1_R0046.
DR   EnsemblGenomes-Gn; Mmwyl1_R0047.
DR   EnsemblGenomes-Gn; Mmwyl1_R0048.
DR   EnsemblGenomes-Gn; Mmwyl1_R0049.
DR   EnsemblGenomes-Gn; Mmwyl1_R0050.
DR   EnsemblGenomes-Gn; Mmwyl1_R0051.
DR   EnsemblGenomes-Gn; Mmwyl1_R0052.
DR   EnsemblGenomes-Gn; Mmwyl1_R0053.
DR   EnsemblGenomes-Gn; Mmwyl1_R0054.
DR   EnsemblGenomes-Gn; Mmwyl1_R0055.
DR   EnsemblGenomes-Gn; Mmwyl1_R0056.
DR   EnsemblGenomes-Gn; Mmwyl1_R0057.
DR   EnsemblGenomes-Gn; Mmwyl1_R0058.
DR   EnsemblGenomes-Gn; Mmwyl1_R0059.
DR   EnsemblGenomes-Gn; Mmwyl1_R0060.
DR   EnsemblGenomes-Gn; Mmwyl1_R0062.
DR   EnsemblGenomes-Gn; Mmwyl1_R0063.
DR   EnsemblGenomes-Gn; Mmwyl1_R0064.
DR   EnsemblGenomes-Gn; Mmwyl1_R0065.
DR   EnsemblGenomes-Gn; Mmwyl1_R0066.
DR   EnsemblGenomes-Gn; Mmwyl1_R0067.
DR   EnsemblGenomes-Gn; Mmwyl1_R0068.
DR   EnsemblGenomes-Gn; Mmwyl1_R0069.
DR   EnsemblGenomes-Gn; Mmwyl1_R0070.
DR   EnsemblGenomes-Gn; Mmwyl1_R0071.
DR   EnsemblGenomes-Gn; Mmwyl1_R0072.
DR   EnsemblGenomes-Gn; Mmwyl1_R0073.
DR   EnsemblGenomes-Gn; Mmwyl1_R0074.
DR   EnsemblGenomes-Gn; Mmwyl1_R0075.
DR   EnsemblGenomes-Gn; Mmwyl1_R0076.
DR   EnsemblGenomes-Gn; Mmwyl1_R0077.
DR   EnsemblGenomes-Gn; Mmwyl1_R0078.
DR   EnsemblGenomes-Gn; Mmwyl1_R0079.
DR   EnsemblGenomes-Gn; Mmwyl1_R0080.
DR   EnsemblGenomes-Gn; Mmwyl1_R0081.
DR   EnsemblGenomes-Gn; Mmwyl1_R0082.
DR   EnsemblGenomes-Gn; Mmwyl1_R0083.
DR   EnsemblGenomes-Gn; Mmwyl1_R0084.
DR   EnsemblGenomes-Gn; Mmwyl1_R0085.
DR   EnsemblGenomes-Gn; Mmwyl1_R0086.
DR   EnsemblGenomes-Gn; Mmwyl1_R0087.
DR   EnsemblGenomes-Gn; Mmwyl1_R0088.
DR   EnsemblGenomes-Gn; Mmwyl1_R0089.
DR   EnsemblGenomes-Gn; Mmwyl1_R0090.
DR   EnsemblGenomes-Gn; Mmwyl1_R0091.
DR   EnsemblGenomes-Gn; Mmwyl1_R0092.
DR   EnsemblGenomes-Gn; Mmwyl1_R0093.
DR   EnsemblGenomes-Gn; Mmwyl1_R0094.
DR   EnsemblGenomes-Gn; Mmwyl1_R0095.
DR   EnsemblGenomes-Gn; Mmwyl1_R0096.
DR   EnsemblGenomes-Gn; Mmwyl1_R0097.
DR   EnsemblGenomes-Gn; Mmwyl1_R0098.
DR   EnsemblGenomes-Gn; Mmwyl1_R0099.
DR   EnsemblGenomes-Gn; Mmwyl1_R0100.
DR   EnsemblGenomes-Gn; Mmwyl1_R0101.
DR   EnsemblGenomes-Gn; Mmwyl1_R0102.
DR   EnsemblGenomes-Gn; Mmwyl1_R0103.
DR   EnsemblGenomes-Gn; Mmwyl1_R0104.
DR   EnsemblGenomes-Gn; Mmwyl1_R0105.
DR   EnsemblGenomes-Gn; Mmwyl1_R0106.
DR   EnsemblGenomes-Gn; Mmwyl1_R0107.
DR   EnsemblGenomes-Gn; Mmwyl1_R0108.
DR   EnsemblGenomes-Gn; Mmwyl1_R0109.
DR   EnsemblGenomes-Gn; Mmwyl1_R0110.
DR   EnsemblGenomes-Gn; Mmwyl1_R0111.
DR   EnsemblGenomes-Tr; EBT00001741416.
DR   EnsemblGenomes-Tr; EBT00001741417.
DR   EnsemblGenomes-Tr; EBT00001741418.
DR   EnsemblGenomes-Tr; EBT00001741419.
DR   EnsemblGenomes-Tr; EBT00001741420.
DR   EnsemblGenomes-Tr; EBT00001741421.
DR   EnsemblGenomes-Tr; EBT00001741422.
DR   EnsemblGenomes-Tr; EBT00001741423.
DR   EnsemblGenomes-Tr; EBT00001741424.
DR   EnsemblGenomes-Tr; EBT00001741425.
DR   EnsemblGenomes-Tr; EBT00001741426.
DR   EnsemblGenomes-Tr; EBT00001741427.
DR   EnsemblGenomes-Tr; EBT00001741428.
DR   EnsemblGenomes-Tr; EBT00001741429.
DR   EnsemblGenomes-Tr; EBT00001741430.
DR   EnsemblGenomes-Tr; EBT00001741431.
DR   EnsemblGenomes-Tr; EBT00001741432.
DR   EnsemblGenomes-Tr; EBT00001741433.
DR   EnsemblGenomes-Tr; EBT00001741434.
DR   EnsemblGenomes-Tr; EBT00001741435.
DR   EnsemblGenomes-Tr; EBT00001741436.
DR   EnsemblGenomes-Tr; EBT00001741437.
DR   EnsemblGenomes-Tr; EBT00001741438.
DR   EnsemblGenomes-Tr; EBT00001741439.
DR   EnsemblGenomes-Tr; EBT00001741440.
DR   EnsemblGenomes-Tr; EBT00001741441.
DR   EnsemblGenomes-Tr; EBT00001741442.
DR   EnsemblGenomes-Tr; EBT00001741443.
DR   EnsemblGenomes-Tr; EBT00001741444.
DR   EnsemblGenomes-Tr; EBT00001741445.
DR   EnsemblGenomes-Tr; EBT00001741446.
DR   EnsemblGenomes-Tr; EBT00001741447.
DR   EnsemblGenomes-Tr; EBT00001741448.
DR   EnsemblGenomes-Tr; EBT00001741449.
DR   EnsemblGenomes-Tr; EBT00001741450.
DR   EnsemblGenomes-Tr; EBT00001741451.
DR   EnsemblGenomes-Tr; EBT00001741452.
DR   EnsemblGenomes-Tr; EBT00001741453.
DR   EnsemblGenomes-Tr; EBT00001741454.
DR   EnsemblGenomes-Tr; EBT00001741455.
DR   EnsemblGenomes-Tr; EBT00001741456.
DR   EnsemblGenomes-Tr; EBT00001741457.
DR   EnsemblGenomes-Tr; EBT00001741458.
DR   EnsemblGenomes-Tr; EBT00001741459.
DR   EnsemblGenomes-Tr; EBT00001741460.
DR   EnsemblGenomes-Tr; EBT00001741461.
DR   EnsemblGenomes-Tr; EBT00001741462.
DR   EnsemblGenomes-Tr; EBT00001741463.
DR   EnsemblGenomes-Tr; EBT00001741464.
DR   EnsemblGenomes-Tr; EBT00001741465.
DR   EnsemblGenomes-Tr; EBT00001741466.
DR   EnsemblGenomes-Tr; EBT00001741467.
DR   EnsemblGenomes-Tr; EBT00001741468.
DR   EnsemblGenomes-Tr; EBT00001741469.
DR   EnsemblGenomes-Tr; EBT00001741470.
DR   EnsemblGenomes-Tr; EBT00001741471.
DR   EnsemblGenomes-Tr; EBT00001741472.
DR   EnsemblGenomes-Tr; EBT00001741473.
DR   EnsemblGenomes-Tr; EBT00001741474.
DR   EnsemblGenomes-Tr; EBT00001741475.
DR   EnsemblGenomes-Tr; EBT00001741476.
DR   EnsemblGenomes-Tr; EBT00001741477.
DR   EnsemblGenomes-Tr; EBT00001741478.
DR   EnsemblGenomes-Tr; EBT00001741479.
DR   EnsemblGenomes-Tr; EBT00001741480.
DR   EnsemblGenomes-Tr; EBT00001741481.
DR   EnsemblGenomes-Tr; EBT00001741482.
DR   EnsemblGenomes-Tr; EBT00001741483.
DR   EnsemblGenomes-Tr; EBT00001741484.
DR   EnsemblGenomes-Tr; EBT00001741485.
DR   EnsemblGenomes-Tr; EBT00001741486.
DR   EnsemblGenomes-Tr; EBT00001741487.
DR   EnsemblGenomes-Tr; EBT00001741488.
DR   EnsemblGenomes-Tr; EBT00001741489.
DR   EnsemblGenomes-Tr; EBT00001741490.
DR   EnsemblGenomes-Tr; EBT00001741491.
DR   EnsemblGenomes-Tr; EBT00001741492.
DR   EnsemblGenomes-Tr; EBT00001741493.
DR   EnsemblGenomes-Tr; EBT00001741494.
DR   EnsemblGenomes-Tr; EBT00001741495.
DR   EnsemblGenomes-Tr; EBT00001741496.
DR   EnsemblGenomes-Tr; EBT00001741497.
DR   EnsemblGenomes-Tr; EBT00001741498.
DR   EnsemblGenomes-Tr; EBT00001741499.
DR   EnsemblGenomes-Tr; EBT00001741500.
DR   EnsemblGenomes-Tr; EBT00001741501.
DR   EnsemblGenomes-Tr; EBT00001741502.
DR   EnsemblGenomes-Tr; EBT00001741503.
DR   EnsemblGenomes-Tr; EBT00001741504.
DR   EnsemblGenomes-Tr; EBT00001741505.
DR   EnsemblGenomes-Tr; EBT00001741506.
DR   EnsemblGenomes-Tr; EBT00001741507.
DR   EnsemblGenomes-Tr; EBT00001741508.
DR   EnsemblGenomes-Tr; EBT00001741509.
DR   EnsemblGenomes-Tr; EBT00001741510.
DR   EnsemblGenomes-Tr; EBT00001741511.
DR   EnsemblGenomes-Tr; EBT00001741512.
DR   EnsemblGenomes-Tr; EBT00001741513.
DR   EnsemblGenomes-Tr; EBT00001741514.
DR   EnsemblGenomes-Tr; EBT00001741515.
DR   EnsemblGenomes-Tr; EBT00001741516.
DR   EnsemblGenomes-Tr; EBT00001741517.
DR   EnsemblGenomes-Tr; EBT00001741518.
DR   EnsemblGenomes-Tr; EBT00001741519.
DR   EnsemblGenomes-Tr; EBT00001741520.
DR   EnsemblGenomes-Tr; EBT00001741521.
DR   EnsemblGenomes-Tr; EBT00001741522.
DR   EnsemblGenomes-Tr; EBT00001741523.
DR   EnsemblGenomes-Tr; EBT00001741524.
DR   EnsemblGenomes-Tr; EBT00001741525.
DR   EnsemblGenomes-Tr; EBT00001741526.
DR   EnsemblGenomes-Tr; EBT00001741527.
DR   EnsemblGenomes-Tr; EBT00001741528.
DR   EnsemblGenomes-Tr; EBT00001741529.
DR   EnsemblGenomes-Tr; EBT00001741530.
DR   EnsemblGenomes-Tr; EBT00001741531.
DR   EnsemblGenomes-Tr; EBT00001741532.
DR   EnsemblGenomes-Tr; EBT00001741533.
DR   EnsemblGenomes-Tr; EBT00001741534.
DR   EnsemblGenomes-Tr; EBT00001741535.
DR   EnsemblGenomes-Tr; EBT00001741536.
DR   EnsemblGenomes-Tr; EBT00001741537.
DR   EnsemblGenomes-Tr; EBT00001741538.
DR   EnsemblGenomes-Tr; EBT00001741539.
DR   EnsemblGenomes-Tr; EBT00001741540.
DR   EnsemblGenomes-Tr; EBT00001741541.
DR   EnsemblGenomes-Tr; EBT00001741542.
DR   EnsemblGenomes-Tr; EBT00001741543.
DR   EnsemblGenomes-Tr; EBT00001741544.
DR   EnsemblGenomes-Tr; EBT00001741545.
DR   EnsemblGenomes-Tr; EBT00001741546.
DR   EnsemblGenomes-Tr; EBT00001741547.
DR   EnsemblGenomes-Tr; EBT00001741548.
DR   EnsemblGenomes-Tr; EBT00001741549.
DR   EnsemblGenomes-Tr; EBT00001741550.
DR   EnsemblGenomes-Tr; EBT00001741551.
DR   EnsemblGenomes-Tr; EBT00001741552.
DR   EnsemblGenomes-Tr; EBT00001741553.
DR   EnsemblGenomes-Tr; EBT00001741554.
DR   EnsemblGenomes-Tr; EBT00001741555.
DR   EnsemblGenomes-Tr; EBT00001741556.
DR   EnsemblGenomes-Tr; EBT00001741557.
DR   EnsemblGenomes-Tr; Mmwyl1_R0001-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0002-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0003-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0004-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0005-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0006-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0007-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0008-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0009-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0010-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0011-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0012-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0013-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0014-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0015-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0016-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0017-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0018-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0019-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0020-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0021-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0022-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0023-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0024-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0025-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0026-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0027-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0028-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0029-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0030-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0031-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0032-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0033-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0034-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0035-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0036-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0037-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0038-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0039-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0040-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0041-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0042-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0043-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0045-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0046-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0047-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0048-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0049-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0050-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0051-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0052-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0053-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0054-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0055-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0056-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0057-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0058-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0059-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0060-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0062-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0063-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0064-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0065-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0066-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0067-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0068-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0069-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0070-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0071-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0072-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0073-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0074-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0075-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0076-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0077-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0078-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0079-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0080-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0081-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0082-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0083-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0084-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0085-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0086-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0087-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0088-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0089-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0090-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0091-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0092-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0093-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0094-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0095-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0096-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0097-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0098-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0099-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0100-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0101-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0102-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0103-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0104-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0105-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0106-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0107-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0108-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0109-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0110-1.
DR   EnsemblGenomes-Tr; Mmwyl1_R0111-1.
DR   EuropePMC; PMC3067233; 21169432.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00170; msr.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02058; STnc400.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP000749.
DR   SILVA-SSU; CP000749.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002558
CC   Source DNA and bacteria available from Andrew W.B. Johnston
CC   (a.johnston@uea.ac.uk)
CC   Contacts: Andrew W.B. Johnston (a.johnston@uea.ac.uk)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5100344
FT                   /organism="Marinomonas sp. MWYL1"
FT                   /strain="MWYL1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:400668"
FT   gene            262..1812
FT                   /locus_tag="Mmwyl1_0001"
FT   CDS_pept        262..1812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: psp:PSPPH_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68944"
FT                   /db_xref="GOA:A6VR65"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VR65"
FT                   /protein_id="ABR68944.1"
FT                   /translation="MSLEHWNLCLQRLQSEFSTSQFNTWIRPLQAEMLPNGELCLSAPN
FT                   RFVLDWVSNKYQTRIKELLSEFAGDDLAPALKLAVKAQNFAQANQMSPPPPPVSSEPAI
FT                   NPLNNEVARESGYRPGFGLMDDEEGSPNADLEFEAPLTLSGTGLRGELEPYEQGQLPLT
FT                   APKRKVQVEGGINHGANLNNSFTFDNFIEGKSNQLAHAAALQVAENPGGAYNPLFIYGG
FT                   VGLGKTHLMQAVGTEMMRHNPNAKVVYLHSERFVADMVKALQLNAINDFKRYYRSVDAL
FT                   LIDDIQFFAGKDRTQEEFFHTFNALLEGGQQMILTCDRYPKEIQGLEDRLKSRFGWGLT
FT                   VAIEPPELETRVAILMRKADESGIKLSYDSAFFIAQKIRSNVRELEGALKRVIANSHFT
FT                   GRAITPDFVRESLKDLLALQDKLVNIDNIQRIVAEYYKIKISDLLSKRRSRSVARPRQV
FT                   AMSLAKELTNHSLPEIGDAFGGRDHTTALHAIRKIKELQDTDSDIREDYKQLMRILTT"
FT   gene            1845..2942
FT                   /locus_tag="Mmwyl1_0002"
FT   CDS_pept        1845..2942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: pau:PA14_00020 DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68945"
FT                   /db_xref="GOA:A6VR66"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR66"
FT                   /protein_id="ABR68945.1"
FT                   /translation="MKFSVVRETLLKPLQLVAGVVERKQTMPVLANVLVEVKDQLLTLT
FT                   GSDLEVELVGHVPLDECEEGRITVPARKLMDICKSLPDSAVIEFTLDDQKAVIRSGRSR
FT                   FSLSTLPADEFPNIQDMQGDLTVSIAQNSVRRLIDRTGFAMANQDVRYYLNGMLLEVAD
FT                   GQLRVVATDGHRLATAVEDAQVSGDLTQVIVPRKGVLELNRLLNDTDEVVELTIGTNHI
FT                   RAKVAEYVFTSKLVDGKFPDYHRVIPRNNEKIVIADRLELRQVFLRASILSNEKYRGVR
FT                   LILSNGMLQVFANNPEQEEAEESVLVQYQGDNMEVGFNVGYLLDVLGVVDSQEVRLSLN
FT                   DSNSSALIEEAQSHAAQYVVMPMRL"
FT   gene            3044..4150
FT                   /locus_tag="Mmwyl1_0003"
FT   CDS_pept        3044..4150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: pst:PSPTO_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68946"
FT                   /db_xref="GOA:A6VR67"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VR67"
FT                   /protein_id="ABR68946.1"
FT                   /translation="MPLVRLDISHVRNLSSVRFEPSPQVNVIVGKNGSGKTSVLEAIHL
FT                   LSFGRSFRSHKHKTYIQHENDACIVFAQLHQKQGSPIRVGLQRHRDGQIDVRIQGQRAQ
FT                   SVIELAERLPVQLINPDAFRLLEGSPSIRRQFIDWGAFHFDKDFIQAWRGWQKALKQRN
FT                   TLLRRGKISLSLLAAFDQELIRLGEQVNQSRKAYVEKLTPHFVKVLSLLTTELSVSLQF
FT                   FQGWDAQKNLAMAVEAGRERDIELGYTHTGPQRADLRVKTATGDALDTLSRGQQKLVVS
FT                   ALKIAQGQLLIDMGRPLVFLVDDLPAELDANHRQKLCQLLESLNSQIFITSVEPDTTDF
FT                   TWADTTDVRQFSMTNGELSLLSKGLQES"
FT   gene            4151..6574
FT                   /locus_tag="Mmwyl1_0004"
FT   CDS_pept        4151..6574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: maq:Maqu_0005 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68947"
FT                   /db_xref="GOA:A6VR68"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR68"
FT                   /protein_id="ABR68947.1"
FT                   /translation="MSENKYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCDTITVLIHPDESISVSDNGRGIPVDIHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSEALTLTIRKNGKVYEQFYAHGVPQAPLAIVGDSDG
FT                   AGTTVHFKPSPATFSNILFVYDILAKRLRELSFLNSGVAIRLKDERTGKEDFFNYTGGL
FT                   RSFVEHLNTNKTPINDIFHFMCQREDLEDGIAVEVALQWNEGFQENIYCYTNNIPQRDG
FT                   GTHLAGFRGALTRTLNTFIEKEGLAKKQKVATTGDDCREGLTAIVSVKVPDPKFSSQTK
FT                   DKLVSSEVKTAVEQEMTKRFSEFLLEKPNEAKIIVNKMIDAARAREAARRARDMTRRKG
FT                   ALDIAGLPGKLADCQEKDPALSEIYLVEGDSAGGSAKQGRDRRTQAILPLKGKILNVEK
FT                   ARFDKMLASVEVGTLITALGCGIGRDEFNADKLRYHSIVIMTDADVDGSHIRTLLLTFF
FT                   FRQMPEIIERGHIFIAQPPLFKIKRGKQEQYIKDEAALDQHLIEVALDGAHMHVNEDAP
FT                   GIQGEHLAKLMRDYIHIEADVDRLARVYPKDVMGKLLYCKPLTQDDLTKEAAVMEWVEA
FT                   IRSQMPQDARTGFRFDFSVEKDEERNIYLPVVDIMSHGVSNRYRFEGTFFNSPEYKRIV
FT                   AMSETVAELFGEESYIQRGERRETVKTISDMKSWLMKEASRGMTIQRYKGLGEMNPEQL
FT                   WETTMDPDARRMLRVTIDDAVAADQMFTTLMGDEVEPRRNFIQDNALNVANLDV"
FT   gene            complement(6658..7503)
FT                   /locus_tag="Mmwyl1_0005"
FT   CDS_pept        complement(6658..7503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0005"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; TrkA-N domain
FT                   protein; NmrA family protein; KEGG: eca:ECA4449
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68948"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR69"
FT                   /protein_id="ABR68948.1"
FT                   /translation="MILVTGASGQLGRLVIASLLEKTAASNIIAAVRNPEKVADLAEKG
FT                   VQVRQADYTDQDSLVAAMQGVEKVLLISSSEVGQRTAQHSNVIHAAKQAGVSLLAYTSI
FT                   LNADKSPLILAKEHVETENLLAESGVPYVLLRNGWYSENYTMGVAGALEHGVVGCAEDG
FT                   KLSTAARADYAAAAAAVLVKDGQAGKVYELAGDNAFTLSVYAAAISKVSGKTVAYQNVP
FT                   EAEFTKILVGAGLPEGFAAILADSEVGASQGALFSDSKDLSTLIGRPTTQIEDSIKAAL
FT                   "
FT   gene            7587..8000
FT                   /locus_tag="Mmwyl1_0006"
FT   CDS_pept        7587..8000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0006"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: sbo:SBO_4232
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68949"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR70"
FT                   /protein_id="ABR68949.1"
FT                   /translation="MENNLQTSQNGMSRLFDKGDVFSDKCPSRDILKHVTSRWGVLVLF
FT                   ALKDGETQRFSELRRKISGVSEKMLAQTLQALELDGFVLRTSYPVVPPHVEYSLTDLGL
FT                   EVSVRVASLADWIEDNITDILAIQSQRNEELAS"
FT   gene            complement(8078..8779)
FT                   /locus_tag="Mmwyl1_0007"
FT   CDS_pept        complement(8078..8779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aha:AHA_1954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68950"
FT                   /db_xref="GOA:A6VR71"
FT                   /db_xref="InterPro:IPR023998"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR71"
FT                   /protein_id="ABR68950.1"
FT                   /translation="MLDGQESLSDKKQSTTNLSAKEPEQALLVLHETLQEAHPETGAPY
FT                   WRIRCWGLACWQPIYLAMICVYQLKAVPLRLQEIEQKQSGEMVAGYFLPDRMWQEGSHE
FT                   TLIKTASEQLNTMFQSFETAHVDAFGGRPALYQGLLADQLMSALIAINNLLPDEQKYSL
FT                   ETDFQLWAQGMNLPLKALAGLSQQETETPVFVRHTCCLHFRRDGGELCTNCPRLHTKSA
FT                   KQKQQNTINQR"
FT   gene            complement(8876..11017)
FT                   /locus_tag="Mmwyl1_0008"
FT   CDS_pept        complement(8876..11017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0008"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: aha:AHA_1953 ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68951"
FT                   /db_xref="GOA:A6VR72"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR72"
FT                   /protein_id="ABR68951.1"
FT                   /translation="MKPSVHFQLTLLALAITSVPSYSLAADASEATDTRSEDQLSALVV
FT                   KGQTYRNTATKTQLDPEETPQAISVIEKEALQQRGTETVAEAVRYTSGINTELRGGAVT
FT                   RLDFFNIRGFENDKAYYDGLQLLYNDWNLQPQIDMAAVEQVEVFKGPTSTLYGAMPPGG
FT                   MVNLISKAPQSESQHSVELTLGSDNKRETQIDSTGAINDTMNYRIVGLLRKKDGQAVTS
FT                   EEERIMIAPSIDWRISKNTMLNLNLYYQKDPSMGIYSTLPSKGTVYSSINGKLSSDAYA
FT                   GDTNWETYDRDVLLLGYKLDHKINNTWSFLQNARFTTAKVYQENTYSSSLDSDERTLNR
FT                   RAYLTDEKSEGINIDNQFSGVFDIGNAEHNVLVGVDYLKLKSDVIYENAVAPSIDLYNP
FT                   NHDQIIRDNLDFAGSGYSSDFTIDKEQTGVYLQDQIRLDQWVFIAGGRYDQFKATEKGR
FT                   KYGAATNTKVDQSQFSGRAGALYEFDNGLAPFISYAQSFEPVTGSDRNGKTFDTSTADQ
FT                   WEAGLKYKKRDITASATAFEITKRNVLTRDPDSTDYSQKVQVGEMQSRGIELELQKAIT
FT                   SDITVKAAYTLQDVEVTKDNSGIEGNTPVWVPKKQFNTWLTYTPTEGRLAGTSLGAGVR
FT                   YVGQMQLDAANSNTVPSFTLVDLSIGYDLSMLSAQWQGASVRFSMSNVFDETYYSCYDE
FT                   SNCWFGDERAFEVSARYEF"
FT   sig_peptide     complement(10940..11017)
FT                   /locus_tag="Mmwyl1_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 26"
FT   gene            complement(11157..12077)
FT                   /locus_tag="Mmwyl1_0009"
FT   CDS_pept        complement(11157..12077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0009"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; transcription activator effector binding; KEGG:
FT                   aha:AHA_1952 transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68952"
FT                   /db_xref="GOA:A6VR73"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR73"
FT                   /protein_id="ABR68952.1"
FT                   /translation="MANQDRLTRIEKVLDYIHENLDESIHVSSLAEKSCWSRWQFQRVF
FT                   GQATGLSVAQYIRELRLSKAAELLLSSKNRHVDIAIQCGFDSEISFSRAFKQMFNCTPR
FT                   DYRQRGKRYGLRTPLQYRCPNKAQTETPKTFTQIRIESRDGFHIQGRSAWIRGLFSASP
FT                   NFSERVPQLWSQVISEVKTVTKGYRPIGIIDTQDHAQHPDQMLYWAGYLEPINTSSPTI
FT                   FSGANPFNTTPLDTVRVPLQEYAVIPVYGKSSAVEKALEWFIYQWLPESNYYGVQGYEL
FT                   EVYEPDYDPSSSKSYMEYWLPIKPR"
FT   gene            12252..13382
FT                   /locus_tag="Mmwyl1_0010"
FT   CDS_pept        12252..13382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0010"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rno:337920 Na+ dependent glucose transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68953"
FT                   /db_xref="GOA:A6VR74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR74"
FT                   /protein_id="ABR68953.1"
FT                   /translation="MKELTRTALYCAMFIAVGAVAGLLGPSLIYLADLIDASVAEISIV
FT                   FTARAIGNILGALLAGRMFDRWQGHHYLIVMLLCMITGLVLVPFSTSLSMLIVLFFLLG
FT                   ATEVSANAGGNMMMLWLHKEKVGSYVTILHLCHSAGSMLAPLILVFAQWTGHGYGAGYW
FT                   MVALYALLLPLLLWRQPSPTFEVRASEVVPATKQKATFLAFLMVIFLYVGFEITIAGWI
FT                   STYAVLSGEDQNTAAILVTWFFVSLSLGRLFSVFLLRWITPRQGIYGLLVVSFSGSLMM
FT                   IFSDASLVVIALWLGLGCSAFFPMLFSYANSIMALNGKRTGYVFVCCGLGALVAPSLTG
FT                   PIIEVFSAAAFPYLLLVLALLIAFSWQRLAGMTRGS"
FT   sig_peptide     12252..12317
FT                   /locus_tag="Mmwyl1_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.685 at
FT                   residue 22"
FT   gene            complement(13459..14016)
FT                   /locus_tag="Mmwyl1_0011"
FT   CDS_pept        complement(13459..14016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0011"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   abo:ABO_0007 histidinol-phosphatase, putatitve"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68954"
FT                   /db_xref="GOA:A6VR75"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR75"
FT                   /protein_id="ABR68954.1"
FT                   /translation="MAQIKPIILLDRDGVINQDSDAYVKSVDEWQPISGSIKSIAALSK
FT                   AGFKVFVVTNQSGIARGYYDEATLHAMHDKMTMLVEAEGGKVNGIQYCPHGPDDNCNCR
FT                   KPKSGMIEAIEAELGLSFEDHPAIMVGDSLRDLQAGNARGCSPVLVLTGKGRETQYKTI
FT                   DFPFSVYTDLAAFTIATLHKYS"
FT   gene            complement(14078..14551)
FT                   /locus_tag="Mmwyl1_0012"
FT   CDS_pept        complement(14078..14551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0012"
FT                   /product="ybaK/ebsC protein"
FT                   /note="TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA
FT                   synthetase associated region; KEGG: aci:ACIAD1670
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68955"
FT                   /db_xref="GOA:A6VR76"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR76"
FT                   /protein_id="ABR68955.1"
FT                   /translation="MTPAINQLKKLKIAFSIHEYEHDPHCSNFGEEAAEKLDLDPACVF
FT                   KTLLVTDDKNTFVTIVPVTGTLNLKRAASALGVKKLHMADVKDAERLTGYLVGGISPVG
FT                   QKKSLITCIDQSAQAFEKIYVSGGQRGLDIGLAPNDLSRACRNAIFAAIGEAK"
FT   gene            complement(14591..16039)
FT                   /locus_tag="Mmwyl1_0013"
FT   CDS_pept        complement(14591..16039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0013"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: hch:HCH_00025 trk-type K+
FT                   transport system, membrane components"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68956"
FT                   /db_xref="GOA:A6VR77"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR77"
FT                   /protein_id="ABR68956.1"
FT                   /translation="MHFSVILRVIGLLVMVFSVSLIPPIIVSLIYSDGALNAFLYALGV
FT                   NLLGGFLLWFPVRNERGELKIRDGFLVTVLFWTVLGLFGSVPFFLAETPDLTFTDALFE
FT                   SISGLTTTGATILTGIDALPQSILFYRQLLTWLGGMGIIVLAVAIMPMLGIGGMQLYRA
FT                   ETPGPVKDTKLTPRIAETAKALWYIYATLTSVCALGYWIAGMSLFDAICHSFSTVAIGG
FT                   FSTHDESIGYFNSVAIEMICTFFMIVSAFNFALHFYAWRHKSVWHYFKDPEARFFLLIL
FT                   SSTVILAILVLAMTSTYDWSTSIRYAVFESVSIATTSGFSTSDFASWPHFLPFLLIVTS
FT                   FVGGCASSTGGGMKVIRILLILKQGMREIKRLIHPNAVIPVKVGGKAINERVVSAVWGF
FT                   FSAYLLVYVVLMIGLMATGLDQVTAWSAVAATLNNLGPGLGDVASSFTSVSDPAKWMLC
FT                   FSMLLGRLEVFTLLVLFTPMFWQK"
FT   gene            complement(16144..17517)
FT                   /locus_tag="Mmwyl1_0014"
FT   CDS_pept        complement(16144..17517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0014"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: csa:Csal_2872 TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68957"
FT                   /db_xref="GOA:A6VR78"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR78"
FT                   /protein_id="ABR68957.1"
FT                   /translation="MKIIIIGAGQVGATLAENLASEDNDITVIDTDLTRLRELQDRLDI
FT                   QTVEGSGSHPAVLDQAGCNDADMLIAVSNQDETNMIACQIAHTLFKTPTKIGRVRSSAY
FT                   ANYPELFVDSAIPMDVRISPEKEVTKHLSRLIRYPGALQVMEFAEGKVQLVVVKAEKGG
FT                   PLIDQPISFLKEHMPSIQTRIAAIYRDGKSISPDGNTQIRANDEVFFLTAQRDVLDVMS
FT                   ELRPLDVPYRRIIIAGGGNIGERLAQSLEKEYRVKIIERDPERCRYLSETLDNTIVLNG
FT                   DASKQELLLEENIESTDVFCALTNNDEANIMSSMLAKVLGVRTVMTIINNPAYVDIVQE
FT                   GMIDIAISPQQTTISSLLSYIRRGDVVNVHSMRKGAAEALEAVAHGDYRSSKVVGRSIA
FT                   NLNLPEGATIGAIVREDDLIVATSELVIQAEDHVIIFVTNKKQIPAVEQLFQVGLTFF"
FT   gene            complement(17921..19309)
FT                   /locus_tag="Mmwyl1_0015"
FT   CDS_pept        complement(17921..19309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0015"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: sde:Sde_0019 Sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68958"
FT                   /db_xref="GOA:A6VR79"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR79"
FT                   /protein_id="ABR68958.1"
FT                   /translation="MNHDNSFPSNTSQSSKSTGQQSARQVAIKVITNILLQQGSLSTQL
FT                   ARHQLDVASEHAPMLKELCFGVCRQYPRLNSIALHLLAHPFEEKDTDLYAVLLLGLYQL
FT                   TYMNTPDHAAVNETVEACRILNKDWATKLMNAVLRRYQREADDIVEILEAQPSVEFNMP
FT                   KWLVKRFNKHWPEHLEEIIEASNTHPPMCIRVNESLVSRETYKEQLLDLGINTEKGEFS
FT                   DSALYLKNAVRVGELPGFDDGYVSVQDEAAQLSAHILSPKAGEKVLDACAAPGGKTGHL
FT                   LEKANSAGLSSMELTAVELESWRMEKIESNLERLGYSAQLICADASDLDAWWDGEHFDK
FT                   ILLDVPCTATGVIRRNPDIKINRKPADIDDLVIIQREILNKVWTTLKSGGFMLYATCSL
FT                   MPEENEQQIQHFLANQEDAKEVALNSLAADLAVEWGIPVSHGRQLFPQANGHDGFYYCL
FT                   LQKA"
FT   gene            complement(19306..20304)
FT                   /locus_tag="Mmwyl1_0016"
FT   CDS_pept        complement(19306..20304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0016"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: ppr:PBPRA3580
FT                   putative Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68959"
FT                   /db_xref="GOA:A6VR80"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR80"
FT                   /protein_id="ABR68959.1"
FT                   /translation="MPTSPLRIIFAGTPEFAAASLQALLTKMKDSNAENQYEIVGVYTQ
FT                   PDRPAGRGQKLVQSPVKQLAIVNDIPVYQPLNFKQDEDKAQLAALEADLMIVAAYGIIL
FT                   PKVVLDTPKFGCINVHASLLPRWRGAAPIHRSLIAGDGETGITIMQMDVGLDTGDMLLK
FT                   AYCDIKPTDTSETLHDRLAVLGGSTLIEALEKFKAGTLVPEQQDESLTCYAAKLTKQEG
FT                   NVNWSSSAELIERQIRGLSPWPVAYTNSLAGVMKIHAAHIASVSDEASTPGDILVVSKE
FT                   GIIVATGQGSILITEIQFAGGKRMKVQDALNGKNKAALEIGQRLGLIEQTA"
FT   gene            complement(20390..20935)
FT                   /locus_tag="Mmwyl1_0017"
FT   CDS_pept        complement(20390..20935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0017"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase; KEGG: psp:PSPPH_0021 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68960"
FT                   /db_xref="GOA:A6VR81"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR81"
FT                   /protein_id="ABR68960.1"
FT                   /translation="MNKDTSLEKIMAVLTVLEYPDKRLRKIAKPITKFTDELQTKIDDM
FT                   LDTMYDENGLGLAATQVDYHHRLVVMDFSEERNEPIVFINPEFEVLDDEPNEFQEGCLS
FT                   VPGFYEHIYRAAKVRVKALDRNGKPFTLEVDELMAVCVQHEVDHLDGKLMVDYLTPLKR
FT                   NRIKSKLEKAHKLAQKQG"
FT   gene            21139..22467
FT                   /locus_tag="Mmwyl1_0018"
FT   CDS_pept        21139..22467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0018"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: sde:Sde_0023 filamentous
FT                   haemagglutinin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68961"
FT                   /db_xref="GOA:A6VR82"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR82"
FT                   /protein_id="ABR68961.1"
FT                   /translation="MSASNVSGLSKTDWLCLSFLSGIGPSRLSRLYTYLSQFDYHASMD
FT                   NAENLPLFSNEELSDTSPSETITYDLLIALKWPEITARQAMDYFSNGILTKEQEAKRDE
FT                   SLAWLEEADHHLVLQEDEHYPTALKEISVAPAFLYVEGNRDTLALPKVGIVGARKCTRY
FT                   GRDATFQFAEQLSARGVCVVSGGAMGVDTAAHQGALYNKTTPTIAVMGTGLFHRYPHHN
FT                   RQMFEEILEQGGALISEYPLSTSPRPHLFPPRNRIISGLSMGVLVSEASLKSGSLISAS
FT                   YAIQQNREVFALPGRLIDPQSEGCHQLLRQGATLVRHVDDILAECSDLSLPSAPITKSV
FT                   NITKRVKSSAAEKNTKNPLSNNRNQTAESMPVLVSNQVHALPESTSDNAKAVIAIMEQE
FT                   AQPMDFDALIRQSKMDAGLMMQVLMELELYGCVENREGLYCRC"
FT   gene            complement(22549..22965)
FT                   /locus_tag="Mmwyl1_0019"
FT   CDS_pept        complement(22549..22965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0019"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   msu:MS2264 ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68962"
FT                   /db_xref="GOA:A6VR83"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR83"
FT                   /protein_id="ABR68962.1"
FT                   /translation="MSKPEKQSAPQAVRLDKWLWAARFFKTRSLCKDAIDGGKVSYNGS
FT                   KGKASRNVEIGALIGIRVGWDEKVVKIKDISGQRRGAPEAQLLYEETPESIEKREKRAL
FT                   ENKSFGGRIMSDHKPNKKERRDIKQLKKDIFSDM"
FT   gene            23010..23870
FT                   /locus_tag="Mmwyl1_0020"
FT   CDS_pept        23010..23870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0020"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: abo:ABO_0280 inositol
FT                   1-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68963"
FT                   /db_xref="GOA:A6VR84"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR84"
FT                   /protein_id="ABR68963.1"
FT                   /translation="MQDISKHPIFQALQKIIHDAADVIMDIYQRADLGIEQKPDDSPVT
FT                   AADLAAHKVILAGLQALTPDIPVLSEESSEERQVTFEERSKWPVLWIVDPLDGTKEFIK
FT                   RNGEFSINIALVENGAPILGVVYIPTTTEGYFGVTKVWQGLPVGAFKWQGDEYESINVR
FT                   EPREPIIAMTSRSHGPALPASLKNKLKQSYEQVRELPKGSSIKGCRIAEGIADLHLRRG
FT                   PTSEWDTAAQQAIIEAAGGMLVTPDGKPFRYNQRETLLNGHFFVSGAELAPYVMNWYLE
FT                   NEEEE"
FT   gene            complement(24000..25592)
FT                   /locus_tag="Mmwyl1_0021"
FT   CDS_pept        complement(24000..25592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0021"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: rsq:Rsph17025_0029
FT                   alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68964"
FT                   /db_xref="GOA:A6VR85"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR85"
FT                   /protein_id="ABR68964.1"
FT                   /translation="MNLTEQEWWRGSVTYQIYPRSFMDSNGDGIGDIPGITSRLDYLAD
FT                   LGVDAIWLSPIFTSPMKDMGYDVSNYIDIDPSFGTLSDFDEMIAKAHNLGLKVIIDQVL
FT                   SHTSDQHPYFLESRQNQTNDKADWYIWADAKPDGSPPNNWLSIFGGTGWQWDSRRKQYY
FT                   MHNFLRQQPDLNFHNPNVQEWILSTVRFWLERGVDGFRLDTVNYYFHDKLLRDDAADFR
FT                   QKSVADWNPYHMQYHLFSKNQPENLVFLKKFRALLDEYGATTSVGEVGESHHPIEMMGE
FT                   YTTDKRLHMAYSFEMLGHSFSPKHFSKQITDFFRLAPKGWPCWAFSNHDVVRHVSRWKK
FT                   HAEDPTALAKQACALLLSLEGSVCLYQGEELGQQETDLNYDELVDPQGIEFWPEDKGRD
FT                   GCRTPMSWDNSEFSGFSSSTPWLPVKETQRQLNVADQQNDPSSVLNFYREMLAFRKQNS
FT                   VLRNGNTLFINDDNSLLAFVRGDTMLCIFNLGNQSITYQNTTEFNQCIKVGNTKVEGKA
FT                   LVLGTNGFAFLTK"
FT   gene            complement(25594..26622)
FT                   /locus_tag="Mmwyl1_0022"
FT   CDS_pept        complement(25594..26622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0022"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: pde:Pden_4439 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68965"
FT                   /db_xref="GOA:A6VR86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR86"
FT                   /protein_id="ABR68965.1"
FT                   /translation="MAKIELKNLSKTFGSTDVIRGVDLTINAGELMVFVGPSGCGKSTL
FT                   LRLICGLEDITSGELLFDGVSMNDKVPSERGIAMVFQSYALYPHMSVYKNMAFGLKLAN
FT                   VSPQEMKNRVLEAAKMLQIDHLLERLPKQLSGGQRQRVAIGRAIVRDPRVFLFDEPLSN
FT                   LDASLRVDTRLEIAKLHHKMKDTTMIYVTHDQVEAMTLADRICVLRDGNIEQVGTPEEL
FT                   YSHPKSLFVAGFIGSPKMNFLTGNIAEQHYCHTLGIRPEHLVVDQQNGIWSGEVVHTEN
FT                   LGSDFFVFIDLGTSEPLVVRLDGQERIQLGSRLKVRPLEKHLHRFDNNGLPIPSKSYQE
FT                   AI"
FT   gene            complement(26635..27468)
FT                   /locus_tag="Mmwyl1_0023"
FT   CDS_pept        complement(26635..27468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0023"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_2962 probable
FT                   trehalosemaltose transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68966"
FT                   /db_xref="GOA:A6VR87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR87"
FT                   /protein_id="ABR68966.1"
FT                   /translation="MTNKALFKKAAFYSVVVVIVLISVFPFYYAILTSLKTGSDLFKVN
FT                   YFPSSFNFSNYIDVLNNGQFIRNTLNSVFIASTTVIFALFLAVTASYALARVRFKGRGL
FT                   LLMAILAISMFPQIAVLAGLFELIRFIGIYNTPWAMILSYTIFTLPFTVWVLTTFMRDL
FT                   PVEIEEAAIVDGATPWVIITQIFMPLLWPALVTTGLLAFIGAWNEFLFALTFTASETMR
FT                   TVPVAIAMLSGSSQYETPWGLIMAASVLVTIPLVILVLIFQRKIVSGLTAGGVKG"
FT   gene            complement(27465..28427)
FT                   /locus_tag="Mmwyl1_0024"
FT   CDS_pept        complement(27465..28427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0024"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pde:Pden_4441
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68967"
FT                   /db_xref="GOA:A6VR88"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR88"
FT                   /protein_id="ABR68967.1"
FT                   /translation="MFKKHILTTPEVSSLQRQKLRAAFWFLAPMLLVLFCVAAWPLLRS
FT                   IYFSFTNTSLTNLYGGEWVGFKNYLTWKTFSSGRTIYSGTLADPAWWNAVWNTVRFAVV
FT                   SVSLETIIGLMVALVLNAEFKGRGLVRAAILIPWAIPTIVSAKMWAWMFNDQFGIINDM
FT                   LLSVGLIDHKIAWTANLDTAMLSVLIVDIWKTTPFMALLCLAGLQMIPRDMYESAKIDG
FT                   VHPIKVFFQVTLPLVKPALMVAVIFRTLDALRMFDLIYVLTPNSKATKTMSILSRENLI
FT                   EFDKFAYGSAQSTLLFAIIAIFVALYIWLGKLDLSGEKS"
FT   sig_peptide     complement(28311..28427)
FT                   /locus_tag="Mmwyl1_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.770 at
FT                   residue 39"
FT   gene            complement(28499..29767)
FT                   /locus_tag="Mmwyl1_0025"
FT   CDS_pept        complement(28499..29767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0025"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pde:Pden_4442 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68968"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR89"
FT                   /protein_id="ABR68968.1"
FT                   /translation="MRNPWEFIKPSLLSISIVASAAQATEVVLVSGAVGKDIEVLKEVV
FT                   KPWEKSTGNKLTVFPMPASTTDQFGQYRLWLAAGNADIDVYQTDVIWAPQLANNFVDLT
FT                   PYTRDIVDQHFPSIIESQTTNGKLVALPIFTDAPALYYRKDLLKKYNKPVPNTWGELTE
FT                   TAKYIQTKEREAGNSDMWGFVWQGNAYEGLTCDALEWVKSFGGGQIVEADGTISINNPN
FT                   AVAALKMAKSWVGDISPAGILAYQEEDARGVWQTGNAVFMRNWPYAYSLGNTEESAIKG
FT                   KFGAAPLPSGTSQNKSAATLGGWNVAVSKYSKHKEASISLAKYLASEEVQKYRALHSSN
FT                   LPTIISLYDDKDIKEQQPIIAQWKDVFLHAVPRPSAPTKIKYNEVSSKFFSAVHSTLAG
FT                   SGSAEENLEVLEYELETLKGNTW"
FT   sig_peptide     complement(29693..29767)
FT                   /locus_tag="Mmwyl1_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            30008..30973
FT                   /locus_tag="Mmwyl1_0026"
FT   CDS_pept        30008..30973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0026"
FT                   /product="regulatory protein LacI"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: tma:TM1200
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68969"
FT                   /db_xref="GOA:A6VR90"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR90"
FT                   /protein_id="ABR68969.1"
FT                   /translation="MSNKSVTIHELASLAGVSIASVSRALNGKPGISEALRARIISLSE
FT                   EINYKPNVMARQLISGKTPIVALCMPPSPYEFSDRPYFVHLYQALTLYLHRKGLVPVLF
FT                   AYENIEEVFSQASSAILLGATEDDRPEIFDRQKFPYVTLETGVGASVVIDEANGVYKLT
FT                   HYLFKKGRKNMLFLGENIDISTSQGRLRGYRKAIGELGLQENFDNVPRQISSSLSAYRQ
FT                   MMEHFQSSEPFPYDAVICANDELAVGVIQAAEDAGYKVPEDISVTGFDDLPRFSNKITT
FT                   IHQDIPKIAEAAVSLLSEQLDGLPPRVVEVMTRLVSRESA"
FT   sig_peptide     30008..30094
FT                   /locus_tag="Mmwyl1_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.464 at
FT                   residue 29"
FT   gene            31137..31916
FT                   /locus_tag="Mmwyl1_0027"
FT   CDS_pept        31137..31916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0027"
FT                   /product="protein of unknown function DUF1037"
FT                   /note="PFAM: protein of unknown function DUF1037; KEGG:
FT                   mlo:mll3105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68970"
FT                   /db_xref="InterPro:IPR009381"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR91"
FT                   /protein_id="ABR68970.1"
FT                   /translation="MTIKVTVWGENVHEKTNKVVARIYPDGMHNCIAAGLNEDQDIEAT
FT                   SVTLQDKEHGLTEEKLENTDVLIWWGHAAHGDVADEIVDRVQKRVLEGMGLLVLHSGHY
FT                   AKIFKRLMGTTCSLKWREAGERERLWVVNPGHPIVQGVGDYIELPHTEMYGEPFAVPNP
FT                   DEVIFISAFEGGEVFRSGLVYRRGNGKIFYFRPGHETYPIYYDDKVKRVLKNAVKWSQP
FT                   EGSRWIDSCPCVPADQAPNPIEVKGEGLHKPGEEGFK"
FT   gene            31916..32965
FT                   /locus_tag="Mmwyl1_0028"
FT   CDS_pept        31916..32965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0028"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: atc:AGR_L_2956 probable trehalosemaltose
FT                   utilization protein, function"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68971"
FT                   /db_xref="GOA:A6VR92"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR92"
FT                   /protein_id="ABR68971.1"
FT                   /translation="MIRIGIIGTGGMARVHAEEFSKIANCEVVAACDLNASRLASFVEA
FT                   HNIPYAFGSVEALLSSGQVDAVSIVTPDPFHKKLSIQALEAGMHVLCEKPLALNASDAK
FT                   EMADAAKKAKCINMVNLSYRNAHSLQKARELIAMGRIGNIRHVEASYLQSWLVSPKWGD
FT                   WKTEDTWLWRLSSAHGSKGVLGDVGVHILDFVRFPVGDFASVNCTLTTFDKAENNQIGE
FT                   YHLDANDSALITARMNNGAMASIHASRWATGHLNDLRLVIHGDKGAVKVSLKLDQEWDR
FT                   LEVCLDDDVIDCVWKELKCDHTPNIYQRFIQSILSGVQDQPDFEAGLQVQRVLDACEQS
FT                   DQSGKTVLL"
FT   sig_peptide     31916..31969
FT                   /locus_tag="Mmwyl1_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.721 at
FT                   residue 18"
FT   gene            32992..34113
FT                   /locus_tag="Mmwyl1_0029"
FT   CDS_pept        32992..34113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0029"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bra:BRADO0445 putative
FT                   oxidoreductase/dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68972"
FT                   /db_xref="GOA:A6VR93"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR93"
FT                   /protein_id="ABR68972.1"
FT                   /translation="MAILRWGMVGGGDGAFIGDVHRMAARLDGGYQLVAGCFSSNFERT
FT                   KASAKLLGVEADRAYSDFNAMAEVESQREDGIQVVSIVTPNFLHYDNVKAFLDHGIAVI
FT                   CEKPLTVSLLQAQELQTLAKERNTFLAVTYNYVENPMVKVARELVKNGELGELLMVDAY
FT                   YLQDWLAADIENSDQKQAAWRTDPAKAGRAGCLGDIAIHAYNLVSYLIGYSASSVNARL
FT                   ATFVAGRRVDDHADIQLGYSDNILQGRILASQVMTGHENDLGFRLTGRGATLEWRQEDP
FT                   NVLWFKPMGAPAQRLTRNGAGYPERLNALCRIPAGHPEGYLEAFANVYKHIRLALSEKD
FT                   FLYYPNVDQVVKDMGFVEACLQSHDQGNWCEVE"
FT   gene            complement(34144..34734)
FT                   /locus_tag="Mmwyl1_0030"
FT   CDS_pept        complement(34144..34734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0030"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hch:HCH_03198
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68973"
FT                   /db_xref="GOA:A6VR94"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR94"
FT                   /protein_id="ABR68973.1"
FT                   /translation="MSYTPRHKEQTRQRILQAAAKLFCSNGFDRVTLTQIMKKANMTHG
FT                   AFYAHFSGKSSLYEAAMQFATSNGFWARNDKKTESNETHLKALVTRYLSWSRNDKEHPS
FT                   PLEFLVTDAAHKEEKVRQAYQACFDSLVERLAEILKKRGSQEAEALAEETVVSLVGTVA
FT                   IARSFDKPLQTDFLKRAQERIVNRLNSGIKNSA"
FT   gene            34864..36132
FT                   /locus_tag="Mmwyl1_0031"
FT   CDS_pept        34864..36132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0031"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: csa:Csal_2911
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68974"
FT                   /db_xref="GOA:A6VR95"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR95"
FT                   /protein_id="ABR68974.1"
FT                   /translation="MSLKERIVITGMGLVSPLGLGVASVWDRLVRGESGIRLLPTTLSE
FT                   GLNTHIAGQVPSHTEQANGLNESDYLSPKDRKRVDLFTLFALAAAEEALSQANWHPTSV
FT                   DDQEATATIIATGIGGLPTITQAHTTLVEQGARRLSPFTVPAFLANLAAGNVSIKHGFK
FT                   GPIGTPVTACAAGVQAIGDAMRLLRTGEAKVALAGGTEACIDPLSLAGFGALKALSTRN
FT                   DDPEKASRPFDKDREGFVMGEGAGLVVLETLEHALARGATPLVEIVGYGTSGDAYHLTS
FT                   GPENGEGAARAMQTALNMAGITADQIGYVNAHATSTPVGDRGEINALRRVFGEKVTEVA
FT                   ISSTKSATGHLLGAAGGVETIFSAQALITGVLPPTLNLENPEDSMADLDLIPLVSREKS
FT                   VEYVLCNGFGFGGVNAAIILKRY"
FT   gene            complement(36221..37543)
FT                   /locus_tag="Mmwyl1_0032"
FT   CDS_pept        complement(36221..37543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0032"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: pin:Ping_0572 TRAP
FT                   dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68975"
FT                   /db_xref="GOA:A6VR96"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR96"
FT                   /protein_id="ABR68975.1"
FT                   /translation="MISIELLTAILFACIIVSFALGAPVGLALGGIAMGIGYMTWGDAL
FT                   FNVIPTTLESTHFSFILLAIPLYIYMGQLLTRSGIGDAMFNASQMLIGRVRGSLAISVI
FT                   VVCSMIGAMVGIIGAGIMTSGSIALRPMLERGYDKRLALGVIMAGGGLGILIPPSIPMI
FT                   MFASSTQNSVGRMFIGALIPALITVVLLIAYVVISCKLNPKRAPMDVVPEVQPTPKEKF
FT                   LTARDGLLSLLLIVAVLGSIIMGIATPTESGAIGVVGAIVLAIFFKRFKPRMVQKAGMQ
FT                   AALLVSVAMWIIVGASVFSNFHLLMGVQNMVAGFTQDLGLPPIVVIMLFQLIMLLLGFI
FT                   IDEFIIVLMCAPIFTPIAVSLGYDPIWFGILMILNIEIAVQTPPYGFALFYLKGIAPPN
FT                   ITMLDIYKSITPFVLLKLFVLIIVMMFPELVTWLPNQLMDG"
FT   sig_peptide     complement(37475..37543)
FT                   /locus_tag="Mmwyl1_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.927 at
FT                   residue 23"
FT   gene            complement(37540..38103)
FT                   /locus_tag="Mmwyl1_0033"
FT   CDS_pept        complement(37540..38103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0033"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: pin:Ping_0571 tripartite
FT                   ATP-independent periplasmic (TRAP) C4-dicarboxylate
FT                   transporter subunit DctQ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68976"
FT                   /db_xref="GOA:A6VR97"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR97"
FT                   /protein_id="ABR68976.1"
FT                   /translation="MIMTAIRRYCLGVHALVAFIGNSVSYLMPVLAFVVAFEVFSRYIL
FT                   DSPTIWAYDTSLFIFGYIAALGGAYAQQQRAHINVDILYNKVSARTKSIFNLFSFALAM
FT                   FFMVIVCKMSIGKFEEALEFNYRRQSEWAPHMHHYWLMMAVASVLLILQLSSDWIDALH
FT                   QAITGKPLIEKPLENESEEEGIAP"
FT   gene            complement(38181..39206)
FT                   /locus_tag="Mmwyl1_0034"
FT   CDS_pept        complement(38181..39206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0034"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: pin:Ping_0570 TRAP dicarboxylate transporter-DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68977"
FT                   /db_xref="GOA:A6VR98"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR98"
FT                   /protein_id="ABR68977.1"
FT                   /translation="MIKAILKVKKRLVVSSLAVALGLGAVASSANAADYNWRFANLYSR
FT                   GSAFGAVYEDLAKNIETMSDGRIKVQVLYDGEGVGSSGIFGAVKTGLITMGATFQSLNA
FT                   GELPAGLVEIGLPGGTSDVGELTTLFQEKGWAPILKEAYGAQGLVWLDPYIQPAVYVIT
FT                   KKPINSIEDFQGLKIRAPGAYGKFLRNLGASPVSLAWSEIYTSLSTGVIDGSIGSNMID
FT                   HRDGNHVEVAKYMYPLPLAGAQVLPIIVNQSAWNKLPADLKAIVKAATTVHAQEQMTKS
FT                   RLWESEAIADMEAKGLQWSPEPSAADKAAWKAAGAKLWDEYAAADKYSKELIDVLRKEQ
FT                   K"
FT   sig_peptide     complement(39108..39206)
FT                   /locus_tag="Mmwyl1_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            40065..41003
FT                   /locus_tag="Mmwyl1_0035"
FT   CDS_pept        40065..41003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0035"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rfr:Rfer_0374 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68978"
FT                   /db_xref="GOA:A6VR99"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VR99"
FT                   /protein_id="ABR68978.1"
FT                   /translation="MSVKNYSLGQVGDYEIKQLKVFKTVVDCGGFSAAETSLNIGRSTI
FT                   SLHISNLEARLNLVLCKRGRGGFSLTEEGLIIYQMTENLLESLDAFRTTVNNLNVSLTG
FT                   KLRLALSDKVSLDPRSHFPELIQRFSTEAPEVSITTNVSSMSNIERMILNDEADIGFIP
FT                   YHRKLDGLSYVHLYSDDCFLYCGKDHPLATMSVEDQDEKVDKYPATHAGLKPHEAVSEQ
FT                   ISQMNLTAISYFYDSRLALILSGRYIGFLPERYAASYVESGQIIAVAPENRSYTLGVAV
FT                   ICKKTTQPNKPRELFLKVLHQTVEELISAPY"
FT   gene            complement(41014..41781)
FT                   /locus_tag="Mmwyl1_0036"
FT   CDS_pept        complement(41014..41781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0036"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: sit:TM1040_3872 GntR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68979"
FT                   /db_xref="GOA:A6VRA0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA0"
FT                   /protein_id="ABR68979.1"
FT                   /translation="MAYQIISNITTKNIPMAERLYREIGESIKQEIAKSSLKIGDKLPT
FT                   ERVYAELFGVSRTLVREAFIMLEIEELIEVRKGSGSYLKNNLSLKTSHKVSDVGPFELL
FT                   QARQEIESSIAACAAPVITKQDLQKLQDILDIESAELETVEKANDADRDFHLSIAQATQ
FT                   NTVLLDTATRLWDMRDGNPMWKKLHARIQDTSYHDQWLDDHKKVLIQLRKRNAEGARQA
FT                   MWQHLENVKQTLFKLSDTDAPDFDGYLFAQPHN"
FT   gene            41953..43164
FT                   /locus_tag="Mmwyl1_0037"
FT   CDS_pept        41953..43164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0037"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: csa:Csal_2974 mandelate racemase/muconate
FT                   lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68980"
FT                   /db_xref="GOA:A6VRA1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VRA1"
FT                   /protein_id="ABR68980.1"
FT                   /translation="MKIRSAKVIVTCPGRNLVTLKIETDEGVYGIGDATLNGREKSVVS
FT                   YLEDHVIPTLIGKDPQRVEDIWQYLYRGAYWRRGPVGMTAIAAVDVALWDIKAKLAGMP
FT                   LYQLLGGKSREKVMVYGHATGLDIESCLEEVRKHVELGYKAVRVQCGIPGIPTTYGVSK
FT                   EAGKPYEPADSALPAEHVWSTEKYLNNVPELFAAVRKEFGEDLHILHDVHHRLTPIQAA
FT                   RLGKEVEKFHLFWLEDCTAVENQSSYELIRKHTTTPLAIGEVFNSLSDCQELIQNQLID
FT                   YIRATITHAGGITNIRRIADFASVFHVKTGFHGATDLSPVCMGAALHFDTWVPNFGIQE
FT                   HMPHTKETDLVFPHAYEFNDGFFTPGDVPGHGVDIDEEIAAKYPYKPAYLPVNRLEDGT
FT                   LWNW"
FT   gene            43171..44193
FT                   /locus_tag="Mmwyl1_0038"
FT   CDS_pept        43171..44193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0038"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   csa:Csal_2975 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68981"
FT                   /db_xref="GOA:A6VRA2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA2"
FT                   /protein_id="ABR68981.1"
FT                   /translation="MKAFQVANVNDYALIDTLQPVAEAGEVLIKTAFAGICGSDLHIIH
FT                   GQNPFVQFPRITGHEFSGVVAAVGEGVTHVKIGDKVCVDPVISCGECYACRAGRFNVCA
FT                   KLQVFGVHRNGGFGEFTSAPASNVLVLPDNVTLEQAALVEPYSIATNVLSRMEPIPGDT
FT                   LLVYGAGVIGLTIVQVAKAMGIERIIVTDIVDERLETAKSLGATDVINSREHKVEDCIR
FT                   EWTNGEGVPLIADAACIPALLPEILRIACPAGRIGLLGFSTTPSDLAQIEVIKKELTIV
FT                   GSRLNNRRFPQVLEMIASGRLDPLALISHRIALNDIGDGIQLMEKHPELTRKVLVEMSE
FT                   "
FT   gene            44291..45253
FT                   /locus_tag="Mmwyl1_0039"
FT   CDS_pept        44291..45253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0039"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: mta:Moth_0422 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68982"
FT                   /db_xref="GOA:A6VRA3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA3"
FT                   /protein_id="ABR68982.1"
FT                   /translation="MNIKKLLIASVSFVSLSANAESYKLNMSTVLAPNNPLTKGLFHFK
FT                   KEVESATNGDFKINVFPSGSLGGTNDLVEQARAGSNVSMMADPSRLQNYVSDFGVLASP
FT                   YVFESLEQLQKYYKSDAFKELEAELQRKGGLVILSANWFQGTRMLITKKPVSTPADAKG
FT                   MRIRAAGSTIGVKTVEILGGTATPMPWNEAYTALQQQVIDGVEVHPAAFYDSKLYEVAD
FT                   YIQPTNHTFLMTYLVVGEQWFKSLPEGYQTLLKEKASETGDFVTANILKNEQFYIDESV
FT                   KHGMTFHDVDIKKFQENSKGLFESIGLSDEYKKVEESLK"
FT   sig_peptide     44291..44353
FT                   /locus_tag="Mmwyl1_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            45303..45803
FT                   /locus_tag="Mmwyl1_0040"
FT   CDS_pept        45303..45803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0040"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: mta:Moth_0423 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68983"
FT                   /db_xref="GOA:A6VRA4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA4"
FT                   /protein_id="ABR68983.1"
FT                   /translation="MFNRISRSIYHIEVILSQIILTLIVILVFFAAAARSMDYPIIWSV
FT                   EIAKIFFMIVCFLCIDLTLKKNKHIGITYFIEKLNEKAQNIFQLFVLILMLVFTIFSIT
FT                   KGVELIHVYKFRMFNATGIPYRYIMPVIPLSMFLMSITIIAHMETCIKKLGNYKSNKEK
FT                   AEV"
FT   sig_peptide     45303..45413
FT                   /locus_tag="Mmwyl1_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.727 at
FT                   residue 37"
FT   gene            45805..47085
FT                   /locus_tag="Mmwyl1_0041"
FT   CDS_pept        45805..47085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0041"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: mta:Moth_0424
FT                   TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68984"
FT                   /db_xref="GOA:A6VRA5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA5"
FT                   /protein_id="ABR68984.1"
FT                   /translation="MLTLIIVFFALIFIGMPVSFSILISSAIYFHFIGELPFTIFYQKM
FT                   ASPTQNFALLAVPLFILVGNIMNETGIAARLFHFTKYVVGWMAGGLAQISIFMSAILGG
FT                   VSGSAVADASMQSRLIGPEMERKGYPVPYSANVIAYSSLITGLFPPSISLILFGFVGNV
FT                   SIGKLFLAGIVPGLLLTFMQMLLSWWIAKYYKIQPELPGLPKFKDVSHSARINKWALLF
FT                   PVFLLFVIRLGIFTPSEAGAFVVVYALIVGRWVYKELTFNGLKKALKNSAVDLGMVMFL
FT                   IMAAGALGYAIILEQLPVAAGDFISSVTSNQYLILILCLLLVLIFGMILDGSVCILLLT
FT                   PIILPVLTSIGYDPVHIGIVMTTTILIGANTPPVGICMFTVCSLLKCKTEDFFKSSIPF
FT                   ILTFILFLILLTIFPDISLMLPSTLME"
FT   sig_peptide     45805..45870
FT                   /locus_tag="Mmwyl1_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.374 at
FT                   residue 22"
FT   gene            47089..48138
FT                   /locus_tag="Mmwyl1_0042"
FT   CDS_pept        47089..48138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0042"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   pol:Bpro_3972 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68985"
FT                   /db_xref="GOA:A6VRA6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA6"
FT                   /protein_id="ABR68985.1"
FT                   /translation="MKFTYFNRNELKSLGTKLLSQYGMPDDRASITAELLIQSDELGFT
FT                   THGLSLIPYYIPELQAGKMQEADDVVVVNDTGSTFVWNAQYLPGIWMMNKAMDEAFSRV
FT                   KEHGVVTASINRAHHIGCLSTYVKLATDKNLICIVSTSDPAGKLVAPFGGIDPVLTPNP
FT                   WAIGYPTNGDPVIIDTVTSICTFSKVREHLNTGLPMPYPMLQDKNGNETTDATVINDGG
FT                   AILPIGGTDYGHRGYCFSIMVEMLTQGLSGHGRADDVSRWGGNVYIQLIDPEAFAGLEA
FT                   FKEQMDKLTELCLASRPREEGKPVRVPGQFGLSCAKQSKTQGIRLNDETLDRLKQSAEA
FT                   AGIEFPKSI"
FT   gene            48273..49229
FT                   /locus_tag="Mmwyl1_0043"
FT   CDS_pept        48273..49229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0043"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: csa:Csal_2976 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68986"
FT                   /db_xref="GOA:A6VRA7"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA7"
FT                   /protein_id="ABR68986.1"
FT                   /translation="MIKPMLKVAVMSSILLAGLSQAADVTLKFGYPANEDNIWHKAALK
FT                   FKEVAETKSNGRIDVKLYPNEQLGKEMDVINSIQLGTADMTITGESLQNWAPKAALMAV
FT                   PYAFTSSEQLKKAVDGEVGKEISEQISERTGLKPIAWFERGPRHLTSNRKILSPSDLDG
FT                   LKLRVPNVPLFVKTWQSLGAKPIPMAFSEVFTALQQNTIDGQENPLSLINSASFYEVQK
FT                   YVNLTGHVRSWIYVVIGQDKLNSMPADLRDIVLDAGKQMQSYEHSMFAADEAQLRSTLE
FT                   ARGMEFVQPDLEAFKEAAQKAVQEALTPEQLALYKKI"
FT   sig_peptide     48273..48341
FT                   /locus_tag="Mmwyl1_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            49315..49860
FT                   /locus_tag="Mmwyl1_0044"
FT   CDS_pept        49315..49860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0044"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: csa:Csal_2977 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68987"
FT                   /db_xref="GOA:A6VRA8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA8"
FT                   /protein_id="ABR68987.1"
FT                   /translation="MSVSSQINNPKDFLSRLEASVQWLLRIVDWVFSVLAVSALLAITV
FT                   VVVLQVVSRFLLPSSPIWTEELSRYLFVYLIVMGSGLVIRHNRHVRLELYQGALNRFWN
FT                   KVYQIFCHVLAGSFAIYILPYAIKYAQIGRWQTSPALEVPMYWAFLSVTFFFALTAFYS
FT                   FMGVLLVLLERDDQGVAS"
FT   gene            49860..51134
FT                   /locus_tag="Mmwyl1_0045"
FT   CDS_pept        49860..51134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0045"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: csa:Csal_2978 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68988"
FT                   /db_xref="GOA:A6VRA9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRA9"
FT                   /protein_id="ABR68988.1"
FT                   /translation="MEVILLFLVFFLLLFVGVPIVFCLGIASLTYLTMVGIPLTIVPQR
FT                   LYAGMDSFVLLCIPGFILAGNLMNVGNITDYIIRFSNALLGHIRGGLGLANVGGSMIFG
FT                   GISGTAVADTASIGAVMIPGMARSGYDKPFAAAVTAASSTIGPIIPPSVPMIIVGSLSG
FT                   ISVGKMFLAGVVPGLMLGLAMMITAYIIAVKRQYPREKRATLKEIYIVGKGAFWALLMT
FT                   FIILYGIIGGLFTPTEASIMASLYAFVVGMFVYKGLTWKNLPKLLVDTVLSSTSLLLLV
FT                   GMANLFGWILTSEQIPQMLASAIFSISENPFVVILIINIVLLIVGGFMETIAALIILFP
FT                   TLLKVAEGIGMDPIHFGVMAVLNLIIGLTTPPVGVCLFVAAGISELPMTTIVKAIWPFL
FT                   LCNLFVLLLVSYIPAISLWLPSLLG"
FT   gene            complement(51182..52132)
FT                   /locus_tag="Mmwyl1_0046"
FT   CDS_pept        complement(51182..52132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0046"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vvy:VVA0215 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68989"
FT                   /db_xref="GOA:A6VRB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB0"
FT                   /protein_id="ABR68989.1"
FT                   /translation="MSNRVTHLKAAHYFSVASQTLSYTKAAKQLHVSQAAVSQQIRLLE
FT                   EYLGVPLFYRSGRDMRLTSQGLELAEHLTQAFDFISKGLDSVKLEPVEGTLLVSGLQSF
FT                   VSLWLMPRLWRFSDLQKDITVKLFSADERIDIHAGNIDVGIDDNKHLSINSQNTTKRTL
FT                   ISSDIIPVCSPSLAERIGLYQPTDLLKCWMIQVDDSSYQWKTWFEELAICPIRSKSILW
FT                   AEVNSWYMGISAVKAGHGIFLCPKFMVQKELDEGTLVPAYPKALNEKIEFYAYYAKNSP
FT                   RKARIEAFVDWLREESNGQNNAPIKTEPHQPLPWP"
FT   gene            complement(52619..53896)
FT                   /locus_tag="Mmwyl1_0047"
FT   CDS_pept        complement(52619..53896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0047"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase class-III; KEGG: slo:Shew_3172
FT                   4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68990"
FT                   /db_xref="GOA:A6VRB1"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB1"
FT                   /protein_id="ABR68990.1"
FT                   /translation="MNNADLQKRKEIAIARGQGNMAPVYVDRAVNAEIWDVEGKRHIDF
FT                   GAGIAVVNTGHNHPKVKAAVLAQVERFTHTCVMVSPYESAVALAEKLNAAAPGNTPKKS
FT                   IFVTTGAEAVENCVKIARAYTGRPGIIAFNGGFHGRTNMTMGLTGKVNPYKIGFGPFPS
FT                   DIFHIPYPNDYLGITEEQALADLQLRFTCDIEPSRVAAIIIEPVQGEGGFYQASASFLQ
FT                   KLRKLCDDHGILLILDEIQSGFARTGTMFCHEQADIEADLITAAKGIAGGFPLAAVVGK
FT                   ANIMDAPIPGGLGGTYGGSPVGCAAGLAVFEAIEEEKLCDRAVEVGAHFVKHLTEMQTE
FT                   YPSIIGDIRNAGAMIAVEFVHDGDVNKPYPELAKKLSAKAAENGLVLLSCGIRGNVIRF
FT                   LPALTIEMDIIDEGMDIFKRCFKELV"
FT   gene            complement(53989..55455)
FT                   /locus_tag="Mmwyl1_0048"
FT   CDS_pept        complement(53989..55455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0048"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: azo:azo1920 probable
FT                   succinate-semialdehyde dehydrogenase [NAD(P)+]"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68991"
FT                   /db_xref="GOA:A6VRB2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB2"
FT                   /protein_id="ABR68991.1"
FT                   /translation="MTAILSQPSLLKSRSYIGGEWVEAKSGKTFAITNPANGEHIIDVA
FT                   DLGAEETTLAVEAAEKAQKEWQGRTAKERATLLRRWNQLILDNQDDLATLMTLEQGKPF
FT                   AEAKGEVAYGASFIDWFADEARRLNGDVIPTFAKDKRVLTIKQPIGVVAAITPWNFPIA
FT                   MITRKAGPALAAGCAIVIKPSDETPLCALALAELAHQAGIPAGVLNVVVGKDAKAIGGV
FT                   LTGHPTVRKLSFTGSTPVGKLLLSQCAQTVKRTSMELGGNAPFIVFDDADLDAAVEGAI
FT                   ASKYRNAGQTCVCANRILVQEVVYDIFAEKLAKRVATFKTGDGFAEGVNIGPLINPAAI
FT                   SKVELLVGDAITKGAKALIGGSKATAAGAQFFEPTILTGVTEDMDIFSNEIFGPVAPLF
FT                   KFKTEDEAVAMANNTPFGLASYFYSQNIARIWRVSEALEYGMVGINEGIISSEVAPFGG
FT                   VKESGSGREGSQYGIDEYVEIKYLCMGGLA"
FT   gene            55940..58051
FT                   /locus_tag="Mmwyl1_0049"
FT   CDS_pept        55940..58051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0049"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: vpa:VPA1656 ferric vibrioferrin receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68992"
FT                   /db_xref="GOA:A6VRB3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB3"
FT                   /protein_id="ABR68992.1"
FT                   /translation="MFIQESSVLSSTTFRYSILACSMMFGLSAQAASDVTELKALTVNA
FT                   SVIGESKESDVKEYAGSRTVISAEQMTKTAAKSIDDALQQVPGVKVQDETGTGVLPNVS
FT                   VRGLSASRSGQAQFLMDGVPLTLAPYGHTGQSVFPATLLSLERIDVVRGGAAVQYGPNN
FT                   VGGVINLVTRPIPKDWESQISNRITGFEHSNNTLNNLYLRTGGWVNDDFAIQIEANTQN
FT                   GDSARDHSDTDIQNFQIKTDWLISDTQELQAFVQRYDADTQMPGALSPQAYKEDRTQSQ
FT                   RTNDTYEADATRWHLKFLQDLDWGNAAQFEVLTFGHRDTRNFVWGYNGTSGVAWSDPRF
FT                   ASTDIRNSPREFNVFGVEPKLSVAFGSPESVTQNLIVGMRYVNEDIDYQLRQTSISTGT
FT                   VTVPRDWQMDTDAVAAYVSDEVGLMNNRLKVTPGVRFESVHMNYQDNGTTKEQRSNQIN
FT                   EALPGLTVAYSLTDDWVSYANAQKSLRAPQISSIRGDGNKDGELSWNYEVGARYTHGRN
FT                   AFNVALYRIDYKDQLEWIAGEQTFENAGKTLHQGLELSGRYGPESLPDLSLGLAYTYLD
FT                   ATYEEGANKGNQLIDASKHQLSWDASYNFAGYQSTVSGYYYSDAFSDASNTTEEDVNGS
FT                   TGKIPSYTVWNLNVSKDLYEVGKTKLSIDVAVNNVFDKEYYFRGVDTSPVGRYPALGRT
FT                   YSVTGNLTF"
FT   sig_peptide     55940..56035
FT                   /locus_tag="Mmwyl1_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.964 at
FT                   residue 32"
FT   gene            58210..58878
FT                   /locus_tag="Mmwyl1_0050"
FT   CDS_pept        58210..58878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0050"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: sit:TM1040_3324 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68993"
FT                   /db_xref="GOA:A6VRB4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB4"
FT                   /protein_id="ABR68993.1"
FT                   /translation="MAQKRAVVRQSFPDIIAADLRQRILSGDLAEGELIRQELLAEEYD
FT                   VSRMPIREALKRLDAEGLVVFTNNRGATVTKHTLEEIAEIFDVRMMLEVDLFTRAIPLM
FT                   QDEHFELCEALLKEMELSYQSGDVAAWGPLNARFHSALYAASDRKLTSNLLERASLQSN
FT                   RYVSMHIDQLNKSQSAQQDHRDLLALARLGDVQCAADKLRSHIENTKFQVLEWIAAARS
FT                   "
FT   gene            complement(58999..60242)
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0051"
FT   gene            complement(60296..61231)
FT                   /locus_tag="Mmwyl1_0052"
FT   CDS_pept        complement(60296..61231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0052"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: sil:SPOA0266 proline
FT                   racemase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68994"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB5"
FT                   /protein_id="ABR68994.1"
FT                   /translation="MQVIDSHTEGEPTRVIVSGGPDLGSGSLAERAKILATEHKNFYRS
FT                   VVSEPYGQEAMVGVMLVEPVDSTCAAGVIYFDAAAVIGMCGHGTIGVAATLAHMGKIGI
FT                   GTHKIETPVGVVEVTLSDANTVTVKNVASHRLQKNVTLDIDDIGTVSGDIAYGGNWFFI
FT                   VDQSPVPVIPSNIRNLTEVAIKIREAIETKQLTGTDGGIIDHIVLYGSALNEKGHSRNF
FT                   VLCPDNAYDRSPCGTGSSARLACLAADKRLAPGEEIIQESTIGSSYRLSYQQATNNTII
FT                   PNITGQAFITKEATLMMNPSDPLKNGIKLS"
FT   gene            complement(61222..62199)
FT                   /locus_tag="Mmwyl1_0053"
FT   CDS_pept        complement(61222..62199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0053"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   sit:TM1040_3198 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68995"
FT                   /db_xref="GOA:A6VRB6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB6"
FT                   /protein_id="ABR68995.1"
FT                   /translation="MMSNDVFDVSVFNGIMPALMTPCKADRTPDFDNLVKKGMEMMAAG
FT                   MSAVVYCGSMGDWPLLTDTERMEGVERLVSAGIPVVVGTGAINTKSAVALAAHAEKVGA
FT                   AGLMVIPRVLSRGSVIAAQKNHFKAILTAAPSIPAIIYNSPVYGFATRADLFFALRAEH
FT                   KNLVGFKEFGSKEALRYAAENITSQDDDVLLMIGVDTAVYHGFVKCGAVGAITGIGTAL
FT                   PNEVLLLANLCKLAAKGNAEARVRAQELEEAFSVLASFDEGPELVLFFKYLLVLNGEEE
FT                   YRLHFNETDELNAAQRRYCEDQYTLFKDWFADWAKQGGVIDTCK"
FT   gene            62412..62765
FT                   /locus_tag="Mmwyl1_0054"
FT   CDS_pept        62412..62765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68996"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB7"
FT                   /protein_id="ABR68996.1"
FT                   /translation="MPYFDQFMQQWKAYLTQQLSLSGLSYLVSGAGDAADIKTNSLAYF
FT                   AWLRTHSIELVGIDEARDNVAWVMLEKQLKAFAEKAEKGTFDLVSKLHLEESQIQIILN
FT                   FNYDDEQHIVYVS"
FT   gene            complement(62842..62964)
FT                   /locus_tag="Mmwyl1_0055"
FT   CDS_pept        complement(62842..62964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68997"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB8"
FT                   /protein_id="ABR68997.1"
FT                   /translation="MRSLRGAKPNTQEGGEMEILAALAEAYKEKHHAIDPPELI"
FT   gene            complement(63018..63239)
FT                   /locus_tag="Mmwyl1_0056"
FT   CDS_pept        complement(63018..63239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68998"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRB9"
FT                   /protein_id="ABR68998.1"
FT                   /translation="MLGLTPNGLWLLTQGEEYFLSYKEFPWFENAPVKAVFNVEKQGES
FT                   GFCWPDLDVDLSLDGIKHPEKYPLKAKH"
FT   gene            complement(63241..63477)
FT                   /locus_tag="Mmwyl1_0057"
FT   CDS_pept        complement(63241..63477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT1927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABR68999"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC0"
FT                   /protein_id="ABR68999.1"
FT                   /translation="MSPAVYRENGFKFFFFSNEEERMHVHIVGHDGEAKFWITPEIALA
FT                   KSYNLSVKELSKLEKSVEEHKDEIIAAWQKHFG"
FT   gene            complement(63557..64960)
FT                   /locus_tag="Mmwyl1_0058"
FT   CDS_pept        complement(63557..64960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0058"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: hch:HCH_00873
FT                   dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69000"
FT                   /db_xref="GOA:A6VRC1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC1"
FT                   /protein_id="ABR69000.1"
FT                   /translation="MYDLVVLGSGPGGYAAAFRAADLGLNVAMIERHGTLGGVCLNVGC
FT                   IPSKALLHVAGKILMAEGPAHGVQFAKPTLDLDAIRHHRQSTVDALTSNLALMAKGRKV
FT                   TVIHGEGKFDSTSSITVTKDGKSQQVDFKNAIIAIGSRAIKLPFVPYDDPRILDSTSAL
FT                   QLERIPEHLLILGGGIIGLEMATVYQSLGAKITVAELGEQIMTGADKDLVRVFEQTNKN
FT                   RMSFLTKTQVTNIEATPEALNVTLKDKDGERQLAVDAVLVAVGRSPNGKTAGIADIGVK
FT                   LDERGFVLTNDKCQTSVPNIYAIGDVTHGPMLAHKASHQGHTAAEVVAGHKVDFQPLAI
FT                   PSIAYTFPEVAWVGLTETEAKKQNMAVKTAVFPWTASGRAIASGVTQGKTKLIYDEATK
FT                   RVLGAGVVGAHAGELLGELTLAIELGATLEDIALTIHAHPSLHETVGLAAELGAGTITD
FT                   LPNKKAKRA"
FT   gene            65102..65662
FT                   /locus_tag="Mmwyl1_0059"
FT   CDS_pept        65102..65662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0059"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ret:RHE_CH02697
FT                   probable transcriptional regulator protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69001"
FT                   /db_xref="GOA:A6VRC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC2"
FT                   /protein_id="ABR69001.1"
FT                   /translation="MADKNATKTKIMDTAEGYIVQGGYNAFSFRDIAEAVGIKSASVHY
FT                   HYPTKADLVSAVMMRYTQAFAAQLPDPTDEKFDPKALLNGFIKGFKAKIVDQRDMSLCT
FT                   MLTSNKSILPEPVSNELAAFYQLILDWLSRVFVRLDQIDEDLGLMQASQLLACLHGASI
FT                   LVQGTDQPDFFDRALSEWKARCQ"
FT   gene            65758..66696
FT                   /locus_tag="Mmwyl1_0060"
FT   CDS_pept        65758..66696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0060"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /note="TIGRFAM: lipid A biosynthesis (KDO)2-(lauroyl)-lipid
FT                   IVA acyltransferase; PFAM: lipid A biosynthesis
FT                   acyltransferase; KEGG: vfi:VF1799 lipid A biosynthesis
FT                   (KDO) 2-(lauroyl)-lipid IVA acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69002"
FT                   /db_xref="GOA:A6VRC3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC3"
FT                   /protein_id="ABR69002.1"
FT                   /translation="MSNGDKHTYNPTFEWRFLHPRFWLTWFSVLVSLLIAFFPLRWRDK
FT                   LASWIAGRLLNTKSRALKRARVNLEQCFPDKTLEEREALLKRSFQTAAQYFIAYGELIV
FT                   RSKRHCENRCVIFGEEHLFPLLKSDQNVIALVPHCWAIDYAGVMLTAKGHKTVAMIRTQ
FT                   KNPIFNWLIHLQRVRYGARVYCRSAGIKPFMKSIKEGYLGYYLPDEDLGAQNSVFTPFF
FT                   ASNKATMKGLGRLASLTDAKVVPMLPAYNAELGKYELFISPPLENFPSGSEETDALIMN
FT                   QALEAMISKHPEQYMWVLNLLRTRPDGSDLY"
FT   gene            66821..67765
FT                   /locus_tag="Mmwyl1_0061"
FT   CDS_pept        66821..67765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0061"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   pau:PA14_00280 coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69003"
FT                   /db_xref="GOA:A6VRC4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC4"
FT                   /protein_id="ABR69003.1"
FT                   /translation="MSASSPAMVTDLDVQAVKDYLLSLQDHICSTLESVEPSARFKEDA
FT                   WDRPNGGGGRTRVIAGGDVIEKGGVNFSHVMGDNLPPSATADRPELAGGRFEAMGVSLV
FT                   IHPNNPMAPTSHANVRLFIVYKDGMAPVWWFGGGFDLTPYYGFDEDCIHWHQASYDAVE
FT                   PFGEGYYSRFKKWCDEYFYLKHRGEPRGIGGLFFDDFNEGSFEHCFGMMESVGNAYTEA
FT                   YLAILKRRKDLPFTEQQRDFQLHRRGRYVEFNLVFDRGTHFGLQSGLGRTESILMSLPP
FT                   EVRWTYEYQVEPNSEEAKLTDYYLTSKDWLAAR"
FT   gene            67792..68592
FT                   /locus_tag="Mmwyl1_0062"
FT   CDS_pept        67792..68592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0062"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: pen:PSEEN0031
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69004"
FT                   /db_xref="GOA:A6VRC5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC5"
FT                   /protein_id="ABR69004.1"
FT                   /translation="MDQYAVVGNPIAHSKSPSIHAHFATLTNQDLVYSTLLGDEIEFEN
FT                   QVRDFFEKDGKGLNITVPFKERAYAMCDILSQRAKQAGAVNTLFMGKNGDLFGDNTDGI
FT                   GMVRDIIHNHCQSLTDKRILLLGAGGAVRGVLEPVLAENPESVTIANRTLEKAQSLADQ
FT                   FDCLASSFEALEGPFDIIINGTSASLSGSLPPLKDELVNGQTWCYDMMYGKERTVFLQW
FT                   AYERGAEGADGLGMLVGQAAEAFYLWRQVRPETASLVETMREQM"
FT   gene            68631..69791
FT                   /locus_tag="Mmwyl1_0063"
FT   CDS_pept        68631..69791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0063"
FT                   /product="protein of unknown function DUF482"
FT                   /note="PFAM: protein of unknown function DUF482; KEGG:
FT                   maq:Maqu_2871 protein of unknown function DUF482"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69005"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC6"
FT                   /protein_id="ABR69005.1"
FT                   /translation="MKAQWFSSVDQIGEAKWQEAIGATRYPFAQFAFHHALEQSKSIGD
FT                   GTGWYPEYLLVMDDDDSPLAIAPTYLKTHSQGEFVFDWSWADAYQRYGMRYYPKRIWAI
FT                   PFSPVTGSRVFSHLDPKGDDAEFSHLYPALAELMTQANQDRDYSSWHLLFPKPEHAALF
FT                   APNKDLLHRISCQFHWFNRDYKDMEDYLSHFSSRKRKTARKEREKVAKAGITLTRTIGK
FT                   DLTSADIDFFYLCYQSTYAKRGQQGYLTREFFGQLADTMGEQILLVQAFRGDEAIAASW
FT                   CFFDDHSLYGRYWGCMEEVDCLHFEACYYQGIEFCLEKGLQHFDPGTQGEHKIARGFEP
FT                   VFSHSIHYIAHEGFREAIGNFCEEEAQAVREYHQDTHELLPFKQES"
FT   gene            complement(69798..70784)
FT                   /locus_tag="Mmwyl1_0064"
FT   CDS_pept        complement(69798..70784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0064"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: hch:HCH_06726 predicted
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69006"
FT                   /db_xref="GOA:A6VRC7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC7"
FT                   /protein_id="ABR69006.1"
FT                   /translation="MRASRILKMLMMLQTHEKVTAAELADACETSIRTVYRDIEALSAI
FT                   GVPVYSEQGVQGGYRLLQGYRTRLNGLSAKEAETLFLAGLSGPAQKMGIDTLLADAQLK
FT                   LKAALPENIRPEIDRLQSRFLLDAPNWFSDDEKVTYLPDLMTAVLEQRCVVMQYQSWKG
FT                   EINRQLQPLGIVLKGGQWYLLAQVEQDVRTYRVSRIGSLTLLGEVFERPKDFNLTAFWQ
FT                   DSLRRMEVVQFPIIAEVRLTSLGRKIMQHVCSSYAVNQAQIEPMDESGWHRARFPVGES
FT                   VYGCAELLRFGAELEVIGPPELRAEMEKMVSSLEKLYQQDATRSLSN"
FT   gene            70965..71606
FT                   /locus_tag="Mmwyl1_0065"
FT   CDS_pept        70965..71606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0065"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bra:BRADO1419 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69007"
FT                   /db_xref="GOA:A6VRC8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC8"
FT                   /protein_id="ABR69007.1"
FT                   /translation="MSEIQSNQDTITLYHAPQTRGTGIWVLLEELGIPYDMKVLNFKAG
FT                   ENQQPEFLAINPLGKFPTLVHNGTVVTEQVACYTYLADLFPEKGLAPAFNDPKRGAYLR
FT                   WMAYQGSSFEPAVIDKAFNRPEVAASQSSYGSFDKMLQTLFDQIAKGPYLLGEELYAVD
FT                   ILWGLSLKWCRMFGLITTNPVVDAYIERVTSRSSFTRVEEKEQALLLAQS"
FT   gene            complement(71690..72880)
FT                   /locus_tag="Mmwyl1_0066"
FT   CDS_pept        complement(71690..72880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0066"
FT                   /product="globin"
FT                   /note="PFAM: globin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: cps:CPS_0848 flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69008"
FT                   /db_xref="GOA:A6VRC9"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRC9"
FT                   /protein_id="ABR69008.1"
FT                   /translation="MLTQHHIDTVKATIPLLASAGTAITEHFYQRMFSHNPELKDVFNM
FT                   THQRTGGQPAALFNAIAAYATHIDNLEVLTNAVMRIAHKHTSFNIQPSQYDIVGHHLIE
FT                   TLRELAPDAFTKDVEEAWVAAYMQLAGIFIQVEGDLYKERAAQLGGWKDFRRFRVASKT
FT                   PESDLVTSFVFEPVDGGAVIDYQPGQYLGVKLHPKGNEFDEIRQYSLSTTPNGKNYRIS
FT                   VKREGAGDIAGVMSNYLHDHLNVGDEIEAMPPAGDFVFQDKQTPVVLISGGVGLTPMQA
FT                   ILNTLAKQQYKHPVSYLHACAHQGQHSFKEHVNSLKDQLNLSVHTWYEQADSEEEGVTK
FT                   GMMQLEAIKDSLPLTNGEFYLCGPVGFMMFVKQQLLVLGVEADRIHYELFGPHQEV"
FT   gene            73031..74683
FT                   /locus_tag="Mmwyl1_0067"
FT   CDS_pept        73031..74683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0067"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: cps:CPS_0851 anaerobic nitric
FT                   oxide reductase transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69009"
FT                   /db_xref="GOA:A6VRD0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD0"
FT                   /protein_id="ABR69009.1"
FT                   /translation="MVYLSQIDTKNNSPYEPISMKQVSNNALLSFALDLASAVTQPNRF
FT                   EQLVYAVRATINCDAVVLLANNNGVLTPLAQRGLSEDLMGRRFIIEEHPRLKAISSGHY
FT                   PVRFPADSPLPDPYDGMVLGHDENLPVHSCMGVPLYLEGKLIGVVTLDSIMPGVFDDID
FT                   ARALEIIGTMAAMTLNTAILMEKLENQSQHAQNVLKVMGEQSHEMIGQSKAMQDLKQSI
FT                   NLVAPSDFAILIEGETGVGKELVARALHEQSARSEAPMVYVNCAAIPHHLIESELFGHV
FT                   KGAFTGADRDRDGKFLLADGGTLLLDEIGELPLEVQGTLLRAIQNQEIQAVGKDQIRKV
FT                   NVRIIAATNRHLETEVAEHRFRADLFHRLSVFPIQVPALRDRQGDVPLLAGFFAERFRR
FT                   KLGLQQLTLSASAIDMLEAYHWPGNVRELEHVISRAALFSKAESSKAESTKADNTTGIT
FT                   VISSAHLTGLQIDSRIQEKIQNVEIPQQILDKQEIVDLRLETETYQRNLICKALEASNG
FT                   NWTKAAQQLSMDRANLARLAKRLGIVVAKEVRS"
FT   gene            complement(74763..75197)
FT                   /locus_tag="Mmwyl1_0068"
FT   CDS_pept        complement(74763..75197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0068"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: psa:PST_1579
FT                   protozoan/cyanobacterial globin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69010"
FT                   /db_xref="GOA:A6VRD1"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD1"
FT                   /protein_id="ABR69010.1"
FT                   /translation="MTPSNQPIYGEGDATLQAVGGLTGLQNLVETFYRIMENTPEFRPL
FT                   FDMHPNNIELTIDKLVSFLSGWMGGEKLFSKKYGPISLPQAHAHLIVTEKEKAMWLNCM
FT                   AAALDELGYAEDLKAYLLPKLEFPAERIRQVSAARHSKSV"
FT   gene            75813..77102
FT                   /locus_tag="Mmwyl1_0069"
FT   CDS_pept        75813..77102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0069"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: maq:Maqu_0061
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69011"
FT                   /db_xref="GOA:A6VRD2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD2"
FT                   /protein_id="ABR69011.1"
FT                   /translation="MAWPPMISNITTPLLGLVDTAVVGHLGTATHLAAVAIGASIFSFL
FT                   FWAFGFLRMGSTGLTAQALGQGDERRVRELLLQSILMGVFIGLILILFRAPLIDLAITL
FT                   MEPSAEVEPWARLYCEARIFSAPAVLAGYALMGWFFGVQYSKGPLWMLLVINVANMILD
FT                   YFAVYGLGMASDGVAWATVFAHYIGVTVAGVLAWHKLKGFSGHVPLRVLAKWREYMALV
FT                   QVNRYLFVRTILLLLVMLFFTAQGARQGDSILAANAVLLTFLMIISNALDGFAFSVEAL
FT                   CGEYYGRKDKANFKKVIQLSTYWALFAACILMLIFWLFGNQIIALLTSVQSVRDDAALY
FT                   LPWLIFFPLLGIWSFMLDGVFIGTTSVKQMQNTMIVCVVGVFFPVWFITQDLGNHGLWF
FT                   SQAMLFIARAITLYWCYLQNMKKGVWFANS"
FT   gene            77220..78110
FT                   /locus_tag="Mmwyl1_0070"
FT   CDS_pept        77220..78110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0070"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: atc:AGR_L_1139
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69012"
FT                   /db_xref="GOA:A6VRD3"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD3"
FT                   /protein_id="ABR69012.1"
FT                   /translation="MSKNFLSELTGSFATPALENPTGVMMEAAYRDLGLDWRYINCEIQ
FT                   PDDLKNAVLGARAMNWRGFNCSIPHKVSVISHLDDLGESARIIGAVNTVVNRDGKLIGE
FT                   NTDGRGFVESVKSSLELTKTRVVLFGAGGAARAVAVELALAGVAHITIVNRNQKRGEEL
FT                   AKLVADNTSAGAEYHAWTKQYQIPADTDLVINVTSIGLFPDVEVELDIDTESIKSSMVV
FT                   ADGIFNPPATRLIQTAKTKGCTTVNGLGMLVQQGVITFEYWTGKTPSIEVMKAALRDAL
FT                   DITDLDSTDLESTEK"
FT   gene            complement(78137..78913)
FT                   /locus_tag="Mmwyl1_0071"
FT   CDS_pept        complement(78137..78913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0071"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: csa:Csal_0403 GntR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69013"
FT                   /db_xref="GOA:A6VRD4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD4"
FT                   /protein_id="ABR69013.1"
FT                   /translation="MESNHFGRVKQPKISDIIMKELESMILEGSFTAGQKLPPERELAA
FT                   RFEVSRPSLREAIQKLIARGVLFSRHGGGTYVSEQLGSSFADPLQDLLSSHDEFLYDQL
FT                   EFRDALESLAAYYAALRSTDADKTKLTQCFNQLVEANQNKAFALEAKLDVEFHMTIAEA
FT                   AHNVVLLHTLRSLHAMLAKSISSNLRNLFEKQAARKRVMEQHTNLYQAIMDGNAEAART
FT                   AAHTHLVFVEDNLLKMRQEETRIQRSLRRNEHHNPL"
FT   gene            79167..82046
FT                   /locus_tag="Mmwyl1_0072"
FT   CDS_pept        79167..82046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0072"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; FAD linked oxidase domain protein; KEGG:
FT                   csa:Csal_0405 FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69014"
FT                   /db_xref="GOA:A6VRD5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD5"
FT                   /protein_id="ABR69014.1"
FT                   /translation="MNTDSLADKAAQYCNLYSALKDAKTGAIDETRLIRDPLRTLAYGT
FT                   DASFYRLIPQLVVRVDNEAEVQLVLKEARKRNLPVTFRAAGTSLSGQAVTDSILMQLSD
FT                   NWKGHRVHEHGHHISLQPGIIGARANQLLAPFQRKIGPDPASINACMIGGIAANNASGM
FT                   CCGTAQNSYHTIQSARLIFADGALLDTADEASRLAFGNRHADLLDTLVRLSKSVQANSE
FT                   LAERIRHKYRLKNTTGYSLNSLIDYQDPFDILLHLMVGSEGTLGFISEVTYETVVDHPI
FT                   KAAAMIFFDDMEATCRAVTSLKSSPVSAVELIDRAGLRAVEGKPGMPEILSSLGSQAAG
FT                   LLVDVRAASAEELEANLALVKQALSGQATLNPIEFTQDKIIYDSYWKIRKGLFPAVGAV
FT                   RPVGTTVIIEDVAFPVEQLAEGVLELQSVFQKHGYREAILFGHALEGNLHFVFTQGFDD
FT                   PKEVKRYEQLMDEVAQLVAVKYKGSLKAEHGTGRNMAPYVELEWGKEAYDIMWQIKRAF
FT                   DPQGLLNPDVILSHNANLHVQNLKPLPKANDKVDTCIECGFCESSCPSKSITLTPRQRI
FT                   VIWREIQRLTAMGTDPLRLAELKKDYDYQGVDTCAGCGLCSMQCPVGINTGDLTRELRH
FT                   DRHPDSKVGYWIADHFDGVTKTAKVGLNLASGARRIIGDSGMATVTSVMNKVSQGAVPK
FT                   WHKQMPSAASSLTSIPLMQCDEMQTNDAQKEVIYFPCCATRVMGAGPNAEDKRSVMEVM
FT                   FSVLQKAGYKVTVPNNIDSQCCGMAFQSKGQFEAAKQKSNDLNSLLLEVSENGRIPIVC
FT                   DVSPCLLRMQESLDPCLQLHEQVGFVSTHVMPNLTVKDKLGKIALHVTCSTTRMGLADS
FT                   FVQLAHQLADEVVIPPDITCCGFAGDKGFSTPELNASALKTLAKAVEGCEAGYSNSRTC
FT                   EIGLSEHSGIEYQSIVYLVDQLTQPLSGL"
FT   gene            83146..83631
FT                   /locus_tag="Mmwyl1_0073"
FT   CDS_pept        83146..83631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0073"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="PFAM: Thiolase; KEGG: azo:azo0310 probable
FT                   beta-ketoadipyl CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69015"
FT                   /db_xref="GOA:A6VRD6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD6"
FT                   /protein_id="ABR69015.1"
FT                   /translation="MHENGTVSAGNASGINDGAAALLLASRQALEKHNLTPRARIIATA
FT                   CAGVEPSIMGIGPVPAVKKVLALTGFTLEQMDVIEINEAFSSQVLSVIKDLDLENGDPR
FT                   INPNGGAIALGHPLGMSGARIVGTALNQLEQSQGRYALCSLCIGVGQGMAMIIERIQ"
FT   gene            83792..84832
FT                   /locus_tag="Mmwyl1_0074"
FT   CDS_pept        83792..84832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0074"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   sdn:Sden_0303 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69016"
FT                   /db_xref="GOA:A6VRD7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD7"
FT                   /protein_id="ABR69016.1"
FT                   /translation="MPFSDHTALLHLKKRLRRLRTSPHMRALVREHDVKLSDLIYPIFI
FT                   EENITDEVPINSLPGLTRLPEAQLSAEIESLYELGIRYVMPFGISHHKDNCGSDTWNSE
FT                   GLLFRMISTIKAVNPEMMVIPDICFCEYTTHGHCGVLKNQIIDNDETVQNLVKQCINAA
FT                   RAGADMLAPSAMMDGQVMAIRQGLDQAGFNHVAILAHAAKFASSFYGPFRDAVECELKG
FT                   DRHTYQLDYANARQALHEAILDEQEGADILMIKPGTPYLDILAKLRSETLLPLAVYQVS
FT                   GEYAIIKCAAQSGLLNERETVLETLTGCKRAGADLIVTYYAKQFAQWLREDNDHHHLAS
FT                   IIGHKS"
FT   gene            84842..85726
FT                   /locus_tag="Mmwyl1_0075"
FT   CDS_pept        84842..85726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0075"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sdn:Sden_0304 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69017"
FT                   /db_xref="GOA:A6VRD8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD8"
FT                   /protein_id="ABR69017.1"
FT                   /translation="MNIKDYALCIVIMAIWGLNFSVVKLGLNGMDPMLLTGLRFTLAVI
FT                   PAIFFVRKPDVHILYLIGYGLTFGVGVWGMSTCSIGAGLSPGMAALLLQTNVVFGLFLG
FT                   WAMLNEKVKFAHILGSLIALGGLAASLTVTDGSVNFQGVTLILFAAISWSISGILIKKS
FT                   QTKAVFSFTLWAMLFAPLPLFLMSYVQVGASAFTTFFDHLTGVVLFSIVYQAYGTTLFG
FT                   YWIWNRMIVSHPLSQVAPFTLLVPIFAILGSNILFNEVISLEKMLSSSLIIFGLLIGIL
FT                   PVERARSFVRRIV"
FT   gene            85792..86520
FT                   /locus_tag="Mmwyl1_0076"
FT   CDS_pept        85792..86520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0076"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: sdn:Sden_0305
FT                   protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69018"
FT                   /db_xref="GOA:A6VRD9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRD9"
FT                   /protein_id="ABR69018.1"
FT                   /translation="MIIFTHRQTDIHKAQELMNITWNDKTSDHIRDIMIPNTTIQSPLR
FT                   LSVGHESFCDTLILWHRAFPTLHYKETCVTTRDSEIIIEWTAKGRQLGEFLNISATGKP
FT                   ITYQGATHLVFMQDKVIHYASDVHIQGIVDHLIGLPSHSQATTLRANGKEYLYGVIQKL
FT                   LCNDLTRRQIECLSLSTLNLSVKEIACILNIESSSVQTHFKRAFDVLQINNKKMFMEYT
FT                   MANNTLEIFIRMGLFLRRKP"
FT   gene            86773..87015
FT                   /locus_tag="Mmwyl1_0077"
FT   CDS_pept        86773..87015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0077"
FT                   /product="FAD linked oxidase-like protein"
FT                   /note="KEGG: csa:Csal_0405 FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69019"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE0"
FT                   /protein_id="ABR69019.1"
FT                   /translation="MADEVVIPPDITCCGFAGDKGFSTPELNASALKTLAKAVEGCEAG
FT                   YSNSRTCEIGLSEHSGIEYQSIVYLVDQLSESSPA"
FT   gene            complement(87149..88678)
FT                   /locus_tag="Mmwyl1_0078"
FT   CDS_pept        complement(87149..88678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0078"
FT                   /product="KAP P-loop domain protein"
FT                   /note="PFAM: KAP P-loop domain protein; KEGG: ppr:PBPRB0094
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69020"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE1"
FT                   /protein_id="ABR69020.1"
FT                   /translation="MSDTDTEAFAKCATGNKRKELAERFTKYLKSRDTKDNAYVVNLNG
FT                   AWGTGKTFFVTEWKKLVEKQGHIAIKIDAWESDYLNDPLAIIIAELLEQTQLKIKNHDA
FT                   RFRIAERNVASAIFNMGKSILPIGSKVVGKHLLGETATSEILDLIAAATGSVTNHSAVK
FT                   DDLNMGDLGLEVASQHKRHKQFTRDFKKQARELVDFALEGNPNKQVFIFIDELDRCRPT
FT                   YAIEMLETVKHLFDIPNFIFVLSTDTSQLQHSIKAVYGHDFDSHEYLSRFFEQRLTLPE
FT                   LDYFEFLTAEKIFETEDFKPLPTLPAINSAEELRAAVALICEQNKHHLSLRRVKQICVQ
FT                   LEIVLDSKELRENAYPILTLIGLVVGNALYSGWSQPKLPIERAKLALELSVNPDSIPIT
FT                   FNPLNVFRTYSHQDNSAGSSVSAKNIIKNCLEALSLQKQGKTLNSSHFGSRNNKYEFIN
FT                   SQFSLLLVKPGNLIVRFNEISGEFYVKIIADEQELLQIIENLDIQVNINEK"
FT   gene            complement(88856..89662)
FT                   /locus_tag="Mmwyl1_0079"
FT   CDS_pept        complement(88856..89662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69021"
FT                   /db_xref="GOA:A6VRE2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE2"
FT                   /protein_id="ABR69021.1"
FT                   /translation="MENLFWWQYALIGAIFIWSGFVRSGLGFGGAVLALPFLLLVKNDP
FT                   LLFLPIISIHLLVFSSWIAWQGSRATKQQAILAAERGEAPQEAQGNIAWGYLKKALGIM
FT                   IVPKLIGVFGLLTLPGNIVTGVIFVIVAVFAVSYILNKPFYTNNKFLDTIFLMLGGYVS
FT                   GTSLIGAPLIVSVFATKVPRHQLRDTLFVLWFILVMIKMVSFLIAGIDLQLIHQLWLLP
FT                   CALIGHVFGQKLHNRIQKAETPVFFQFVGWALLIVCGFGLYSTFML"
FT   gene            complement(89743..90633)
FT                   /locus_tag="Mmwyl1_0080"
FT   CDS_pept        complement(89743..90633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0080"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cvi:CV0581 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69022"
FT                   /db_xref="GOA:A6VRE3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE3"
FT                   /protein_id="ABR69022.1"
FT                   /translation="MLDDLKIFITAANKNSLTAAAQHLDMTIATVSRRISALEQKLGCE
FT                   LLHRSTKGLTLTPVGESYYRECAEFIDALDQRISNLDQTLNSLKGDLKVLAPVNLGSGP
FT                   LDAFWQDFVQLYPDIELNIELSNTLQDIRDTRADIALRSGNQPSSSLIQKKLGHIEPIL
FT                   VASPNMAFPLPKTIEDLQHAPSIASNMFADWLLINNQEDRRPLNKEHRHISNDMTITLN
FT                   LAKAGAGIALIPMSMVHGALETGELIRVLPEWRGQNREIFLVWPYRRSLSARAKLLKEE
FT                   MTKFLHQQTWFHPSP"
FT   gene            90785..91000
FT                   /locus_tag="Mmwyl1_0081"
FT   CDS_pept        90785..91000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pin:Ping_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69023"
FT                   /db_xref="GOA:A6VRE4"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE4"
FT                   /protein_id="ABR69023.1"
FT                   /translation="MKHRIIFAVLMSFTLSLFMSAWITYLNIGLHPNFVSLWMHAWVLA
FT                   WPAAGIISFIAGPFLHALAHKLAVKV"
FT   sig_peptide     90785..90865
FT                   /locus_tag="Mmwyl1_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.641 at
FT                   residue 27"
FT   gene            complement(91096..92502)
FT                   /locus_tag="Mmwyl1_0082"
FT   CDS_pept        complement(91096..92502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0082"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: sme:SMc04263 putative amino
FT                   acid carrier transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69024"
FT                   /db_xref="GOA:A6VRE5"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE5"
FT                   /protein_id="ABR69024.1"
FT                   /translation="MAAIIDFLNTIFWGYILIYGLLAVGVYFTLRLGFIQVRRFPEFIR
FT                   TVLKAPQSDRGGISPFQALCTSLASRVGTGNMTGVAVALYLGGPGAIFWMWVVAIIGMA
FT                   TAYAESTLAQLYKMRDQNGQLRGGPAFYISKGLKAPWAGAVFSLALILAFGLVFNAVQA
FT                   NSIAGAMEGAFGIDTSVTGIVIMLLAAIVIFGGIKKIARFAEIVVPFMAILYLLLALYV
FT                   IFANISDVPAAFALIFKSAFGIEQAAGGVLGAMLNGVKRGLFSNEAGMGSAPNIAAVAT
FT                   PNPHHPSSQGMVQSLGVFIDTLLICTATALMILLSGALGNGQTGIALTQTALTTHIGSA
FT                   GHYFVAIAIFFFAFTSIIGNYSYAENALTYLKWANKPGIFILRILALGMIPWGAYESVA
FT                   MVFNAADAAMGLMATINLIAIVMLSGLVVKLTKDYFTQLKTHTPVFNSDDYPEIRDDID
FT                   LSVWDEKPSK"
FT   gene            complement(92726..93847)
FT                   /locus_tag="Mmwyl1_0083"
FT   CDS_pept        complement(92726..93847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0083"
FT                   /product="phenylalanyl-tRNA synthetase, class IIc"
FT                   /note="KEGG: ade:Adeh_3432 phenylalanyl-tRNA synthetase,
FT                   class IIc"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69025"
FT                   /db_xref="GOA:A6VRE6"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004530"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE6"
FT                   /protein_id="ABR69025.1"
FT                   /translation="MSKHNYLTHEQLLSALSLRDLTNPKHGMHAMQQLISEAETAVAAL
FT                   WSCYLQRINANPIVPVYENYDALGYPVDGASRDIRYSRYVSDSLMLRTQTSSSVPTWLS
FT                   SWRSLRPESLGIISHGLVYRRDCIDRWHCAEPHQLDIWIVMPKAQAEDTQILSDSISAL
FT                   MKTLLPNHVVQQSKSPHPYTINGVQLDAIEGQNLIEVGECGNIDPDLLTRNGWSSDDYT
FT                   GVAIGLGLDRVLMLRKGIPDIRLLRDPDPRIQQQMLDLSPWRPVSRQPKAERDISIVVN
FT                   RDTDMDIIGDQVRLTLGEQAHWLEELQLLSRTEYQQLPKSAIERLGMTSTQVNLLLRIN
FT                   LRHPTRSVPTSLANELRNKIYLSLNQGHNYLAN"
FT   gene            complement(94215..95717)
FT                   /locus_tag="Mmwyl1_0084"
FT   CDS_pept        complement(94215..95717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0084"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rru:Rru_A2959 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69026"
FT                   /db_xref="GOA:A6VRE7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE7"
FT                   /protein_id="ABR69026.1"
FT                   /translation="MRTSASRNKIALMAICLSAIMLGLEITSVPSVLPVLKDILPADFK
FT                   QLQWIMNAYTLAMCSVLVAMGALADRFGRKRVFTVGIIVFGIASLICSLATNAPILIAA
FT                   RFLQGISAAAMLACQVAILSNQFQNGPERGVAFAWWGIIFGLGLGFGPIVGGLIIAHLS
FT                   WEWVFLIHVFIAVATLVLARIGVLESSDPDSLRVDYGGMITLSSAVFGLVFMITQGKSI
FT                   GYLSLEGILIISASTLAFVLFLIIESKVARPMFDLKAFRIRNFSGALFGAAGMNFSFWP
FT                   FVVYFPIYLQGVLGYDGITAGLTVLALTLPTVVVPPYAEKILIKQGPKFLISLGLVCIS
FT                   GGFFLLWVIASSPEASWLTLMPGCILAGIGLGFTNTPVTNTATGSLPPERAGMASGMEF
FT                   SARMISLSLNIALMGLILANGITSRLLDLLPKTLSETKLIEITDILASGNLNILENYGI
FT                   SKEIAKHILMEGFSSVLLYGATATAVICFLAFITFEKRRQYS"
FT   sig_peptide     complement(95631..95717)
FT                   /locus_tag="Mmwyl1_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.309 at
FT                   residue 29"
FT   gene            95936..96802
FT                   /locus_tag="Mmwyl1_0085"
FT   CDS_pept        95936..96802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0085"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: atc:AGR_L_1733 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69027"
FT                   /db_xref="GOA:A6VRE8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE8"
FT                   /protein_id="ABR69027.1"
FT                   /translation="MLTLDVDSVRAFVAIADLKSFTQAANLLGTTQAALSLRLKRLEER
FT                   VKRRLIERTPRQVRLSSYGELFIASARDFLEAHERAVESLLLAKKRLKLGIGCHLIGSE
FT                   LQSMLAKVNEFAPDLVLEISTDTSFQVKEAYLNGELDAVILRSEDERKEGFILCIEHYS
FT                   WYASPSFQYSPNEPLKLATLDEKCGVRDQAPMLLKRAGLKSHNVLVAGNTDVINAAISA
FT                   GMAVGVFSQRMAPKDSIDVGELFNLPTLPTSSIELHTHLTDQETRKVLKVICSVFNEYT
FT                   AEELAVY"
FT   gene            complement(96816..97466)
FT                   /locus_tag="Mmwyl1_0086"
FT   CDS_pept        complement(96816..97466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll1820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69028"
FT                   /db_xref="GOA:A6VRE9"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRE9"
FT                   /protein_id="ABR69028.1"
FT                   /translation="MSQSLEETTLSKVKRGPNRASYDKDLAFNIIDAALMCHVGQSKDG
FT                   QVFVTPTSHWREGDYFYWHAHSKARNIKGPIDEPEKVCINISLLDGLVLARSAMHHSVN
FT                   YRSVTLFGVPELIEDKEEKVRQFKLFLDKVSPGRWETLRPVNEQEIKATGVVRIKIDEA
FT                   SVKFRAEPPVDDPADNNWPVWAGVMPLERHWGEVEQDPIQTKHYPEPKAPDAV"
FT   gene            97492..99069
FT                   /locus_tag="Mmwyl1_0087"
FT   CDS_pept        97492..99069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0087"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG: yen:YE0931
FT                   putative GntR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69029"
FT                   /db_xref="GOA:A6VRF0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF0"
FT                   /protein_id="ABR69029.1"
FT                   /translation="MVRYNKTLEESGFYKNSQNKDKKAGQIMKYAIASLRFSLEDDEPY
FT                   YKQLIEQIQQGIVSGELSVGDKLPSSRFLASSLGVSRSTTSRAYDQLIAEGILTSEEKR
FT                   GVFVAALPMISHRASKSPDTVLSVMNDVPQKRAFDSGADMSAFPTKEWAASMRRSWLTP
FT                   DLTVLEGGYTTGYPDLKTAIVDYLYRVRGLECSAEQIIVTAGSRDSLLLLQHTITLLGD
FT                   SENSPVKWWFEEPTYPPIRQVIHSSIKAGALFIDEDGPCLPDSEHASNVAIVTPNRQYP
FT                   LGVSISAARRQQWLQALQNESPSWWLVEDDYDNEFVYQGRSNVPFMQTASVHEQARDRV
FT                   FFVGSFSKVLFRGLRLGFIVAPMKHIETVHKSQRVLGSSASLPIQPAVADFMLQGHFDR
FT                   HINRMRRHYRLKRDVLLALLECHLATWFEWKRPRGGMHVLIELKSEFLPIVQTGMAWDQ
FT                   LIAKEIKRDDVQLSTLSSHYVCQQKETNRCRFGFLLGFSGPKEEEMTYIVKILRNWLLA
FT                   HLVENKTY"
FT   gene            99223..99678
FT                   /locus_tag="Mmwyl1_0088"
FT   CDS_pept        99223..99678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69030"
FT                   /db_xref="GOA:A6VRF1"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF1"
FT                   /protein_id="ABR69030.1"
FT                   /translation="MLYFAHLNSYEASKNDIFIFVFMNRMDKLNKFQDILHHYVHSVSS
FT                   ILADSLRPVIAASCLFLSFFVLVSAPFFIGNLGVINIDPILNAGLVSSIVFTTLLLVSY
FT                   WSVMTHINLARQKLAFSLFHVFAPNEQPSRAEVRYMMSCGAPFFRFR"
FT   gene            99838..100884
FT                   /locus_tag="Mmwyl1_0089"
FT   CDS_pept        99838..100884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0089"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; KEGG: sfr:Sfri_0224
FT                   ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69031"
FT                   /db_xref="GOA:A6VRF2"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF2"
FT                   /protein_id="ABR69031.1"
FT                   /translation="MILLLTRILSKVALALMVGLLAGCQGGVLDPKGQVGIEEKQLIIV
FT                   ATLLMLLVVIPVIFMTLYFAWKYREGRDEIYEPKWSHSTKIETIVWIIPIIIVIILGVI
FT                   TWKSTHALDPYKPLKSDKDHINVQVVSMNWKWLFIYPDLGIASVNELRFPANVPVAFQI
FT                   SSEGTMNSFFIPQLGSQIYSMAGMVTKLHLIANEPGTFKGISANYSGPGFTNMKFDAIA
FT                   METEADFDAWVEGVKAGSHNVINNGVLNQVSYDKLAEYDADPHHKHVATPVQYYNSIEP
FT                   GIFTDNVMKFMKDHGQVELLKGTSFEPKMIHDGSNHGEMNHGEMNHGEMNHEASEHSSH
FT                   EMHMEADK"
FT   sig_peptide     99838..99918
FT                   /locus_tag="Mmwyl1_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.709 at
FT                   residue 27"
FT   gene            100884..102863
FT                   /locus_tag="Mmwyl1_0090"
FT   CDS_pept        100884..102863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0090"
FT                   /product="Cytochrome o ubiquinol oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: Cytochrome o ubiquinol oxidase subunit I;
FT                   PFAM: cytochrome c oxidase subunit I; KEGG: sfr:Sfri_0223
FT                   cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69032"
FT                   /db_xref="GOA:A6VRF3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF3"
FT                   /protein_id="ABR69032.1"
FT                   /translation="MSILGKLSLDAIPLHEPILIATFCGVALGGLILAFLLIKYNLLGT
FT                   LWKNWITSVDHKRLGVMYIVLALVMLLRGFADAVMMRLQLALSTNGGDGYLPPHHYDQV
FT                   FTAHGVIMIIFMAMPFMIGLMNIVLPLQIGARDVAFPFLNNLSFWLTAGGAILVNISLF
FT                   VGEFAKTGWVAYPPLAGLEFSPDVGVDYYIWALQISGIGTTLTAVNFLATVFKMRAPGM
FT                   KLMDMPIFTWTCTWANILIAASFPILTVTLALLTLDRYLDFHFFTNDGGGNSMMYINLF
FT                   WAWGHPEVYILVLPAFGIFSEVVSTFTGKRLFGHKSMIWASGAISILGFIVWLHHFFTM
FT                   GSSANVNAFFGMATMVIAVPTGVKLFNWLFTMYRGRLRVTVPVLWTLGFMVTFTIGGMT
FT                   GVLLAVPGADYVLHNSLFLIAHFHNTIIGGAVFGYLAGFVFWFPKVMGFKLNEKLGKAA
FT                   FWCWLVGFFLAFMPLYVLGFLGMTRRLNHTDNPDWNIWLYIALVGAFVIMAGIISQLLQ
FT                   LYVSFRDRKDNLDTTGDPWNAHTLEWATSSPPQSYNFAVIPTVSDIDAFTDMKEKGEAY
FT                   VRKDSYAPIHMPKNTASGILISGCVTVMGFALIWHIWWLAALGLFGSFVFLVIRAYTKD
FT                   VDYYVQPDEIARTENAYLDSVAKG"
FT   gene            102866..103477
FT                   /locus_tag="Mmwyl1_0091"
FT   CDS_pept        102866..103477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0091"
FT                   /product="Cytochrome o ubiquinol oxidase subunit III"
FT                   /note="TIGRFAM: Cytochrome o ubiquinol oxidase subunit III;
FT                   PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   shn:Shewana3_4033 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69033"
FT                   /db_xref="GOA:A6VRF4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF4"
FT                   /protein_id="ABR69033.1"
FT                   /translation="MSTTHMNTHDAHDEHHDHDPAPHNVFGFWLYLMTDCLLFATIFAT
FT                   YAVLFMNTAGGVSGKDIFELDFVLVETALLLVSSITYGFAMICAHKKDKKGTMSWLSVT
FT                   FLLGAGFIGMEIYEFHHLIVHGNGPQASAFLSAFFTLVGTHGLHVTAGLIWMAILMIEL
FT                   TVSGFGSRTVTRLSCLSLFWHFLDVIWICVFTVVYLMGAI"
FT   gene            103477..103800
FT                   /locus_tag="Mmwyl1_0092"
FT   CDS_pept        103477..103800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0092"
FT                   /product="Cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: Cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG: pat:Patl_1293
FT                   cytochrome c oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69034"
FT                   /db_xref="GOA:A6VRF5"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF5"
FT                   /protein_id="ABR69034.1"
FT                   /translation="MSDHSSEANSHGSVKSYVTGFVLSVILTGIPFWMVMTEAFDKGPT
FT                   YVTIILLAIVQIFVHLKYFLHLNFTSEQGKLDAYSFLFALMIIVMVVALSVWIIYASNA
FT                   MMM"
FT   gene            103872..104762
FT                   /locus_tag="Mmwyl1_0093"
FT   CDS_pept        103872..104762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0093"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: pha:PSHAa2227 protoheme IX
FT                   farnesyltransferase (heme O synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69035"
FT                   /db_xref="GOA:A6VRF6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VRF6"
FT                   /protein_id="ABR69035.1"
FT                   /translation="MFKRYLQVTKPGIIMGNLISVAGGFFLASRGEIDWILMLATVIGL
FT                   SLVVASGCAINNYIDRDIDAKMQRTRNRVTVNGEMSGKAAFFHGIVLGVIGFALLSYFT
FT                   NWVAVAFAAFGYVVYVGLYTMYFKRKSVYGTFVGSLSGAVPPVVGYCAAAGQFDAGAAI
FT                   LLTMFCIWQMPHSYAIAIFRYKDYEAAGIPVLPVSQGIAKAKRHIILHIAAFAVVAALL
FT                   PLTGYVGIGFMVVALATSLWWLAMALRGYRPGIDVNGWARQVFFFSIITVTALSVTMAL
FT                   DFNEVSPNLLVFAAH"
FT   gene            104930..106591
FT                   /locus_tag="Mmwyl1_0094"
FT   CDS_pept        104930..106591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0094"
FT                   /product="Tannase and feruloyl esterase"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   bra:BRADO2873 putative feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69036"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF7"
FT                   /protein_id="ABR69036.1"
FT                   /translation="MKTLLTYFVPALTLVLLGSSTAAYAVNCQTLVTKAPQNVEIKTTM
FT                   MGRDKDVRSPYCLVSGVMSQRMGVDDKFYSIQFELRLPNFWQGRFGYQFNGGNDGEVKP
FT                   ALGAITGLISSQYAINQGFAVVSSNGGHDAQANPEAGLAGPAVFGHDPEARRDYGYGAV
FT                   QKLNPVARSLIESYYASPIKYSYGLGQSNGGRMAMVAASRFPDMFDGLLVGYPGFNLPR
FT                   AALQHAWDIQALHRVSDDISQSLTPRDLKVFAKRILDQCDTLDGISDDMIFAADACQKI
FT                   FDPKALVCKSNFDRDCLPLNKVAALMRMHMGPHNSKNQALYADWAYDTGISSANWRMWK
FT                   VESTISDWSNKPISVVMGAASLAHIFTTPFTNVAGNIYALENYLFKFDFDKDAPKIYAI
FT                   NNQFKESAMTIMTTPDAAKPKLTEFKQHGGKMIIFHGNSDPVFSVKDTMRWYDFLDFML
FT                   EGRAPEFVRLYRVPGMPHGQGGPSADQFDMLTPLVSWVERKKAPHSIVAATRAKNSEIT
FT                   ARMAGITRPLCPYPSYAKYNKGDFLKASSFQCVVAR"
FT   sig_peptide     104930..105007
FT                   /locus_tag="Mmwyl1_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 26"
FT   gene            complement(106603..107352)
FT                   /locus_tag="Mmwyl1_0095"
FT   CDS_pept        complement(106603..107352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0095"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: sfx:S3087 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69037"
FT                   /db_xref="GOA:A6VRF8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF8"
FT                   /protein_id="ABR69037.1"
FT                   /translation="MESPILLVTGGGRGIGAATAKLAAQQGYQVVINYRKDASSAEKIV
FT                   TDIIASGGLAHCLQADVSDVEQVIEMFATIRRNWGPIKALVNSAGVLDQQARFVDTQPE
FT                   RWQRIFQTNVFGTMQCCQEAFQDMAVSRGGQGGAIVNVSSLASVYGSPNEYVDYAASKG
FT                   AVDSFSKGFALEVAGDGIRVNVVRPGLIYTDMHADGGEAGRVDRIGPNLPLQRGGQPEE
FT                   VAEAILWLLSDKSSYSTGGFIDVGGGR"
FT   gene            107555..107980
FT                   /locus_tag="Mmwyl1_0096"
FT   CDS_pept        107555..107980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0096"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rle:RL3785
FT                   putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69038"
FT                   /db_xref="GOA:A6VRF9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRF9"
FT                   /protein_id="ABR69038.1"
FT                   /translation="MQTNNLGFLLTDIIRLMRREYLKSDLCMTPMQARTLVYVSNCEGI
FT                   RQVQLAEMLDIQPITLARLIDQLAEDNLVERRPDPKDRRAYGLYLMEKSTPLLEKIDVE
FT                   VKRVREKALQGLTEEQVTALQGALSVMHTNLSTDSSS"
FT   gene            108005..109069
FT                   /locus_tag="Mmwyl1_0097"
FT   CDS_pept        108005..109069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0097"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   shm:Shewmr7_1874 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69039"
FT                   /db_xref="GOA:A6VRG0"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG0"
FT                   /protein_id="ABR69039.1"
FT                   /translation="MSEQENNPSLPKQVEKRTTRRVLLVALPLVVILASVFVYMKGGRY
FT                   VETDNAYVQSDITTINAEVSGAIQTIAIKENEKVSKGQLLFSIDATPFKVAEAKAQAQL
FT                   QQVRLNILEQKAAYEEKKAEINQAENEFAFNQREEKRQANLLKQKFISDTQFDQARQAA
FT                   EVSELKVATLKKDLFRLKEALGGDPSAPLEDHPSYQAAQAALDQTRIDLGHVNVRAPAS
FT                   GVVAKVPNSGEYVTAGSTTMVLVSDERQWIAANFTEKDLTYVQPGQEVEIEVDAYPGVS
FT                   LHGKVESISPATGSEFSVIPAENATGNWVKVAQRLSVKILVDTDQDTPVLRTGFSSNVT
FT                   IDTEHQRRLFGLAL"
FT   gene            109080..110606
FT                   /locus_tag="Mmwyl1_0098"
FT   CDS_pept        109080..110606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0098"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   shn:Shewana3_2224 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69040"
FT                   /db_xref="GOA:A6VRG1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG1"
FT                   /protein_id="ABR69040.1"
FT                   /translation="MALTQSLKTEDAGTNRIMITISVMLATIMQALDTTIANVALPHMK
FT                   GAMGTTQDQISWVLTSYIVAAAICMPLTGILSAKIGRKRLFMWSIVGFTVSSILCGAAQ
FT                   SLDQIVLFRLLQGVFGASLVPLSQSVLLDTYPKEKHGSAMAMWGVGVMVGPILGPYLGG
FT                   LLTEYYSWRWVFYINVPFGIIAWLGLAGFLEESKLDKKRSFDMYGFVLLGVAIGSLQMM
FT                   LDRGESQNWFASLEVTIEGLLTVVCGAMFLVHIFTHSHPFIDPKMFRDRNFSVGMVFIF
FT                   IVGIILLSSMALLPPFMSSLMGYPVVDIGAILAPRGFGTMAAMIIVGRFANKIDARLFI
FT                   TLGLVLITYSMWEMTLFTTEVTAWDIIRTGMVQGTGLGFIFVPLSTISFATLDPKYRNE
FT                   GTSMFSLLRNIGSSIGISVVTTYLAQRTQINHAAFADYINPFNLGLQIAQEQGAYNTTT
FT                   AAGLSALNQVVTGQAATLAYLQDFRLMMWVTIAALPLVLLLKGRSKQTRA"
FT   gene            110794..111402
FT                   /locus_tag="Mmwyl1_0099"
FT   CDS_pept        110794..111402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vco:VC0395_A1915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69041"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG2"
FT                   /protein_id="ABR69041.1"
FT                   /translation="MSALDRHFILGYGSLINGESRAKTGETGEVWPVKLHGFERHWSVM
FT                   SVEYGMSSVAVIHAPEKACNGVLVEVPYDQFPLFDEREKGYQRAAIDAKQLTTYQDHPL
FT                   PEGTYWVYHTENVIEPYHECPIALSYLDVILSGCLEHGDDFAQDFLTLTKGWASPLLND
FT                   RKAPRYPRVQPELSTERLNTLLAPVTTLSIKELSVTYES"
FT   gene            111392..112453
FT                   /locus_tag="Mmwyl1_0100"
FT   CDS_pept        111392..112453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0100"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   small domain protein; KEGG: pat:Patl_0079 rRNA
FT                   (guanine-N(2)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69042"
FT                   /db_xref="GOA:A6VRG3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VRG3"
FT                   /protein_id="ABR69042.1"
FT                   /translation="MNLNSTSQLLVRNEEGLVGKILFANPEDTYPLDLSRKADVYAWCQ
FT                   SKTYYDALLRVGFADEKLFLSEQWALEHGSDFDHIVIYQPKAKELLDYLLASVLPLLKE
FT                   GGQIWLVGDNKSGVKSSMKRLEAGLDEVGKRDGAKHCLLYTGYKRRPTKPFVFEDWITT
FT                   WKQEVAGQTLTLCSLPGVFGHGKLDKGTDILLNQLNQHRFMSDVASARILDFGCGDGII
FT                   ALWLHNKTGARITALDDSVMALKATELTFAANQVSDAVTLIASNGLDEVKGRFNYVVTN
FT                   PPFHSGVNTDYSIAESFFMMVKQHLTLNGELFVVANDFLRYPPILDAALGSHTRLYRDR
FT                   GFAIYHGRQPKKK"
FT   gene            complement(112550..113167)
FT                   /locus_tag="Mmwyl1_0101"
FT   CDS_pept        complement(112550..113167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0101"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   hch:HCH_04209 putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69043"
FT                   /db_xref="GOA:A6VRG4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG4"
FT                   /protein_id="ABR69043.1"
FT                   /translation="MISMEFLITSLILVLIPGTGVIYTISTGLFQGARASFAAALGCTL
FT                   GIVPSMLASIFGLAVILNTSAMAFQVVKFIGVAYLLYLAWCMWRETGGLALEKKEEQKI
FT                   NLFQVALKGCLINVLNPKLTIFFLAFLPQFINSNSSLATSQMLLLGGIFMAMTFVVFIL
FT                   YGALASKARRYLIGSSNIAKYLQRTFAMSFALLGLKLALTDR"
FT   gene            complement(113282..114388)
FT                   /locus_tag="Mmwyl1_0102"
FT   CDS_pept        complement(113282..114388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0102"
FT                   /product="acyltransferase 3"
FT                   /note="KEGG: shm:Shewmr7_0291 acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69044"
FT                   /db_xref="GOA:A6VRG5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG5"
FT                   /protein_id="ABR69044.1"
FT                   /translation="MDIEASQEPSVDKSSPTKAKKVVRVIEFDYLRGLAIVLIVLGHSV
FT                   TNTNDGFPVWLENIVRGGTGVFVFISGFFFHHIFAQRFDYRRFMSKKVMNVLVPFLAVS
FT                   VFAIVVNFFGFLLVDQASVPEAFALCWEVLQKGFVLFPHWYIPFIMATFLCSGLHFRYL
FT                   KLPLFAQLSILAAFTIIAVVIHRPADNINVLQSLVYFTPFYLLGMLYSQYLDWMKLHYS
FT                   YFLVAAIITVIATVWLQSGVLFHAGGFHKAAFEWGGIDLQFIQKMGLCILLVGFCSHWV
FT                   WPTLGKHLIMLASISFAIFFLHPLLGMIWGNTKYFLLNAGYIEPNTTVAYSLISSVFLF
FT                   IFQFYGSVWLIGKLRRLFGSKSRLLIGA"
FT   gene            114630..115088
FT                   /locus_tag="Mmwyl1_0103"
FT   CDS_pept        114630..115088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0103"
FT                   /product="protein of unknown function DUF1456"
FT                   /note="PFAM: protein of unknown function DUF1456; KEGG:
FT                   ppr:PBPRA2338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69045"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG6"
FT                   /protein_id="ABR69045.1"
FT                   /translation="MNNNDILRRLRYTFDLKELSIVEIFAAADGIASQEQVTSWLKKED
FT                   DAGYVEMIDVEMATFLNGFINTKRGKREGPQPVPEKRLTNNAIFMKLRIALNLQAEEIL
FT                   DIMSLAEFNLSKHELSSFFRKPDNRHYCECKDQILRNFLMGLQKQFRV"
FT   gene            115308..116363
FT                   /locus_tag="Mmwyl1_0104"
FT   CDS_pept        115308..116363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_1239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69046"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG7"
FT                   /protein_id="ABR69046.1"
FT                   /translation="MLMKNKVAQAVIVASLSSQGFALELGDFNGTQFSVGGYVKAEGVF
FT                   NNPDESNSTFEGSASQSRLNVTTSRKEGDHNLKGFIEGDFRGASSVFRLRHATITIDNL
FT                   TIGQTWTGQFYANAPFDTEIINFYGTGIGTVSGNGAVVRPDLVVHYAKDGMRLTLQDPL
FT                   YNEAHYPDMVAAYTHRTADGHALNVAVTGRDVSLNNGDSEFGAALSLAAKLNFGDTSVT
FT                   LSGFSGKGAAIYAGWGYNGSAGTAATAELDGNGDLVTVSGFSAGIGHKISDKLRVNLRY
FT                   GQVTSDEVNSTVADDTLKTTTANMIYTYLPGLEFGVELRDQNAATRPPSATGTTVRPAG
FT                   QQVEVMAMYKF"
FT   sig_peptide     115308..115376
FT                   /locus_tag="Mmwyl1_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            complement(116431..117390)
FT                   /locus_tag="Mmwyl1_0105"
FT   CDS_pept        complement(116431..117390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0105"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: psa:PST_1666 benABC operon transcriptional
FT                   activator BenR"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69047"
FT                   /db_xref="GOA:A6VRG8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG8"
FT                   /protein_id="ABR69047.1"
FT                   /translation="MKFDFSACDLQVADASAQALASILLDKGFGEHHFTQSMPQERLTT
FT                   LKFKEFGPLSILEYAVGIATHVSSSNVENAYFLHVILAGHSVEQHQNGRRILKAGDSIF
FT                   IMPKNRFEANDSADCRKLIVKIPTDFLHQTAREFGYLFPLDPIRFESKVSQFPLTGPLF
FT                   NLLNDILQQDKDELYERALIYYCRLLNSGILNMFDSNVGPSTLPKKSLHRHIERIRNYV
FT                   LDNITTDIAIDELAHLCQISRKSLYNLFERETGLTPSAYIRRLKLESIHSELKNNERIK
FT                   NVTQVALKYGFTNLGRFSAQYREQIGELPSQTLRDFSY"
FT   gene            117617..117931
FT                   /locus_tag="Mmwyl1_0106"
FT   CDS_pept        117617..117931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tko:TK0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69048"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRG9"
FT                   /protein_id="ABR69048.1"
FT                   /translation="MIAREWKARCPMAKKEGFIAYLYETGVKDTSATEGFKGAQIFGRE
FT                   VDELTFEVTLITYWPTRESIVAFAGQDIEVAKLYPEDDDYELDPDTFVRHYDVIENHWV
FT                   "
FT   gene            complement(117978..120266)
FT                   /locus_tag="Mmwyl1_0107"
FT   CDS_pept        complement(117978..120266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0107"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein; KEGG:
FT                   cps:CPS_3968 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69049"
FT                   /db_xref="GOA:A6VRH0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH0"
FT                   /protein_id="ABR69049.1"
FT                   /translation="MARFKARFRLWAYLPIAGILLFLSFLIFDWVAPVDLESRSLSQTV
FT                   LAEDGSILRNFADENGVWRFPVTLGDVSPNYLEALITYEDQYFYHHPGVNFFALIRATW
FT                   QWLSTGEIVSGGSTLTMQVARIRYPEARTVWGKLKEIVRALQLEWHFSKTDILTYYLNH
FT                   APFGGTYEGIQAASLGYFGHTVKQLTDAQAALLAVLPQAPSYYRPDRHNERAQQARDKL
FT                   MRRLVTLKEWSTERLNDALIEDIPAVTKQDYQSAPLLARRLVTHNKSPQIETFIHSQWQ
FT                   GQISNLLRNYVHGIGQKVSAAALVVENETGKVKVYAGSADFNDSSRFAYVDMVQATRSP
FT                   GSTLKPFIYGMALDEGLIHSESLLMDVPLKFGDYQPDNFNGGISGPVSVTHALQKSLNI
FT                   PAVQVLEQLKPIYFFLKMKKAGIELKLPTGAKPNLAVALGGVGSDLEDLVYAYTSLGNK
FT                   GQAQHLRFSTEDKQSQQPLLSNGAAWIIRKILLDNPDSVSGLAVKTGTSYGFRDAWAIG
FT                   VSQHYTLGVWIGRPDGVPMPGHYGQVTAVPLLNNIYQRLNDRRPDPLMPDSVSKVDICW
FT                   PQGDIVKTVCEESHSAYILDGTIPKTWYNTASLQQPFNQSEFQFWQADDSKLRVNISCQ
FT                   VNAKRHKVTVWPAPLDNWLSLEQRRSSRIPSWDPRCETTGNLVSQSAVRIYGLANQDAF
FT                   QLPKQQNQEITLSAEGGEAPFYWFLNGVLLPDQQRKTTLKDLKSGNYQLTLIDQAGSRD
FT                   QVEFSVLLY"
FT   gene            complement(120266..125125)
FT                   /locus_tag="Mmwyl1_0108"
FT   CDS_pept        complement(120266..125125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0108"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein; KEGG:
FT                   pmy:Pmen_0730 alpha-2-macroglobulin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69050"
FT                   /db_xref="GOA:A6VRH1"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR040639"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH1"
FT                   /protein_id="ABR69050.1"
FT                   /translation="MRSVLSGLHLIWMSFLLLSSTLHAADFYISDVSETTQDNAPALVI
FT                   RFTDSIDPQSDLSKSISVTPNPTTGNIWIPQNNGRQWVLPFVEPSTEYTIRVDSKTKSI
FT                   SGSTLSEKDSEGNIHNFERTVKTREIIPGANFSGKGSFLVGNIQNGIPVTVINQKSVDL
FT                   DVFRVRDDTLDRFIDETSLQGMNDYYSLNRLKKYADLVHTARYENDAKANQRKTYNLNL
FT                   DPVLEKNSPGIYVAIIRKPGDYDYAYDTAVFTITDIGLHARKYKDSLVIYSHSITTAKP
FT                   MPNVNLRFLWPKTDKQAAREQAATSGLDGSYQLSTNDLPKVVLARHGDSITFLKLDEGE
FT                   LDLSAYPNVPSLHRNYQMFMYGPRDLYRPGEEVSINLLLRDYDGQKVANLPLQAKLYDA
FT                   RGERKKQFTWQPDSTNLYQTSFQLDGNAPTGKWRLEVSINNDYVDTYWFQVEDFLPETL
FT                   TLSFYDDVPNQTRYAPKGSFDVPIQGDYLYGAPAAGNDADAVVTVSPSTTPFPALKDYY
FT                   FGNAKEKINGRTLKTAAIKLDKDGKGVISVPDNWANTPVPLRYLVSASVYESGGRPVTR
FT                   NQNIIQLPDFEKLVGIQPLFKGRPASNETLQFKLLSVDQKGKPVADKLSVRMSRNYREY
FT                   FWEYNESRGWYWNYQSHIYTVGNENIDVKGNAVTVDFPVQWGTYILEVTSETGAKSTFE
FT                   FETEWSWDNQSSSNLKPDMLQMSLDKDHYKPGDKATLRLTSPVAGDGIINVESTNGVQY
FT                   SLHKHIEKGTNEVSIDIQQNWNRHDLYVTTMVLTPADQVTEVAPKRALGITHLSIIRPD
FT                   AIADVKLTTEEKVQPNKVVKAHINVANVSELGNQPLYATVALVDKGVLNITRYKPPQPE
FT                   QYFYAPRRFESAYFDIYGKIINNLGYDMIRQKFGGDAFNESDAELSRGGKKPKSDVQII
FT                   SFLSEPVALVNGEADVSFDLPNFNGKLEWMVVVYGDHSYGSAHKEMIVADKLVSQIAMP
FT                   RFLAMGDKSQISIDLHNLSDAKQTFNVSVKVNGAVISEGVQQSLELADKEKTVLTIPIT
FT                   GADMEGQGVVTLNATNGDDINITRTWRLGVRSPYPWATNQLRATLEPGEQWKPSFDISS
FT                   LRDSSVQAMLTISNRPAINFRNQFENLLQYPYGCLEQTTSSTYPWLLLNEDMVSQLDLN
FT                   DSIEQEFKQPFSEAFRLKQIQNGIEKLKAKQLSNGGFGYWDSSSWESRWGTVYATEFLI
FT                   DARKQGIVGDDDMLKRAIERLTFFVNNNPESDMWSESSDYYQFSYRAYAAFVLAKADAI
FT                   SLSFVRRLYDQSSTTELNESGLAWMHLAGALHQLNDTSRAQKALELALKIDRKQYAYYR
FT                   DYGSILRDQALSLAVALELGLDDGDLADKMIESLQSKRWFSTQERIALLKVARQYANKN
FT                   SEWRATIQLPSGEQSLVKEQAFNSVFDADQLRKLKGITADDQKLYVSLQYQGAPKNTPK
FT                   PYSEGLRISRQYYDLTGKPTTPTKLTSGDLVIVELNVATVGDDLRIPDALVVDLLPAGL
FT                   ELENQNLSNASVDLDSIMIDEKPLGSYFRENNLLYQEYRDDRFVASVSLTNRSVKKLYY
FT                   LARAVTPGIYQIAPPFVEDMYRPNYRAIGTSINTLEIQPR"
FT   sig_peptide     complement(125051..125125)
FT                   /locus_tag="Mmwyl1_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(125207..126430)
FT                   /locus_tag="Mmwyl1_0109"
FT   CDS_pept        complement(125207..126430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0109"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pfo:Pfl_0659 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69051"
FT                   /db_xref="GOA:A6VRH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH2"
FT                   /protein_id="ABR69051.1"
FT                   /translation="MNTFEKDIRTSAINAFFIVSARCVSDLSRFLNMISLSSYVFIISN
FT                   SVYQFSIFMIFHVCGSIIASVASLPFFRKVQGKTALILINILCFFSMLLLIITPEKQHI
FT                   YAFPYIAFINGFTHTMFVIGTSSQLPNWIIKSKLVLTNTWLISLSSMSAVVGSLIAGTL
FT                   VATTGYQGIFLINCGVYVLVVGLLLPLKKMASHSAWASQSVSFKKEWRSLISELKKEPV
FT                   LGSMLLITLIGSLGNAAHQIGFPIIAEQLIPNNISQSMGILMASWAIGRFLGARAIAYL
FT                   LKKYAYLSLETLFLFGFSAMSLGFILVFQQHSQLWATAFIVAAGIGDGISDVSLISRIQ
FT                   TEPENLRLPMLSILALLKMTGFTVCMIIVAPFYTWLTLDLVILLFHGTPLIALVISQAW
FT                   LRQRPIQL"
FT   gene            complement(126627..127655)
FT                   /locus_tag="Mmwyl1_0110"
FT   CDS_pept        complement(126627..127655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0110"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: stm:STM3626 ABC superfamily
FT                   (atp_bind), dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69052"
FT                   /db_xref="GOA:A6VRH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH3"
FT                   /protein_id="ABR69052.1"
FT                   /translation="MNQSDNQLILKAEGLKQHYHVKQGLFKPDAVVKAVDGISFNLEKG
FT                   KTLAVVGESGCGKSTLGRMLTMIETPTGGSLSHRGEDLLTLTADAQAKLRQKIQIIFQN
FT                   PYGSLNPRKKIGAILEEPLVINTKLSKAERREKALAIMAKVGLKAEHYDRYPHMFSGGQ
FT                   RQRIAIARGLMLDPNVIVADEPVSALDVSVQAQVLNLMMDLQQEFGLSYVFISHDLSVV
FT                   EHIADDVMVMYLGKVVEQGTREQLFENPKHPYTLALLSSTPQLSPDKRRKRIKLQGELP
FT                   SPLNPPSGCAFHGRCSYANERCKNETPLLRLDDQAEQEKGHMIACHAVEEKRIEVIEVG
FT                   AA"
FT   gene            complement(127652..128620)
FT                   /locus_tag="Mmwyl1_0111"
FT   CDS_pept        complement(127652..128620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0111"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: msu:MS1365 ABC-type
FT                   dipeptide/oligopeptide/nickel transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69053"
FT                   /db_xref="GOA:A6VRH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH4"
FT                   /protein_id="ABR69053.1"
FT                   /translation="MSLLQLENLSVTFGNFRAVDNISYKVEEGEVLGIVGESGSGKSVS
FT                   SLSIMGLIDFPGKVSADQLTFDGQDLQAMPEKQRRKLTGSDIAMIFQDPMTSLNPCFTV
FT                   GYQIIEALKTHQGGSKKELRARAIELLTQVGIPAPESRLDNYPHQLSGGMSQRVMIAMS
FT                   IACDPRLLIADEPTTALDVTIQAQIIDLLIELQRKKQMGLVLITHDLALVAEVAHRVIV
FT                   MYAGQIVESGPAAEVFSTPKHPYTQALLASLPESASGKARLEALPGVVPGQYDRPAGCL
FT                   LSPRCPYATDHCRKVEPANQGDLDRQVKCHTPLDRKGRPAA"
FT   gene            complement(128632..129546)
FT                   /locus_tag="Mmwyl1_0112"
FT   CDS_pept        complement(128632..129546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0112"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sfx:S4193 dipeptide
FT                   transport system permease protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69054"
FT                   /db_xref="GOA:A6VRH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH5"
FT                   /protein_id="ABR69054.1"
FT                   /translation="MTTSTKTSTTDIPLTAPVPMTPLQEFWHYFSSNKGAVAGLVVIAI
FT                   ICFMAVFANFVAPHSPSDQYRDALLLPPAWLEGGNWSFVLGTDDVGRDILSRLIYGSRL
FT                   SIAVGIVAVTASLVMGILLGLIAGYFKGIIDTAIMRIVDIMLAMPSLLLAIAIVAILGP
FT                   SIVNAALAISIVSLPHYVRLTRAATMAEMSRDYVTSSRVIGASPLRLMFICILPNCLAP
FT                   LIVQATLGFSSAILDMAALGFLGLGAQPPTPEWGSMLADALQFVQRAWWVVTFPGLMIL
FT                   ITVLAFNLMGDGLRDALDPKLKQ"
FT   gene            complement(129558..130568)
FT                   /locus_tag="Mmwyl1_0113"
FT   CDS_pept        complement(129558..130568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0113"
FT                   /product="Nickel-transporting ATPase"
FT                   /EC_number="3.6.3.24"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A2357
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69055"
FT                   /db_xref="GOA:A6VRH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH6"
FT                   /protein_id="ABR69055.1"
FT                   /translation="MFQFIFRRLSLVIPTFIGITLLTFTLIRLIPGDPIEVMAGERGVS
FT                   AERHAELSAQLGFDQPLYVQYYHYVTGVLQGDLGNSLITREPVMKEFLTLFPATIELAF
FT                   CAAIFAILIGLPAGIFAAVKRGTVIDHSVMTFSLTGYSMPIFWWALLLMLVFSVNLGWT
FT                   PVSGRIDVVYWIDDVTGFMLIDSILSGEEGAFASAVSHLILPSIVLGTIPMAVIARMTR
FT                   SSMLEVLSEDYIRTARAKGIAPWRVIVIHALRNALIPVITVIGLQVGILLSGAILTETV
FT                   FAWPGIGKWLIESIGRRDYPVVQGGILIVACIIIVVNLLVDITYGIVNPRIRHSR"
FT   gene            complement(130836..132428)
FT                   /locus_tag="Mmwyl1_0114"
FT   CDS_pept        complement(130836..132428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0114"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rru:Rru_A2356 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69056"
FT                   /db_xref="GOA:A6VRH7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH7"
FT                   /protein_id="ABR69056.1"
FT                   /translation="MKKGLAKLTLALMAAGAISTTAHAATTLVYCSEGSPEGFNPAFYT
FT                   SGTTFDATSKNMFNRLVEFKLGTTETEPGLATSYDVSSDGLEYTFHLRKGVKFHTSKDF
FT                   TPTRDFNADDVIFTFDRQGNKDNPYHTVSGGSYEYFTGMGMDTLIKEMVKVDDYTVKFI
FT                   LTKPEAPFIANLAMDFASIFSKEQADFYMKKGTPEKLDIDPVATGPFQKVQYQKDSLIR
FT                   YTAFKDYWQGKAKIDRLVFSITPDASVRYAKLKAGECDVMPYPNPADLQQMEADPNINL
FT                   MSQEGLNVGYLAFNTQKKPFTDPRVRQALSLATDKSAIIDAVFQGAGKAAKNPIPPTMW
FT                   SYNKNVVDYPYDPVKAKKLLAEAGYPDGFSTNIWAMPVQRPYNPNARRMAEIMQEDWSK
FT                   IGVKAEIVSYEWGEYLNRSKKGEHDTVLLGWTGDNGDPDNFLYVLLGCDAVGGANRAQW
FT                   CNEEFNDLLLKAKQTSDKAERTKLYEESQVVFKREAPWITIAHSVVYEPIRKEVKGYKI
FT                   DPLGGHYFYNVSK"
FT   sig_peptide     complement(132354..132428)
FT                   /locus_tag="Mmwyl1_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(132952..133821)
FT                   /locus_tag="Mmwyl1_0115"
FT   CDS_pept        complement(132952..133821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0115"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: bms:BR0950 oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69057"
FT                   /db_xref="GOA:A6VRH8"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH8"
FT                   /protein_id="ABR69057.1"
FT                   /translation="MKVSFIGLGTMGYPMAGHVSKAGHAVVVFNRSTQKAQNWCEEYTG
FT                   TFATTPAIAAQDADIVLTCVGNDDDLRAVYLGPEGAFQQAKAGTLFIDHTTASAEVAKE
FT                   LHQAAQERGFYFMDAPVSGGQAGAVNGVLTVMIGGSQGDLDKAQPVLDCYAKATSLMGP
FT                   VGNGQIAKMVNQILIGGVLSGLSEGIRFAQTAGLDIATLVDTLKHGAAGSWQLENRGET
FT                   MAKNEFDFGFAIEWMHKDLGLCLAQSEKMGIKIPLTQAVDQDYQALIAEGRGRQDTSVL
FT                   VKALDKKA"
FT   gene            complement(134278..134898)
FT                   /locus_tag="Mmwyl1_0116"
FT   CDS_pept        complement(134278..134898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0116"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ret:RHE_CH01936 probable arylesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69058"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRH9"
FT                   /protein_id="ABR69058.1"
FT                   /translation="MATILCYGDSLTWGRVPNGGRYPKHLRWPTMLNDLLGQQHQVINF
FT                   GLPGRTTIWNDPFLEGRNGLTYLQAALETFGPVDILILMLGTNDLKRHFHIGAYEAAKG
FT                   IEKLIEKSRIPNSHDFPVPTLVVIAPPNILSPTGSMAESFDGAIEKSQHFHQYYQDIAI
FT                   RNQCIFLNAAGVLQPSDVDGVHLDTQANEQLANAIYSLIKMEI"
FT   gene            134993..136423
FT                   /locus_tag="Mmwyl1_0117"
FT   CDS_pept        134993..136423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0117"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: maq:Maqu_3572
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69059"
FT                   /db_xref="GOA:A6VRI0"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI0"
FT                   /protein_id="ABR69059.1"
FT                   /translation="MSITPSTFSSKDDICSALSRLKNVARQTPFPSAEERRQCLTRLQV
FT                   VLMNHETSLLDALQKDFGHRAHEESRLLELVPLLGEIKHAKRHLVKWMKPSKRKVHIST
FT                   LPASAQVFYQPKGVVGVISPWNYPVLLSLGPLVGALTAGNRVMMKLSEFCPATNQVLRD
FT                   IVTHALGEDWVEVVEGEADIANEFSLLPFDHLLFTGSTSVGHIIMRNAAEHLTPITLEL
FT                   GGKSPLLVAPSADLRDTAKKLVFGKVLNAGQTCVAPDYVMCHSDQKQILIDYIKQELAD
FT                   YYPEGVLSPDYTSLINVRQLDRLKGYLEQARAAGVQCDNLMPQGPEESDGKLALHALYQ
FT                   PNDALNVMQDEIFGPLLPILTYADMSEALSYIQQRSRPLSMYLFTQQNEDQKRCEESIA
FT                   SGSLVINHTLVQVAQADLPFGGIGASGMGAYHAEEGFRTFSHSKSVLRKRGPNVLTLLR
FT                   PPYLRRIHKLVAKYWPYL"
FT   gene            complement(136541..138526)
FT                   /locus_tag="Mmwyl1_0118"
FT   CDS_pept        complement(136541..138526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0118"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   pfl:PFL_2312 methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69060"
FT                   /db_xref="GOA:A6VRI1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI1"
FT                   /protein_id="ABR69060.1"
FT                   /translation="MKSPIRIRQQINIGLVVILLLALASIYIVIETKVKPDLTAERQQQ
FT                   ISVNQKGLSELLSAKLEKIQLLTSTLALASTELPKDEALFKKVFPNIINNHDDKSIAGG
FT                   GIWPEPSAFTQGTQRRSFFWGRDGSKMSYLDDYNDPAGSGYQNESWYTVGKTAPVNRCT
FT                   WSEAYIDPVTKIPMVTCTIPMKENTKFTGVTTVDMMLDGITNTLEQYGSENQGYVFAID
FT                   QAGQVLSFPKGKANLVKSDGSMLTAAELGNQLPWLKSALDKISGSQQVIALDHDDILNG
FT                   AAYVDLFKHPQTGWTIGLVVPKARMTEIAQSMGLFLMIVIGALLVVVSIIAISYFRSLL
FT                   GQINQTTQQIQELADGGSTQELEVGKLNELGDLRQAVNAYGDKLKKLLEQIHIESANLV
FT                   KDAGRLSTFSNDFLNKANSLSDENTTLAAATEELGATSHDVAMYANETRETVERIHKDV
FT                   RNSGNEMSTVIETMRSLTSAMTQAQTNILKLDEDSRRANGMLSVIRDIAEQTNLLALNA
FT                   AIEAARAGETGRGFAVVADEVRNLAAKSESSAVEIEQVLGRLQIASKESVSSMELGHSE
FT                   TIRAVATAESTASHLQQVVNAFSQITDQATQISVAAGEQQKVSQDLSRFVSRLQELTGS
FT                   NASDSSHLSRMSQEIDAIANRLNALK"
FT   gene            complement(138650..139399)
FT                   /locus_tag="Mmwyl1_0119"
FT   CDS_pept        complement(138650..139399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0119"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; regulatory protein DeoR; KEGG:
FT                   bpa:BPP3096 glycerol-3-phosphate regulon repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69061"
FT                   /db_xref="GOA:A6VRI2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI2"
FT                   /protein_id="ABR69061.1"
FT                   /translation="MNKRHYDIVQWVNKQGRQTLQAVADEFSVSVQTVRSDIRLLAEKG
FT                   LVLRSHGEVIPFPHRENISFDQRRIRHAAGKKHIADLCVSKLADYQSIFLGSGSTVAEV
FT                   ANQLSLFQGLQVMTTNLHAARNLCEHPDCELTISGGRVRMRDQDVIGGDAMRFFQRYRA
FT                   DIGIFSVAAANKQGHLFDFTDDEVMAREALVEHCHYRILVIDSTKFDTESRCLWGKMSD
FT                   YDCVITDQKPSSSLLSSLSYQGVEILY"
FT   gene            139500..140522
FT                   /locus_tag="Mmwyl1_0120"
FT   CDS_pept        139500..140522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0120"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sit:TM1040_0544 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69062"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI3"
FT                   /protein_id="ABR69062.1"
FT                   /translation="MSVLLQLTYQKESFTMTVKKTLLLCAAALAFPLSVQAQDVLTLYT
FT                   SQPNQDAQMTVDAFEAANPDIKVEWVRDGTTKLMTKLRAELSSGVVKPDVLLIADSVTM
FT                   ESMVSDGYLYSYMSPNRDQYEDSLYSKDGYYYGTKLITTGIVRHKQAPQHPTDWADLVK
FT                   PEYKNQVAMPSPLYSGAALIHLATLTADKSLGWNYFEQLHANQAMAQGGNGGVLKAVAS
FT                   GTKPYGVIVDFLAIREAAKGSPIEFIFPKTGVTMVTEPVAIMKEAKNKAAAKRFVDFLL
FT                   SKEGQALVLEQGYLPARSDIGVPEGFPKRVDIRLMPFDAAKTLRDNEANKERFSKIFEG
FT                   "
FT   sig_peptide     139500..139613
FT                   /locus_tag="Mmwyl1_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            140573..142255
FT                   /locus_tag="Mmwyl1_0121"
FT   CDS_pept        140573..142255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0121"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sit:TM1040_0543
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69063"
FT                   /db_xref="GOA:A6VRI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI4"
FT                   /protein_id="ABR69063.1"
FT                   /translation="MDSQLRWLSIGLFVLIATLSVLPSLRLLVEALSHTAFSTSSPMAE
FT                   VLRSERTWTALRNSFYTSGLGTLIAVVLGCGFGFVVTLTNIRGRAIWVFCFMLPMMIPP
FT                   QVTALSWLQLFGPASPILNTLGIAPALGSPQPMYSAEGIALLLGIQSAPLVFLALRTQL
FT                   ISLPQDLLEAAQLSRASQFRIWVDIILPLCRSAIIAGAALAFVSSLGNFGIPAMLGIPA
FT                   GYIVLPTLIYQQMAGFGNDMLSQVAGLSMIIALLVLAGMLLQQWLQQRSCYALLGHTAQ
FT                   SLSFRLKQWRLPLEILLALMLCFILVAPLFALIVSSLVPALGMPLNADTITFAAFYEMI
FT                   GRQGVTSRAFENSAFLAFFSALVLMLVSLPLGYLLMRLPMRTRAVIASLIEVPYAIPGI
FT                   VLAIAFILLFAKPLPFIEVSLYGTLGIIFLAYLSCFLSVCLKPVLSAMSQLDPALEEAA
FT                   QLAGARPIQRLMDIILPLTAPAFFAGGLLVFLISINELTVSALLWSAGNETLGVLIFNL
FT                   DESGDSVLASAIAVLVVLLVAGLMSLLSLFAPRLPKGVIPWHG"
FT   gene            142243..143286
FT                   /locus_tag="Mmwyl1_0122"
FT   CDS_pept        142243..143286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0122"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMc04300 probable ferric iron transport
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69064"
FT                   /db_xref="GOA:A6VRI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI5"
FT                   /protein_id="ABR69064.1"
FT                   /translation="MARLILDGVEKSFHGTPVVKGLNLTIEPGEFVALLGPSGCGKSTI
FT                   LRMLAGFENVSGGQIIHGDDCLSSSTRHVPTEERNFGMVFQSYALWPHMTVKENVGYPL
FT                   KVQKTPVAERNKRIKDALEIVQLEEYADRLPAQLSGGQRQRVALARSLVTEPDVVLFDE
FT                   PLANLDRHLRATMEETFRAFHKRTGATMVYVTHDQSEAMSLADKIAVLNKGQLVQWGTP
FT                   QELYARPRNTWLANFIGRGSVLSVAAVAPSQYVSGTNLTELIRQHSPDKAASSVLVRPQ
FT                   DIHFVSADDSALIVSVHSCIFRGERYDIELTLKDGQRLLAYSDVPMTLESQHQVRLGQA
FT                   WSLESES"
FT   gene            143283..144383
FT                   /locus_tag="Mmwyl1_0123"
FT   CDS_pept        143283..144383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0123"
FT                   /product="beta-lactamase-like protein"
FT                   /note="KEGG: sit:TM1040_0541 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69065"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI6"
FT                   /protein_id="ABR69065.1"
FT                   /translation="MKVSIDILSGAGRKTAAAILVTYEAEHQSKPIRFLLDAGGALEVG
FT                   EDKGWTQPDHLDAIFISHDHQDHMGGLIDIDSKVPVYATSPVQQQLPTHLNLHTLPICG
FT                   STNVSGIKVTTGSAGHSFGGVWLHLDMGEGVFYSGDFSLESGLYPFTMPPLASVALLDA
FT                   SYGLYDNSLEQCKNALLHYLKDERALLMPVPQTGRALEMACWLTSLGFHDWTLGEDCIA
FT                   PETVLAGPKDSVCSEIRPVLENMKSQPFNPNAKVVLCGDPDGLSGEAAVLLQQPERYLP
FT                   VYTGHLPEHARQAVSEDRAHFERWNVHPRKQDLKRLVDHLGCHICVPLFYTMKDLSEWR
FT                   QALGPSVTADSYIELDCIELDYDLNT"
FT   gene            144367..144936
FT                   /locus_tag="Mmwyl1_0124"
FT   CDS_pept        144367..144936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0124"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: csa:Csal_3230
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69066"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI7"
FT                   /protein_id="ABR69066.1"
FT                   /translation="MTLIPKPFVFARHAQSEFNAAFRIGGFTDSPLSIMGVQQAKDAAP
FT                   ILSAIDWSVVATSTLQRTQETAFHAVPKQTIMAYEQLKERNWGDLEGCPIEQQLPYDVT
FT                   PPNGESWRDFETRVLSALNEILSEHSWPLIIAHSGVYRVLNNVINGTPYCPRIGNVTPI
FT                   SFVPSQDENGWEITPFKGSFTCYQMP"
FT   gene            144918..145370
FT                   /locus_tag="Mmwyl1_0125"
FT   CDS_pept        144918..145370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69067"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI8"
FT                   /protein_id="ABR69067.1"
FT                   /translation="MLPNAVIVDLDGTLAEFDHTEVAHWVLGAEKHWDPFFEHMKHAPV
FT                   IENVLRLVNILKQQGQHILICSGRPESHKQHSVEWIQKHQIPCDGIYLRPDNADALPDE
FT                   DVKKALLEKIHQDGFTPWLVLDDRDAVVQGWRNLGLTCLQCAPGDF"
FT   gene            145501..146676
FT                   /locus_tag="Mmwyl1_0126"
FT   CDS_pept        145501..146676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asa:ASA_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69068"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRI9"
FT                   /protein_id="ABR69068.1"
FT                   /translation="MFQLVLLSNQQHIDVANLSLSAELMGLPKDIPISVQQTCLMGGKQ
FT                   TGSRLITLTVGDSVVRVVPTRGMAVLDVVRKDATGKEVRFGWDSPVKEVVHPSFVNQEA
FT                   SGGIGWLDGFNEMIVRCGYQWAGHPGQDGDEFLTLHGRIQNTPADEVVLEVEQVPPYRV
FT                   TLRGRVDEKRFKFTNFELQTVLSLTPDEPYLLVEDTLTNKGSYPREYQAIYHNNFAQPI
FT                   LEDGAQLHVPMAELSPFNDYAAGGLNDWNQMPAPTKDFDEMVFNIRPISDEKGFSYALL
FT                   HNANASCGIEVSYQTDTLPVLTVWKNTDTLEQGYVVGIEPGTSFAYNRSYQRDLGLVPT
FT                   IGAGESKHFVVRFGLLTDEDQVQASVANIAQLQSDQTAQVVSTPIVRLGEA"
FT   gene            complement(146645..147067)
FT                   /locus_tag="Mmwyl1_0127"
FT   CDS_pept        complement(146645..147067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0127"
FT                   /product="protein of unknown function UPF0131"
FT                   /note="PFAM: protein of unknown function UPF0131; KEGG:
FT                   csa:Csal_2119 protein of unknown function UPF0131"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69069"
FT                   /db_xref="GOA:A6VRJ0"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ0"
FT                   /protein_id="ABR69069.1"
FT                   /translation="MEFNMPTNIVAVYGTLREGLNNHELLTDCKRIGLGWLTGFRMHNL
FT                   GDFPGIVSTHENGGRIRVEWYDVSDEILASLDQLEGYDPKTPESSLYIRKRVFSPYGRG
FT                   WIYVYNKSLDHAPYMEAGDWERYSRTSMPHQGAQSV"
FT   gene            complement(147196..148281)
FT                   /locus_tag="Mmwyl1_0128"
FT   CDS_pept        complement(147196..148281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0128"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   methylguanine DNA methyltransferase ribonuclease domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; SMART: helix-turn-helix-
FT                   domain containing protein AraC type; KEGG: ent:Ent638_0045
FT                   methylated-DNA--protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69070"
FT                   /db_xref="GOA:A6VRJ1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ1"
FT                   /protein_id="ABR69070.1"
FT                   /translation="MLITDEKQADGYYQALLNREPSFVGVFFVAVKTTSIFCIATCRAR
FT                   KPKRENVEFYTHFKDAMDAGFRPCKVCRPTENAHEAPYEVQAAMNLVRDCTKAKITDQE
FT                   LRESGIRPIFVRRWFNQHYGMTFQTFQRMYRINYAFQELKTGKSATNTALDSGYDSLSG
FT                   FGYTFKKLLGHAPTLNLENAVILIDRLTTPIGPMFVCATDEGICLLEFVDRRMLETEFE
FT                   DLQRRLKAPIVAGENGHMKQLKIELEEYFAGKRSEFSVPLHTPGTDFQNAVWKMLGSIP
FT                   FGTTASYQEQATRLNNPKAVRAVAKANGMNRIAIVIPCHRVIGKDGSLTGYAGGLERKR
FT                   WLLDHERSHRQHLETQSLEKS"
FT   gene            148531..149157
FT                   /locus_tag="Mmwyl1_0129"
FT   CDS_pept        148531..149157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0129"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   yen:YE1144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69071"
FT                   /db_xref="GOA:A6VRJ2"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ2"
FT                   /protein_id="ABR69071.1"
FT                   /translation="MSTTIVIQEPSSPARLFLLFHGVGATPQSLAPLGEVLSKSFPTAA
FT                   VVSIQAPDASDFGQGYQWFSVQGVTEENRVGRIEAAMPVFVETVKYWQKKMGLGAEQTT
FT                   LIGFSQGAIMSLSSTQMVDEKIAEKIVSLSGRFATLPKKAANQSTNDIQVHFIHGDQDN
FT                   VIDYRLSQLAHEALRARGVISTYDLIPHLAHSVDQTVATCLLLRL"
FT   gene            complement(149237..151252)
FT                   /locus_tag="Mmwyl1_0130"
FT   CDS_pept        complement(149237..151252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0130"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pfo:Pfl_0657
FT                   chemotaxis sensory transducer, cache sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69072"
FT                   /db_xref="GOA:A6VRJ3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ3"
FT                   /protein_id="ABR69072.1"
FT                   /translation="MKTPHSLLLLDEFSKEVSMTVKSKIIALMAAGVILPVFIVSAVII
FT                   KNIRTNALQSFEQQSQSEIGYVDSIFSMYLNNLAENVTFLAQSNALTRLSPGSIKSYAE
FT                   QSIQEEMTPHKNSPLEQEAFALMDAFGKSHPDLTYIWLGSNDKGYLQWPIAKNSKNYNP
FT                   LERGWYKQSINSQSPIRIPAYRDSATNAPLVDYVQRFDGQNGFYGVVGIDVTLKKLTEL
FT                   LAEVKFGGDGYVVMVEDTNTILADPSDPNNNFKSVTEASRPYSTLSDTTTAQELTIDGE
FT                   IWYAKVYKSPILNWKFIGLVPSKVIYAQANSLIITIVIISLVMIAIFMVIGATLSSVVI
FT                   RPVKNMADRLTDISHGEGDLTQRLEVKSKDEAGQMASAFNQFVSSIDSIVGHAKSSCDK
FT                   ISLVAHQSEHLSSELSGVVSHQVNSVDQVSTAFNEMVATANEVASSCSNAAAAAENSET
FT                   QVKEGNKLIQQTMDSLHGLEKEIHSSNESMIELSKESESIGGILDTIKAIAEQTNLLAL
FT                   NAAIEAARAGEQGRGFAVVADEVRTLAGRTAASTEEIDKMLSKLQQQTGFAATKMNHSV
FT                   SVAKDSVVLASQTHQVFEKILNSVLEIKDMMIQISASAEEQHLVAEEINTNVIVIHDGT
FT                   IKSSDLSNQVAETAASLNQLSDELKVMVGRFKSSQP"
FT   gene            151619..152380
FT                   /locus_tag="Mmwyl1_0131"
FT   CDS_pept        151619..152380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0131"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ppr:PBPRA2195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69073"
FT                   /db_xref="GOA:A6VRJ4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ4"
FT                   /protein_id="ABR69073.1"
FT                   /translation="MDYSLFTVSLLIGTGFLAGIINTLAGGGSNLTLPALMVMGMPADI
FT                   ANATNRVGVFLQNVAATFGFRKAKKLDNADILPVMIPSLLGGVVGAFAASYAPEAWLKP
FT                   LLLSAMIGMTLIMIVRPTMIAPPEGTVPFKVSEKPSAWIALFIAGVYGGFVQAGVGFIL
FT                   IAALAGTLRYDLVRTNALKMVCTLGFTALALGVFIWNDQILWIPGLILASGTMLGSFLA
FT                   VKMAIKANPSHLKWFLFIMTVCGSAAALLSD"
FT   gene            152600..154117
FT                   /locus_tag="Mmwyl1_0132"
FT   CDS_pept        152600..154117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0132"
FT                   /product="Pectate lyase/Amb allergen"
FT                   /note="PFAM: Pectate lyase/Amb allergen; KEGG: bsu:BG10840
FT                   pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69074"
FT                   /db_xref="GOA:A6VRJ5"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ5"
FT                   /protein_id="ABR69074.1"
FT                   /translation="MNRKILAASCLAASLIAGCSAVSTENTSQKLSNTGKNSISQDLMR
FT                   SVLPHNDGWAAAEGQVTGGSDALDAHIYTVSSRKAFVDALKEAGNLPKIIRISGTINLS
FT                   SNDQGRELIEADYRVAPYNFEDYKNAYAPAIWNIQPLIKKRPNRDLTGPQEEARLASAK
FT                   KQKDQIVIDVPSNTSIIGLGKNAKIIKGTLQISAGVENVIIRNIAFEDAFDYFPGWDPG
FT                   DSFKIDTNYPGCMGEYVNANQGPQKCPGGRWNSEYDLISINGGKRVWIDHSTFSDGDRP
FT                   DSLFPPVYPFPQNEITQKVQHHDGLVDITNQADLVTISNSYFHDHDKAFLIGNSDGKTA
FT                   DTGYLRVTLHGNYFKNVGQRMPRVRYGKVHAYNNYFVGNAQGDGVGANAYERHVDSLIN
FT                   KPKHNIVRQVLGAGKESAIYSEANVFEIENGNPSHAIGNMKGKVAYDQGSMFNGKMIDI
FT                   VEEANKASGKPLSKDVGWTPTLYGPTPVLPASEVIDYVKENAGAGKL"
FT   sig_peptide     152600..152674
FT                   /locus_tag="Mmwyl1_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.440 at
FT                   residue 25"
FT   gene            154560..155444
FT                   /locus_tag="Mmwyl1_0133"
FT   CDS_pept        154560..155444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0133"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: vvu:VV1_2053 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69075"
FT                   /db_xref="GOA:A6VRJ6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ6"
FT                   /protein_id="ABR69075.1"
FT                   /translation="MLIANSVSLFFCIIGGYYLLIKKRPKVAATILQLIVSIDTFILIL
FT                   IDGNEEFALVFAFLTPVMGVFLLGYRNGSILSLVYFAGIFYFCFTQMDTWQPEIFRPIS
FT                   LMHFSFIYSLLLIVSFFYDSSRRKAYQMMEETNRQLQELATTDVLTKLRNRRHMEDQLL
FT                   NAIGNHYIAMLDVDDFKKVNDQFGHDQGDKVLIKLAEVLMHNIDLLDTVGRWGGEEFII
FT                   IFAEQNLAQLEEKLKQLNYSVAHTDFGIVRPITISIGLANHNANRHRDSIRAMDQALYD
FT                   AKANGKNTYCIAS"
FT   gene            155468..156091
FT                   /locus_tag="Mmwyl1_0134"
FT   CDS_pept        155468..156091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0134"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   sde:Sde_3707 transcriptional regulator, PaiB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69076"
FT                   /db_xref="GOA:A6VRJ7"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ7"
FT                   /protein_id="ABR69076.1"
FT                   /translation="MYTPKHFEVNDLQELLSFVKTFPFATLVSNGDDGLNAEHIPMLVH
FT                   VDAENRVVLQAHIAKANKLWQNLANQADVLVIFQGENAYITPNWYPSKKVDGKAVPTWN
FT                   YRAVHIKGTINFIHEAEWKLSLLEKLTNTHEQKQPAPWSISDAPQEYIDRLQAAVVGVE
FT                   ITVTDIQGKFKLSQNQSAENKNGVRDGLAQVQHPMVDVMQKISS"
FT   gene            complement(156113..157033)
FT                   /locus_tag="Mmwyl1_0135"
FT   CDS_pept        complement(156113..157033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0135"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver; KEGG:
FT                   hch:HCH_00862 response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69077"
FT                   /db_xref="GOA:A6VRJ8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ8"
FT                   /protein_id="ABR69077.1"
FT                   /translation="MSNSFSVLIIDDEIINLQIISDILRSEVDIIMAKSGEQGVRKALE
FT                   LSPDLILLDVMMPDMDGFETMKKLSQDSRTCDIPVIFITALDDIKNEEKGLLLGASDYI
FT                   QKPIHPSIIKARVALHLKLINQHRILERLSTIDPLTSLANRRKYEETIRSEWKLMEEIN
FT                   ETLSLAVIDIDNFKQYNDFYGHAAGDKVLQKVAAILANNFKHNSNLVARYGGEEFVAIM
FT                   PRTSKKEALQRLNKCISEVQEIAITCKKENDSVVTISAGVSSIIPNDGFKFESLFAAAD
FT                   EALYLAKYEGKNQVKWKNVTTSDIA"
FT   gene            complement(157035..159773)
FT                   /locus_tag="Mmwyl1_0136"
FT   CDS_pept        complement(157035..159773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0136"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; KEGG: aba:Acid345_4059
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69078"
FT                   /db_xref="GOA:A6VRJ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRJ9"
FT                   /protein_id="ABR69078.1"
FT                   /translation="MKLNELFDQEEHDFMIKECLFQLWSHSDDLMFIVAVEENGEFSLY
FT                   DNNAASRIAMGIEPNKIYHRNRIRDMFPEEIVEGFYRTYREAITSRKPISIEQYTVNDG
FT                   KDLFYNTLLVPIFDEQDNPAFICGISHETTKIKTAEKMAVEAGEKLKEYNVGLKQINDN
FT                   LDAKVRERTAALELAKAELEEALEAKSSFVARMSHEIRTPINAVIGLSDLALNTSPNHK
FT                   EQQDYLQKIRDSGDILLSLVNNVLDFSKIEAGKLTAESVCFSTEKLIRTTVNMNVFGAY
FT                   AKKLELVTDIADDIPEYLLGDPLRIQQILVNLVSNAIKFTESGSIVIRLRCNKLDGENI
FT                   LLQCEVSDSGIGISSTQLEQLFCPFTQADNSVTRVYGGTGLGLTITRQLCELMNGEIKV
FT                   ESDVGKGSTFTVLLPLKVPTLQPKNAAIDSANMLKALVVDDHPLSRDILAKLLTNFGIE
FT                   STCVGSGWEAIDAIQQSDQSGVAFDVVFMDWQMPGIDGIETSKKIKNLFKELAPPILMI
FT                   SAYEKHHIQPHLDTGIIRQFIEKPIGKSTLFDAINQFFNIEKIAISNKKIAPIPQLSSF
FT                   HILLVEDNLINQQVALGYLKSTGVQVDCAENGKIAIDKIKGTQYDLILMDIQMPVMDGL
FT                   TASAIIRGMDLGYELPIIAMTAHTSPEDKEKSLSVGMNNHIPKPIPSDLLYKTLSNYLI
FT                   SNKENSKPDVELLPVKPALNDKLSMLFKISSLEAGKAIDSLKDDTSIYLKIVRSFWTQY
FT                   TSLLEDPNTRFLTLDNRNLLNDIHSLKSNAAYIGAQDIFKDCVVIERKLLKNEYVDGSL
FT                   LDAVISKLSILLRALDLVFNQIEYKDFDSTTNLKSTLRKVLPLLEQSDFKVENYFPALH
FT                   HKSMNTQYSEDITQIIQNITDIEYEQAAKLVRQLLVKLPGS"
FT   gene            complement(159828..161111)
FT                   /locus_tag="Mmwyl1_0137"
FT   CDS_pept        complement(159828..161111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0137"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   cvi:CV3147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69079"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK0"
FT                   /protein_id="ABR69079.1"
FT                   /translation="MTILTTKALFNIVNGSTLLASGGGGSIKTAYSFVNQIVETKKSIT
FT                   LCSPGSMKNSDFGVVVGAMGSPESFEKIGLQGSEKRAVEVMQDLNKSKRINFTISVETG
FT                   SNIFVAMLAAAKTLDPALVIDADGAGRSVPTLSCLSYSSKINITPFVVLNAPHGKVLVE
FT                   GDIVLNLPHISDEDSDGATKKKAQASIIENMVRPILSSEGSFDGVGAISGWIMNGDQAK
FT                   SALVSNTISMAQSIGEQLNKFKVNDKNIIHDLAVFLNILNISLYSLSEANSPFILKSKD
FT                   CVSQGGFDFNKLSFTQTVNGRVRELIVINQNENLLIWDKDKDHPLTICPDSICMLGKLD
FT                   ETIKDDILADLSSLSGIEKEEADTSLSGWHGLSVEDVVEGQEVYLFSLPAPETLKNENQ
FT                   EVFSALAKQFGYYGSYESLDKLLTKEDI"
FT   gene            complement(161543..162718)
FT                   /locus_tag="Mmwyl1_0138"
FT   CDS_pept        complement(161543..162718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0138"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pmy:Pmen_1505 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69080"
FT                   /db_xref="GOA:A6VRK1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK1"
FT                   /protein_id="ABR69080.1"
FT                   /translation="MKINFPLMALAMGAFGIGVTEFSPMGMLPVIAGDLGVSIPTAGML
FT                   ISAYAFGVLIGAPVMTLLFANMPRRRLLVLSMGIFTIGNLISAMADSYSALMIGRIITS
FT                   FNHGVFFGVGAVVATKLVQPNQRAGAVAAMFSGLTIATIGGVPLASFVGATFGWRNAFF
FT                   GIAVIGLVAMVALRVSLPPLVNQEKANMRNELAVLSKGPVLAALLLTVVGASSMFTVFT
FT                   YIVPMLQQETHASTTFVTAMLVLYGAGLAVGNILGGRYADRSLYGTLIVSLIAVILLLI
FT                   IFAATMSSSIIVVPLIFLWGIASFAVVPPLQSLVVHEASEAPNLASAMNIGAFNLGNAV
FT                   GAALGGGVISAGLGLSSVALAGAGTAVLGLLMVLLLKRSPSNQSNEQVASS"
FT   sig_peptide     complement(162620..162718)
FT                   /locus_tag="Mmwyl1_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.771 at
FT                   residue 33"
FT   gene            162819..163724
FT                   /locus_tag="Mmwyl1_0139"
FT   CDS_pept        162819..163724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0139"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bra:BRADO6676 putative
FT                   transcriptional regulatory protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69081"
FT                   /db_xref="GOA:A6VRK2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK2"
FT                   /protein_id="ABR69081.1"
FT                   /translation="MKQIKVDKTAEMETFLTVAKTGSLSGAARELGLTPSAVSRMMTRI
FT                   EKRLGVRLLVRSTRKLYLTSEGESYALAARRILKDLEETERAIADRASPSGLIKVSTPT
FT                   AYSRLTMIPLYKEFLQRYPNIKIEVEVSDKISNVADGHIDVAIRFGPLPDSNLTARRLG
FT                   ETGRTIVATPNYLAQAGSPKTPADLQHFNCLDFSFQRIEPGWPFRENGEDYILPIQGNM
FT                   TSNNGETLVELVMADIGITRVGNFHIQQALASGQLIPLLEDFNPQDKEVIHAVFIGGQH
FT                   MPARVRVFVDYLVEKMIRHF"
FT   gene            complement(163809..165107)
FT                   /locus_tag="Mmwyl1_0140"
FT   CDS_pept        complement(163809..165107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0140"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: chemotaxis
FT                   sensory transducer; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAC
FT                   repeat-containing protein; KEGG: sbl:Sbal_3377
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69082"
FT                   /db_xref="GOA:A6VRK3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK3"
FT                   /protein_id="ABR69082.1"
FT                   /translation="MIFSKKKDKPSTSTPENQKLKQCNDELNAIKQNTACISFDVNGII
FT                   LDANTIFLDAVGYKLEDIIGKHHRIFCDAEYTKSTEYKAFWDDLKKGKSFHDTFLRFKQ
FT                   NKQPIYLEASYFPVSDESGKVIKILKIANDITEMQESLKNKNAILTALDRSLAVIEFDP
FT                   EGNILHANSNFLRAMKYDLQDIVGKHHKMFCDEKFYRDNPSFWSNLAHGQHSSGRFQRF
FT                   DGNGKVIWLEATYNPIFDEKGRVYKVIKFASDISERVNNAMNAIELAAATSEQTSQVSS
FT                   NAVEILNASVQTSNDIAEKVKSAAEIGDLLKSQSKSISDIVVTIRSIADQTNLLALNAA
FT                   IEAARAGDAGRGFSVVADEVRKLASNTATATAEIGSVVEKNHNLINEMDDMLRSVTGIA
FT                   LHGKESINEVSRGLTEISSGVARFVEMVDKMKD"
FT   gene            165481..165780
FT                   /locus_tag="Mmwyl1_0141"
FT   CDS_pept        165481..165780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0141"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: Addiction module antidote protein HI1420;
FT                   KEGG: neu:NE1355 Cro repressor helix-turn-helix
FT                   motif:helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69083"
FT                   /db_xref="GOA:A6VRK4"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK4"
FT                   /protein_id="ABR69083.1"
FT                   /translation="MTSIKELTNFDMAEQLRTDEDIAAYLSMVLEDGDTDELIHALGHI
FT                   AKARGMTQIAKDSGLGRESLYKALRSGSRPQFDTIVKVLKSLNFDLKAVIHTQK"
FT   gene            complement(166107..167279)
FT                   /locus_tag="Mmwyl1_0142"
FT   CDS_pept        complement(166107..167279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0142"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gka:GK2763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69084"
FT                   /db_xref="GOA:A6VRK5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK5"
FT                   /protein_id="ABR69084.1"
FT                   /translation="MIYLIRFLSSSAWSCFYPFMAVWLHGVVGLTSSSASVVVGFAIVA
FT                   NRVGALVFYGVLDKVSHRYEIIFSLFLMALFASLMLASAHLKITNIAIWIVIVSLFGIS
FT                   NSVSTISQISYIVHNFKEGMHEKALAYENVAANAGSGIAPFVASILLTFSGSLFAALPV
FT                   GLGVVAACCAYYLHNSRLVHKRDTKTANINSTFTQLRDRALIIFMVINFLTMIGYAQFY
FT                   YVFPTYATEQFSSETVGQLFLLASAIIIIAQVPITSFFQRVTKLWRVIISNLLIASGVL
FT                   LLSNSSGGQFSLYIVVPLIVIGEMICGPLYQAQAVKIWSGSSSTIMSIQTCIWGAAEAL
FT                   AAVAGLLLVAHGGGVASFIIGGGACILVTFTAWMSISSKKAIIGINLTEK"
FT   gene            complement(167276..168511)
FT                   /locus_tag="Mmwyl1_0143"
FT   CDS_pept        complement(167276..168511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69085"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK6"
FT                   /protein_id="ABR69085.1"
FT                   /translation="MKKILIVGINNVTLKYISKALKMGEVEPILSLDYLALSDSSKSCI
FT                   AGIKCIPFFGDQKTLSGYLQSHEEVAKEIGSITTFFDELFPMISEVALEFGYNSAPSIY
FT                   AKLASKSFVGSLIPEHVPFESRIVLSDDQITIPWIEKDKINDVMIKPEIGSGALATTRV
FT                   SIYPGESTVEVISSAILNCDIESPLKTPWIVQKYCEGELLSLEGFVEHGEINFLGLSKR
FT                   TRVGLTEASNAFPANSKVDISIRRKMTKAVNDLVIRSGFDNGFFHCEFIATNSTAYLID
FT                   ANMGRLGGASVIEQISLAHNLEPEKLLLHASLLPLGMINKHLEYEEIDKCNDTLAYWYC
FT                   IDEEAKILGWNMPSLSAKHTSMAKIGSIVAPIGISDHSWVGILCGYEEVVKEEISKITI
FT                   NTDKGQKSPVFT"
FT   gene            complement(168570..169922)
FT                   /locus_tag="Mmwyl1_0144"
FT   CDS_pept        complement(168570..169922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0144"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   atc:AGR_C_3718 glycolate oxidase subunit D-like; D-lactate
FT                   dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69086"
FT                   /db_xref="GOA:A6VRK7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK7"
FT                   /protein_id="ABR69086.1"
FT                   /translation="MNITLIDELQSIFGKRLNLSQTFRNQFCQAPSGVELCPPDLVITV
FT                   HSEEEIQLIIKLCSLHEIPVIPAGARSSLEGQINAPSGGICIDCSEMNEIIVVSDEDMT
FT                   ATIQPGVTREQLNDYLRHTGLFFPVDPGANASIGGMASTRASGTNSVRYGTMSSNVQSA
FT                   RVVTSDGQVVSVGSHAPKSAMGLDLLALMVGSEGTLGIFSELTVKLHPQPENIVSGVCS
FT                   FKTVENAINTVTNSLSQGISLARIELLDTTAVKACNQYSKLNLPETPHLFLEFHGNKTA
FT                   NDTSVNSFIENAGYHGGVAQFSNIQEERSALWKARHDAWWAFHSYYKGCKGLATDVCVP
FT                   LSHLSECIAETTNDIESSQLNAPLIGHVGDGNFHLLIMHKDEEDSAKIQNFLVRLSDRA
FT                   LSFNGTVSGEHGVGQGKRKWMAAQHGAALQLMKSVKSALDPKNILNPQKMF"
FT   gene            complement(169954..170937)
FT                   /locus_tag="Mmwyl1_0145"
FT   CDS_pept        complement(169954..170937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69087"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK8"
FT                   /protein_id="ABR69087.1"
FT                   /translation="MKNEKKPNPMLDSVNFDTDELCENKKALGAFLTQFRIRKGYLKVS
FT                   KFLEEIKLPFSDNYYRDIESGRKYLSVDSAVELHNHLKLDESSKISFDFFWHYFKDLLP
FT                   REIHESLFGKGVESKDISSVLELREHDSKVLRRALSLNRYEREFIADEKIVNSFRDNFD
FT                   LMPLMSYLYMVDQASVPEIRLVCQQLGLKFDQRVIDFLKLISKDRKSLDAPFVRQAPIL
FT                   RMPRNKEALRIKNKFLSHEVGISLEKEEKSEYFDVNGTFKYSAILTLKESELNEVQDRL
FT                   VDLLSVLELQNKSGNQLEDVDTHPYFYGLVISGRPEYDGREARKKN"
FT   gene            complement(171126..172115)
FT                   /locus_tag="Mmwyl1_0146"
FT   CDS_pept        complement(171126..172115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_0536 putative syringomycin
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69088"
FT                   /db_xref="GOA:A6VRK9"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRK9"
FT                   /protein_id="ABR69088.1"
FT                   /translation="MKGEIDDLSCFSHLSKATKVQEAFKEASCEIREQLLRQGAIVLKG
FT                   IAPSRDARIFEGIMNSLNFDLRDYVGGSSPRSTVKGKVMEATRTPADWSIILHQEMAYV
FT                   KKLPEVIAFVCVEPAENGGNSTIGDMRQINNLTKESSLNLLQKRGLKLRRTLPSEERVK
FT                   LKPGVKKSWQETFSTSSRLEAELICKARGWEYEWNSKDLVLWQDTIDPMRKHPITGASI
FT                   WCNQAHFWGATAMIEWAKLDNRKGDIQELTKAQKENSNLLEAMCFGDGEPLPDELSFEL
FT                   FHMVRGLESDVHLNSGDILLLDNFQFSHGRRAFSGNRKNNVIIANWGK"
FT   gene            complement(172615..173208)
FT                   /locus_tag="Mmwyl1_0147"
FT   CDS_pept        complement(172615..173208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0147"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG:
FT                   sit:TM1040_1922 DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69089"
FT                   /db_xref="GOA:A6VRL0"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL0"
FT                   /protein_id="ABR69089.1"
FT                   /translation="MLPDDKTRCAWASSAPDFPHYHDMEWGFPVDDDKRLFEKLCLETF
FT                   QSGLSWRTILTKRENFRLAFQQFDFHKVALFGEKEIAELLNNQGIVRNKRKILAVINNA
FT                   KRALEMVEKEGSLAAFIWRYEPNENTLPPPETQTTCAESITLSKELKKRGWQFVGPTTM
FT                   YAFMQSMGLINDHAEDCFMREEIYQARKGFKRPN"
FT   gene            complement(173195..174124)
FT                   /locus_tag="Mmwyl1_0148"
FT   CDS_pept        complement(173195..174124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0148"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: jan:Jann_1407 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69090"
FT                   /db_xref="GOA:A6VRL1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL1"
FT                   /protein_id="ABR69090.1"
FT                   /translation="MNINKLRIFHEVFVTGSITRAAERSYVSQPAASKMLANFEDEIGY
FT                   KLFVRNNGKLIPTDEALYLHEEVYGILQGVNHLEDSIKRAKNSKTGRLRIATIFGPSYQ
FT                   FLPELIAEYMKANPGVDVSLHLSGCSAIRQGIASGQYQIGLVDKAQSSSKHDSVAFDLP
FT                   CYCAVPKDHPAAQLDVIHPNDLLDLSWITLDSENATTKALKRIYAEMGLPLNRTLEVHT
FT                   TIHGLSFVNLGMGATLVDILNFRYFDKVFQLPNVVLKPFHPSVVEPLEVLTSNLSPLSG
FT                   LAKDFYDALIRKLEIQTQLPPDTKHASR"
FT   gene            174325..175356
FT                   /locus_tag="Mmwyl1_0149"
FT   CDS_pept        174325..175356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0149"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: ppr:PBPRA2185 putative amino acid ABC transporter,
FT                   periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69091"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL2"
FT                   /protein_id="ABR69091.1"
FT                   /translation="MKKFSLALAATTTLLAANSYAADTTSTLDAVKERGYVNCVIGNSF
FT                   PGFYSLNKAGEWQGMDIDMCRGVASAVFGDASKVKFLPVQWAQSFTSIKSGKGDILSKG
FT                   MTWTLSRDSAQGLDFLDTYFYDGQGFMVRKDLGVKSVKELNGATVCVLTGTSSELNIAD
FT                   YSRANNLDIKTVVFDDSSVRNTAFFNNNCDALTNDKSGLAAQRSAAPNPNDYVILPETI
FT                   SKEALSFAVKQNDSEWANVVKWTFAAMVAAEEFGVNSQNVEKMRAESQSPVVRRLLGVE
FT                   GDLNTGLGLPQDWAFQVIKNVGNYGEVYERNVGTDSVLGLDREGTLNELWTKGGLMYAK
FT                   SFR"
FT   sig_peptide     174325..174390
FT                   /locus_tag="Mmwyl1_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            175472..176704
FT                   /locus_tag="Mmwyl1_0150"
FT   CDS_pept        175472..176704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0150"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: vvu:VV1_2704
FT                   ABC-type amino acid transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69092"
FT                   /db_xref="GOA:A6VRL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL3"
FT                   /protein_id="ABR69092.1"
FT                   /translation="MIQSSTSKPQKSPTKGTGLPSSTTQKWMSLLNNDSSRAVILQAIV
FT                   LVLVLFGLWFLFANASENLNRLGMTFGFDFLQVTAGFNISWSLIPYDPGMSYWRVFLVG
FT                   IVNTLILSFCVIVVGTLIGTVVGILRLSDNPLVSQLARWYVEVVRNVPLLIQIIFWFTV
FT                   VFSTLPAPRQSYHLGEWLFLNNRGLYVMTMESTLSWGWIVALGVALIAALYGLFRWSKP
FT                   YYTLSGSRSTGFYIGLAVWALVACWAIWTFLNSTSLSVPTLQGFNFSGGAFLPASFGAA
FT                   FVAMTVYRSAAIAETVRAGMQSIDRGQHEAAFTIGFSRVQSLRLILIPQAIRSIIPPMT
FT                   NSWLAATKDSSLAVAIGFPELVSVFMQTSMNQTGRAIEIIFMVMGFYIFISLLISYLLN
FT                   KYNDSVQYKVR"
FT   sig_peptide     175472..175654
FT                   /locus_tag="Mmwyl1_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.914 at
FT                   residue 61"
FT   gene            176705..178063
FT                   /locus_tag="Mmwyl1_0151"
FT   CDS_pept        176705..178063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0151"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dps:DP1436 probable
FT                   amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69093"
FT                   /db_xref="GOA:A6VRL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL4"
FT                   /protein_id="ABR69093.1"
FT                   /translation="MDDLNVKNQPVLKQFVPTPPRPPHKSERGILGTIRHRCFNSIGNS
FT                   LLTLCVATVLFYLVKHVLDWAVFNAVFIADNRRQCMDISPDGACWAGVISWFNGLIYGR
FT                   FPVDEQWRVNIGVLLGLVWLLPLMSKRIPLRNFILLSWIGLYPFVGGYLFLGGRFGEEL
FT                   GLVHGAMTCLALAFLAIIYANWILSALGKKGLNELFVPLVSRLVERRIHLLGFVAVWLL
FT                   VALVIASGLSQVSLEPVPIERWGGLFLTFIIAGFAITMAIPVGVILALGRRSKLPVIHW
FT                   LSMTVIELVRSVPLITVLFMAVTLLPIFLPADMEFNKLTQVLVAVCLFAGAYMAENIRG
FT                   GLQAIPKGQYEAAATLGLGYLHTMVLIILPQALRMMIPNIMTSFISLLKDTTLVSIIGL
FT                   FDIMLMARNIANDKDWVGMHTEPLVMISVLFFILCYSMSQYSLNLEKRLKVDR"
FT   gene            178063..178833
FT                   /locus_tag="Mmwyl1_0152"
FT   CDS_pept        178063..178833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0152"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ppr:PBPRA2188 putative amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69094"
FT                   /db_xref="GOA:A6VRL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL5"
FT                   /protein_id="ABR69094.1"
FT                   /translation="MTTSSGNLAQKAVTETAIKIDNLNKWYGDHHVLKDVSLDISEGEI
FT                   MVVCGPSGSGKSTLIRSLNHLEEYQEGVVSVFGQPLSRDRQSHKIIHQTMGMVFQNFNL
FT                   FPHLTVLQNCTLGLTWLRKMSERDADKMAMRLLDRVGIAHLATRYPGQLSGGQQQRVAI
FT                   SRSLAMEPKIMLFDEPTSALDPEMVKEVLDVMIDLAKTGMTMVCVTHEMQFARQVADRV
FT                   VFMADGEIIEVGPPEQVLVNPQWDRTKEFLQHVL"
FT   gene            179015..180325
FT                   /locus_tag="Mmwyl1_0153"
FT   CDS_pept        179015..180325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0153"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rde:RD1_3866 oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69095"
FT                   /db_xref="GOA:A6VRL6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL6"
FT                   /protein_id="ABR69095.1"
FT                   /translation="MLAKNISTYTNMPFWLADTSLASKIHTNARFEIPQKVDAVIVGGG
FT                   FTGISAAITLARAGLKVVLLEAGHLGEGASCRNGGLLGPSFSKLGVDGLERQYGRDNVH
FT                   ETIRESLVAFNWLVDFIKEEQIDCDLSLCGRFRGASHPSHYAGLIEQAEELAKVVDFPA
FT                   IAVSRQDQFEEVGSNAYHGGVIYPTDGTLQPAKLHRGLCQIAQQAGVLMLEHTKVRDVS
FT                   KQGASYKVQYDGGVIDADQVIIATNGYTGGEFDKFKRRIIPIRSAMIATEELPESVIRS
FT                   VSPKLRAHGGTERLVAYYRPSPDGKRILFGGRAFGRGDQPQLYSKYLQDFMIRTFPQLE
FT                   EAKIDYAWSGYVAYTFDHVPHIGKMDDMHYAMGYCGSGVGRANYFGRKIAQQVLNQVEG
FT                   KTSFDGFPFKTRPLYTGTPWFLPMIMKWHDFADRRGW"
FT   gene            complement(180395..180847)
FT                   /locus_tag="Mmwyl1_0154"
FT   CDS_pept        complement(180395..180847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0154"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hch:HCH_03105 histone acetyltransferase HPA2/related
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69096"
FT                   /db_xref="GOA:A6VRL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024170"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL7"
FT                   /protein_id="ABR69096.1"
FT                   /translation="MTVKIRTIQATDAAAWSALRIEFLPEIKDISQAEVNAFFLGSYPN
FT                   VQEVLVALDDNQHMIGFIELNLRDNVPGSSQQTTPYIEAWFVSPDCQGQGIGKALIEAA
FT                   EQWAKQQGFQELGSDAPISNKKSVNLHKQLGFNEIERVVCLLKPLT"
FT   gene            complement(180870..181508)
FT                   /locus_tag="Mmwyl1_0155"
FT   CDS_pept        complement(180870..181508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0155"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="KEGG: spc:Sputcn32_1461 transferase hexapeptide
FT                   repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69097"
FT                   /db_xref="GOA:A6VRL8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL8"
FT                   /protein_id="ABR69097.1"
FT                   /translation="MKGPNPDTKEPMKGFPQVGYLKNFITRDNIIVGDYTYYDDPDGPE
FT                   RFEDNVLYHFDFIGDKLIIGKFCAIAKDVKFIMNGANHANAGFSTYPFYIFGNGWEKAA
FT                   PKAGDLPYKGNTNIGNDVWIGYDATIMPGVQIGNGAIIASKSVVTSDVPAYSVVGGNPA
FT                   KVIKYRFDEQTIQALQDIAWWDWSAEKITQHLDAIASADLNRLQAAKDE"
FT   gene            181615..183285
FT                   /locus_tag="Mmwyl1_0156"
FT   CDS_pept        181615..183285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pin:Ping_2323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69098"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRL9"
FT                   /protein_id="ABR69098.1"
FT                   /translation="MASTPVVSSLQEHVSFLLHEVETHCHLVELFFTSSSTALLSSIRS
FT                   RRGYVQALREKADIETARLLERRKTNTTFHAQVNGMHTLVIALEMLTKHCFDCIREGTL
FT                   DEPYKHPTGQECRKLVKRIRRALRLVKVGVSDNRRRTGIKLGRRTHKLLASYNELQALT
FT                   LQAKFDLIDDQLRAAILSNVSLKRLIEQLGVVAEALIKTDLGQVATLQNYPHLLDSATN
FT                   LNYDLRDLKVRRLALTRSGSAIAAITHKDESGNDVLAVYKEGDRSKIEEEVAGVNQWRD
FT                   IDPRLAPSVLCQTGTSQINGKSDGSNEQSSLLIEHIPGKTLEALLLAGDQDGTKAALKA
FT                   LFKTLNQTWKATLTPESCAANFMGQLQKRIGDSRKVHPEFFKDEERICGYTSLSFDELV
FT                   RRVAIQETQRRAPFSVLTHGDFNVDNLIYDDAEKRVYFIDLHRASYFDYVQDLSVLMVS
FT                   IYRLQVLSGETRTQMMESAKEVYRFGRRFASRQQDTTFEVRLAAGLARSFATSTRFIFD
FT                   KKLASRMHLRARYLLERLAKLSPEQAQTFTLPLKELYVE"
FT   gene            183278..184213
FT                   /locus_tag="Mmwyl1_0157"
FT   CDS_pept        183278..184213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0157"
FT                   /product="RimK domain protein ATP-grasp"
FT                   /note="PFAM: RimK domain protein ATP-grasp; KEGG:
FT                   pin:Ping_2322 RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69099"
FT                   /db_xref="GOA:A6VRM0"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR027592"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM0"
FT                   /protein_id="ABR69099.1"
FT                   /translation="MNKLKIGVVGIPGKWSTEVLADRLEERTGFRAVIDMSKVELRLDT
FT                   NQLMFQDLDLMTLDGLIIKKISEVYSPATEDRIHLLSYAERAGVKLFSPTQSVGNLVNR
FT                   LSGTLALQRGNIPMPKTRITESPEQAFDTVREFGSAILKPLYSTKARGMIMLTKADSDE
FT                   FVHNALEEYRQSQSIYYIQQTVKLDGRDLGMVFVGGEYLCTYARVGNKDSWNTTINSGG
FT                   KYEMFEPDATLIELGRRAQSCYDLSFTTVDIALTDQGPVVFEVSAFGGFKGALEGCDID
FT                   AASVYADYILKECVSQEGVSQECTLKETTS"
FT   gene            184210..185325
FT                   /locus_tag="Mmwyl1_0158"
FT   CDS_pept        184210..185325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0158"
FT                   /product="HPr kinase"
FT                   /note="KEGG: pin:Ping_2321 HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69100"
FT                   /db_xref="GOA:A6VRM1"
FT                   /db_xref="InterPro:IPR027597"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM1"
FT                   /protein_id="ABR69100.1"
FT                   /translation="MIKTLLNLPHVDEALSHCSETIRLHFADLSVIVHSNEAMLLAGIA
FT                   DYYRSYLKAEAHTTTSLNVYVMEQSAVGDELEWLEVPREAGKQGRKEGFLDVAGGRWIK
FT                   KFKTGMAFLQRPDHTVAVGPCSSNLAQIVNFINNQFLNHYLRQGFTLGHASAFCVNGEV
FT                   TAIAAGSGGGKSTLMLRCLENPERDFLTNDRLLLKNTGPKKTELKKTEQGTQTIGLAKL
FT                   PRVNPGTLLHAERLRHILPEDRHQALRQMPQSELWSLEEKYDVQIEDEYGPNRVRLAGN
FT                   LSRLIMLDWSLDSAEPTQLEPVDLSSQPEVIEGLRKRPGPFYQDKSGAFADLNAIDSVE
FT                   HYCRELANVKVYRLTGRIDFDRAYELIDTLK"
FT   gene            185466..186812
FT                   /locus_tag="Mmwyl1_0159"
FT   CDS_pept        185466..186812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0159"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pin:Ping_2319
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69101"
FT                   /db_xref="GOA:A6VRM2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM2"
FT                   /protein_id="ABR69101.1"
FT                   /translation="MPNPILSPIPAIMDRPHHSDIIARLPSEWTAWPRDESSVNSHVLE
FT                   PNETPSLFKKSKLRWPKRSVVFISDPHADAVAFEDSLIAAGVAERKKKSGLGHLSLTKK
FT                   GKQSEIIVGGDCLDKGPSNLKLLRSVKQLYKLKARVTLLAGNHDLRLLMGLLALARKKD
FT                   VGNQHFFVRMGKKVVPLFREVFDEYLADAHWDKKIPDEDTCRELLFPGDDWFKEFPFHA
FT                   AGFLTAEGIDREVRKMESKNHSFEKHCLSAGLSLRQVYATSLKCQQLFLHKKGEFNWFF
FT                   RRMELVAKRGSFLFLHAGLDDSMGQMLLKSGTKYVNKAFHRNLKRRDLFSFYYSSIANT
FT                   FRTKYRDADLPLTERGVNAIHKAGIHVVVQGHINRQQGQRITIKKGLVHVEADITLDCH
FT                   SRTAEGLKGHGIGATLIGKDTGIVGLSCDYPTAKVMTSTELQGIYGQVL"
FT   gene            186809..187078
FT                   /locus_tag="Mmwyl1_0160"
FT   CDS_pept        186809..187078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pin:Ping_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69102"
FT                   /db_xref="InterPro:IPR027598"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM3"
FT                   /protein_id="ABR69102.1"
FT                   /translation="MKSKTEFKYEALLDADDIQDVLKALSKGLSKGKLEFSEEKEGSLT
FT                   LDPKGLMRLKVSASEDEDSQQFEVKVRWEKRPKRLNKTVPNILS"
FT   gene            187228..189213
FT                   /locus_tag="Mmwyl1_0161"
FT   CDS_pept        187228..189213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0161"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mgm:Mmc1_3308 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69103"
FT                   /db_xref="GOA:A6VRM4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM4"
FT                   /protein_id="ABR69103.1"
FT                   /translation="MLTFAKKLYLGFSVVIILLALVGSTAYFALNNASNGFEEYRFLAR
FT                   ATNAVGRVQANMLMARMKEKDFILTGNIKDKKEFDIYWEHTLQFMAEAKLDVDNAEDID
FT                   VLKGLDTTLNSYIAGVEKIVDFKKQRNELVENVLNIHGPAIEKDLTKILMSAKDDGDVS
FT                   AAYNASLSTRSLLLARLYVLKFLESNTQSSVDRVEKEFADLDSQLKVLSNELQNPARKA
FT                   LLDSVVKDVATYKKAFNDVVAVISSRNNIINETLNPVGSEVTELTEDLKLSIKNEQDLL
FT                   GPQMVDSNTIAVYVIEAIVVIAILLGGAVAWLITRATTTQLGGDPALVTNVVRSVADGD
FT                   LEIQLPNNNEQEASLYAAIRNMVKSLKAKAVLAQKIADGDLTAKVVLASDKDSLGQALQ
FT                   DMVKNLNNILIDIQNAGDQIAAGSSQVSIFSHSLAEGATQQKDNLQTISAALEQLSVQT
FT                   SENAENAREANLLAETAQRAVVEGQAHMQEMVIAMNEIKDAGESIAGFIKTIDEIAEQT
FT                   NLLALNAAIEAARAGEQGRGFAVVADEVRGLASRSTGAAAETAKLIQLSSSKTANGVSI
FT                   AENTNKSLQAVFDGINETSAIVAKIASASHEQALAVSEVTQAMVSVGDVVELNAAGSVE
FT                   GAAAAEELSSQGAAMKQTMARFMLAS"
FT   sig_peptide     187228..187317
FT                   /locus_tag="Mmwyl1_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.775 at
FT                   residue 30"
FT   gene            189334..189576
FT                   /locus_tag="Mmwyl1_0162"
FT   CDS_pept        189334..189576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0162"
FT                   /product="protein of unknown function DUF1272"
FT                   /note="PFAM: protein of unknown function DUF1272; KEGG:
FT                   mlo:msl4947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69104"
FT                   /db_xref="InterPro:IPR010696"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM5"
FT                   /protein_id="ABR69104.1"
FT                   /translation="MLELRPNCECCDKDLPPSAEDAMICSFECTFCLDCVDTMLPNGRC
FT                   PNCGGNFAPRPIRPANKLANNPPSTKRVVSGCKAR"
FT   gene            189768..190238
FT                   /locus_tag="Mmwyl1_0163"
FT   CDS_pept        189768..190238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69105"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM6"
FT                   /protein_id="ABR69105.1"
FT                   /translation="MKTKKHLMLVLSLFLSPELFSANPSINELNSCLALVDFVDTTLDN
FT                   FSDHYTVDDMAIVHGGLSAYKNYLKNDVITPKLLSMYGGNEMQAKLMQKLFDRQRATFF
FT                   EHLSERYSEKKLFTEYAAAINDCTANTRIRPEVAKPLNTALDKMIIMARQIQ"
FT   sig_peptide     189768..189833
FT                   /locus_tag="Mmwyl1_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(190343..191773)
FT                   /locus_tag="Mmwyl1_0164"
FT   CDS_pept        complement(190343..191773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0164"
FT                   /product="histidine acid phosphatase"
FT                   /note="PFAM: histidine acid phosphatase; KEGG:
FT                   aci:ACIAD1671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69106"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM7"
FT                   /protein_id="ABR69106.1"
FT                   /translation="MANIKRYKITLISKGFPLNTRAFIPVIGMLALAGCSSVNTTSIAS
FT                   TDTYVYGTKSVYVPQDSVNNYSTVPASYILVYTELVARHGSRALSSPKYDDISLKIWQA
FT                   AKEQNALTPLGEHLGAEIERLMAANVKMGYGNLSKLGNQEQIQIGERMAQRNASLLNQA
FT                   VQNQQQIAFEYSGQDRARDSGLAFIQGLENVNPALAPLISKPVKNKAQLYFHKQSNNKD
FT                   YQDYVKENPQLRAAVDHLFDQPKSHQVAREMLERVYSPAFVDQLAEGKLSFIKVGKKKP
FT                   TVYNDVEAAIQLFNLYLIAPGLADEAGAQPWNFTQFVTPKESQWLSYVLDGEDYYEKGP
FT                   SFADTNITYKMASALEDDFFNEIKGVQDGTNTKAAKIRFAHAETIIPFAAQMQLKGSET
FT                   GVSRDTGYTLQTSPWRGGWVSPYSANIQWDVYRNQAGSLLVKMLYNEKEIAFKDSCKPI
FT                   STGSYFYQFSELTRCYGK"
FT   sig_peptide     complement(191639..191773)
FT                   /locus_tag="Mmwyl1_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.719 at
FT                   residue 45"
FT   gene            complement(191869..192675)
FT                   /locus_tag="Mmwyl1_0165"
FT   CDS_pept        complement(191869..192675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0165"
FT                   /product="RimK domain protein ATP-grasp"
FT                   /note="PFAM: RimK domain protein ATP-grasp; KEGG:
FT                   maq:Maqu_0076 RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69107"
FT                   /db_xref="GOA:A6VRM8"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM8"
FT                   /protein_id="ABR69107.1"
FT                   /translation="MKIISFDALRTLHLPQVKYIKPESMYEHLEEIKEADWLLFPQYWQ
FT                   LTALVHGLKKRIFPSLASYMIGHDKVEMTRTFRTVAPQQHPYTIIAANTPYEAEKIWDD
FT                   MPSPFVAKIPKSSMGNGVFLIETIGQWRDYVAQTDVLYVQEYLPIDRDMRVIWVGNKIV
FT                   SGYWRLQSDNGFHNNISQGGQVEVALIPKEAQDLVTYLAESLDINHAGFDIAMVGSVPY
FT                   VIEINRIFGNQGLPTIQQDVNTELLNYLNEQYLLSTAMLIDQPSGF"
FT   gene            complement(192809..193246)
FT                   /locus_tag="Mmwyl1_0166"
FT   CDS_pept        complement(192809..193246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69108"
FT                   /db_xref="GOA:A6VRM9"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRM9"
FT                   /protein_id="ABR69108.1"
FT                   /translation="MHVNVQKTFAKTFATIFFTLAGFVVIASFGGAINEYRHGESLTQV
FT                   IIKIINSNIIAIAVFELAMVINKEYGSDNEHDVIVLLRRTLPRFIGTVCVAMALEGLIM
FT                   VIKYSQLDMAGNLYYPVAIVASSGFLLISLGIFLKYAPREH"
FT   sig_peptide     complement(193154..193246)
FT                   /locus_tag="Mmwyl1_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.310 at
FT                   residue 31"
FT   gene            complement(193430..194344)
FT                   /locus_tag="Mmwyl1_0167"
FT   CDS_pept        complement(193430..194344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0167"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   asa:ASA_4157 RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69109"
FT                   /db_xref="GOA:A6VRN0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN0"
FT                   /protein_id="ABR69109.1"
FT                   /translation="MQTSSKSGILYALTAFTLWAIAPIYFKEMSFIPAQEILAHRIIWS
FT                   CLLVMILIVLLRYTDALKVVLRSPKTLAAMLISTALIAFNWGIFIWAIQNNKILSASLG
FT                   YYINPLISILLGVMFFKDKLDRVKKAAVALCFCAVAFEVIQFGSLPWIALILATTFGFY
FT                   GLVRKKVAVDSFTGMAIETAILLPFALVYLILSDSPSANMFENTSTVNWLLFASGPITM
FT                   VPLMCFAAAANRVSLVTLGFFQYIGPTGMFILAVFLYGEPLSPEKLTTFVLIWSALAML
FT                   IVDSIRRIRKTKSAKLIDSNDEI"
FT   sig_peptide     complement(194282..194344)
FT                   /locus_tag="Mmwyl1_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.585 at
FT                   residue 21"
FT   misc_binding    194518..194695
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 98.78"
FT   gene            194814..195743
FT                   /locus_tag="Mmwyl1_0168"
FT   CDS_pept        194814..195743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0168"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rxy:Rxyl_0218 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69110"
FT                   /db_xref="GOA:A6VRN1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN1"
FT                   /protein_id="ABR69110.1"
FT                   /translation="MAGTFFIMIACFTWALDTLIRYPLLGAGYSTLQIVLIEHLTLVLF
FT                   VAPLLWRYRHVYRHMSIGGFSCLFFIGGIGSAMGTLAFTEAFHYLNPTVVILLQKLQPI
FT                   VAILLAYWLLKERIEGHFLQWAAVILLGSFVMMWPDLRQLGDAQWHYSSDTTSILKGYG
FT                   YTLIAVVAWGAATVCGKYLSHQHMPANAIMSGRFVAGLLVLLPMALAQSDTLIAMKPVD
FT                   LSLAVAMALLSGFIGMWFYYQGLKTVPAQLATLAELSFPVFAAAINWLFLDMGLTGYQI
FT                   IGGLMLILGNIGLRMKELRKEELTPAVQ"
FT   gene            195863..196798
FT                   /locus_tag="Mmwyl1_0169"
FT   CDS_pept        195863..196798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0169"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: psa:PST_1584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69111"
FT                   /db_xref="GOA:A6VRN2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN2"
FT                   /protein_id="ABR69111.1"
FT                   /translation="MLLSNLMMVSVMTFKDCILALVIIFAWGLNFVVISFGLSEVPPLL
FT                   LGGLRFLAVAAIGCLLVKRPNIPLKWLCIYALPMGFMQFAFLFMAMANGMPAGLASLVL
FT                   QSQALFTMVFALLFLQEGVRIHQVLAIVLAGSGLLMIAVVSGIGDMTLFGFILTLFAAA
FT                   SWAMGNISARAMSQKGYSVNVNVVIWSAWVPPLPFFVCSWFMEGPELIYSSLLHISWVS
FT                   IGALVYLALVATILGYSLWGYLMSRYPASQVAPLTLGVPIVGLTFAAVILGESLLPLQW
FT                   IGVCFVLTGLLVNTFGARLFGQFKTIFKEA"
FT   gene            196800..197783
FT                   /locus_tag="Mmwyl1_0170"
FT   CDS_pept        196800..197783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0170"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: rru:Rru_A0758
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69112"
FT                   /db_xref="GOA:A6VRN3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN3"
FT                   /protein_id="ABR69112.1"
FT                   /translation="MSTVDKIHVYFIMLPNSVLLDTIGPAEAFQYSNRFAAEVECEGSK
FT                   QFELHFIGPEAKVENALGLNLQVEPLPKVMAANCWVISTGLSGDRVDLETPAMETTISW
FT                   LSKQTEYIGRYISICAGTLLFAKAGLLDGRACTTHHMHIDELQEAAPSAKVLANRLFAV
FT                   DGDFYSSAGVTAGIDLALYLIQQEFGANCASQVARHMVLFSRRGPNDPSQSPWLENRNH
FT                   LHQSVHRVQDAIQVDPARNWSLESLAEIAQCSPRHLVRLFKDSAGVTTREYIHKLRLTL
FT                   AMQFLQSTSLPIEDVAERCGFDDPRQFRRLWARQHSFPPSYYRESK"
FT   gene            complement(198189..198998)
FT                   /locus_tag="Mmwyl1_0171"
FT   CDS_pept        complement(198189..198998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0171"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ret:RHE_PD00028 probable beta-lactamase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69113"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN4"
FT                   /protein_id="ABR69113.1"
FT                   /translation="MEELKLYAMTCGWITMPYGFFMAGETGNLAIPIPCYLIEHPKGTV
FT                   LFDTGLELPLQSEDENVVKKALGGFAELTTVNFVPGEDVAKRLEAFGVDPLKINYVINS
FT                   HLHFDHCGGNACIPNARIVIQKREWEAAKDEENIEKGIYVPRHYDLGHDRLEIDGEHDL
FT                   FGDGSVVLIPSYGHTPGHQSLKVKLDGKEVVIAADACYLKASLEKMTLPDAMVVNDAQA
FT                   MLNNFDLFKKLKAKGAFLLYGHDPKQSKSLTDGSIRQITAETLASLS"
FT   gene            complement(199222..200388)
FT                   /locus_tag="Mmwyl1_0172"
FT   CDS_pept        complement(199222..200388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0172"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   rle:pRL100135 putative 1,3-propanediol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69114"
FT                   /db_xref="GOA:A6VRN5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN5"
FT                   /protein_id="ABR69114.1"
FT                   /translation="MTDGIKPFSFNTPGSMHLEWGGAKRLGELLGEWFKERNLLIVTDK
FT                   FLNESGLLEQTKDSLEKHGFTVTVFDDVVADPPEHVLMECVEQGKKSHADIVLGLGGGS
FT                   SMDIAKLVAVMLTSEQPLSELYGIGKITGTRTPLVQVPTTAGTGSEVTNITILTTGETT
FT                   KMGVVSQQLYADRVLLDAELTVGLPALPTAATGIDAMVHAIEAYTSVHLKNPLSDALAK
FT                   EALRLLSKNLVTACQDGQNRAAREAMLLGANLAGQAFSNSPVAAVHALAYPLGGHYHLP
FT                   HGLTNALMLGPVLRYNMAVAAPLYAELADVVLGYSDEEMEIRSAKFVDFMQKLMNESGA
FT                   PQRLQDVGVTEESLPTLAKDAMLQTRLLGNNPVPVTEEDALALYQAAF"
FT   gene            complement(200429..201868)
FT                   /locus_tag="Mmwyl1_0173"
FT   CDS_pept        complement(200429..201868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0173"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: bmb:BruAb1_1628 GabD,
FT                   succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69115"
FT                   /db_xref="GOA:A6VRN6"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN6"
FT                   /protein_id="ABR69115.1"
FT                   /translation="MLKDMSLLKTRCLVNGEWVEAKAKTTHPVTNPATGEVIAEIPHLS
FT                   PEEIPAVIEASRIAQKKWAALTAKERSVILRRWFELMIENTDDLALLMTSEQGKPLAEA
FT                   KGEIGYAASFIEWFAEEAKRIYGDTIPAPRADQRLTVIRQPIGVTAAITPWNFPAAMIT
FT                   RKAAPALAAGCSMIVRPADLTPLTALAIGELAQRAGIPAGVFQVITGSASKLGKVLTDS
FT                   QVVSKLSFTGSTEVGRLLMAQCAQTIKKVSLELGGNAPFIVFDDADLDKAVEGAMASKY
FT                   RNAGQTCVCANRILVQRGVYEEFTAKLTEKVKALKVGSGVETGTDIGPMIEEKAIAKVE
FT                   DHIQDAISKGAKLVFGGERLGGLFLQPAILTGVTADMKVAQEETFGPMAPLFAFDTEEE
FT                   AIAMANDTIFGLAAYFYTRDHGRMIRVSEALEYGMVGHNTGLISNEVAPFGGVKQSGLG
FT                   REGSKYGIEEYLEMKYVCSAL"
FT   gene            202259..203614
FT                   /locus_tag="Mmwyl1_0174"
FT   CDS_pept        202259..203614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0174"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; AAA ATPase;
FT                   KEGG: ilo:IL1408 NtrC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69116"
FT                   /db_xref="GOA:A6VRN7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN7"
FT                   /protein_id="ABR69116.1"
FT                   /translation="MVFDKNLQRVIDALSDGVYITDGNGVTVTINKAYERMTGLSKHRL
FT                   IGMHMSEVVKAGYISRSVSLEVIKELDAVTIIQTIGDDHKIFVSGTPMFDERGRIEYVV
FT                   TTARDITELLKAKHKEEQLDQLLKLKELYGKSALNGDNQGTFIISRNTKACYDLAKKVA
FT                   TSNAKVLIQGETGTGKTLLANTIHKFSKACDGPFIELNCSAMPESLLEAELFGYVPGAF
FT                   TGASAKGHIGLLEAANNGTLFLDEIGDLPLSLQVKLLKVIAENRFIPVGGTDFKNVNFR
FT                   LISATHHNLRQLVETKLFREDLLYRLNVVPIHLPPLRDRRDEIVPLLEHYIQYFNRVYE
FT                   LDCHWHQEVFEQLDRYDWPGNIRELINLTERLVVTADQPLITIEQLPAEFKLESSFIGE
FT                   KRALKSQVEALEQRLIDEAIKECGTTRAAAKLLGIDQSTLVKKQKRWRNGKL"
FT   gene            203810..205018
FT                   /locus_tag="Mmwyl1_0175"
FT   CDS_pept        203810..205018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0175"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sit:TM1040_1097 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69117"
FT                   /db_xref="GOA:A6VRN8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN8"
FT                   /protein_id="ABR69117.1"
FT                   /translation="MPNTSFQSSITEPKTQWLNVILLWVAGISAAMQFAKFSVSFDDLL
FT                   VHYQAGATSTGAALSAVGIAGLVFGVSAGMIASRVGYLKVLVGALLLGGGLSLIQSTLP
FT                   PFNVLFVTRMLEGFSQLGVVVAAPTLIAKLSAPQHKSLTMGIWGTFFGVAFALCGWAGK
FT                   NILDQYGLQTLFLSHGVFIMTIGVVLFFKLRKNPVLDLVPVTEIQDGFFKQMIKIYRNP
FT                   RALLPSCVFLFYTCTLVSVLTYVPGLIGDSTLQKLMLVVLPLISTSGTFLAGAIAQYLM
FT                   RPQRVALMAYFGVAASVIVLSLISGSAELFCVVVGVMVLFLGMVPGSALAMIPTLARNP
FT                   SEQAQGYGLLAQFGNIGATVGPPTFATAIAMYGLVGLVVLVLCVCCFGVLFSLWAGRIK
FT                   AVV"
FT   gene            205254..207404
FT                   /locus_tag="Mmwyl1_0176"
FT   CDS_pept        205254..207404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0176"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; SNARE associated Golgi protein; KEGG: noc:Noc_0589
FT                   pyruvate/2-oxoglutarate dehydrogenase complex
FT                   dihydrolipoamide dehydrogenase (E3) component and related
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69118"
FT                   /db_xref="GOA:A6VRN9"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRN9"
FT                   /protein_id="ABR69118.1"
FT                   /translation="MKKIALLVLIAALATGFFYFDLHQLLTLEGLKSGLVQFEVWQAER
FT                   PFLVGGVFLLLYVIVTALSLPGAAIMTLAAGALFGLAWGTLIVSFASSIGATLAFLVSR
FT                   YLLQDTVQKRFGDRLKAINEGIEREGAFYLFTLRLVPIFPFFLINLLMGLTTIRALTFY
FT                   WVSQVGMFAGTLVYVNAGTQLGQLESLSGILSPSLLLSFVLLGVFPLIAKKIVDLVKAR
FT                   RVYAGFTKPKSFDRNLIVIGAGAGGLVSAYIAATVKAKVTLIEAHKMGGDCLNYGCVPS
FT                   KALIKSAKVAHQMRHAENYGLNSSEPSFSFKKVMTRIHDVIAKIEPHDSVERYSKMGVD
FT                   VVQGYAKLIDPWTVEIQLTEGGTKRLTARSIVLATGARPFVPDLPGLDEVGYYTSDTMW
FT                   EAFAKFDEPPKRLVVLGGGPIGCELAQSFARLGSTVTQVERSARIMGREDEEVSVLAQE
FT                   SLRQDGVNILTSHNALRCEKEGEVKRLIVEHDGQESVVEFDALICAVGREARLEGYGLE
FT                   NLGIETKGTIVTNDYLETLYPNIFAAGDVAGPYQFTHVAAHQAWYAAVNALFGSFKKFR
FT                   VDYRVIPWTTFVDPEVARVGLSEQDAKEKGIDYEMVRYDLDDLDRAIADSAAKGFVKVL
FT                   TVPGKDKILGVTIVGEHAGDLLAEFVLAMKHGLGLNKVLGTIHTYPTWAEANKYAAGEW
FT                   KRAHAPQRILNWLEKYHTWRRG"
FT   sig_peptide     205254..205337
FT                   /locus_tag="Mmwyl1_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.337 at
FT                   residue 28"
FT   gene            207409..208227
FT                   /locus_tag="Mmwyl1_0177"
FT   CDS_pept        207409..208227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0177"
FT                   /product="protein of unknown function DUF547"
FT                   /note="KEGG: sfr:Sfri_2958 protein of unknown function
FT                   DUF547"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69119"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP0"
FT                   /protein_id="ABR69119.1"
FT                   /translation="MKKLRLLVVTLLNFVFVGLLSSQVSAANGFDHSRWDMLLKQHVLP
FT                   LNGGQASQVDYQGFADDKPELDRYLAALSKVKSGEFDAWPKDEQLAFLINAYNAWTVDL
FT                   ILTKWPDLDSIKDLGSFFRSPWSQSFIPLLGETRSLDDIEHNLIRGSDRYQDPRIHFAV
FT                   NCASVGCPALRNEAYTGKHLEAQLDEQTRLFLQDRSRNRAESDKLLLSSIFKWYREDFE
FT                   KGWKGYSSLEQFLLDHAADLSLTPAESQKLKDKDMSIRFLDYDWALNKTL"
FT   sig_peptide     207409..207489
FT                   /locus_tag="Mmwyl1_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 27"
FT   gene            complement(208222..209169)
FT                   /locus_tag="Mmwyl1_0178"
FT   CDS_pept        complement(208222..209169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0178"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: hch:HCH_01626 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69120"
FT                   /db_xref="GOA:A6VRP1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP1"
FT                   /protein_id="ABR69120.1"
FT                   /translation="MIKISDHVESVMKLDQLRAFIAVVETGSFRSAADSIHKTQPGISA
FT                   AVKALEEQYGISLFDRNSYRPTLTAEGHAFFLQSKKLMSQVLQLENLGHDLAQGTEAPL
FT                   QLCLSQMALDDNCMMRIKAFQQQHADVTLDITTDHLYGVQEKLAKDKCEIAIGPRYGLD
FT                   DRHAFIEINKITMITVMSPELLATVNTSDTKIKQQQLYSIPQILVTNTAANTSGNGHRY
FT                   VLPTGKRWYVNDFQIKKNLLLHGFGWARMPKHYIQSELDNKQLIPIEVENFTSQNQLPI
FT                   FMIRLRHQTQSYQANLFWEMMRGFSPSPTIETDL"
FT   gene            209266..209988
FT                   /locus_tag="Mmwyl1_0179"
FT   CDS_pept        209266..209988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0179"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   hch:HCH_01625 predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69121"
FT                   /db_xref="GOA:A6VRP2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP2"
FT                   /protein_id="ABR69121.1"
FT                   /translation="MDTAIVVLFLAGLITGFSKFSVGGMGLLVLPILLVAFPGPEALAV
FT                   LLPLYIITDIMAVWSYRSKVNWSVLVRFLPLAFLGVFVASHFLANIDGEQFINFLGFMI
FT                   IAMIALGLYLDFRPATFMQKPWAAYSMGFLGGIVTMMANAAGPLFSLFLLEQKLDKETY
FT                   VSTRAWAFFIINVAKLPFYIALGLFSLESVQVSLYGLPGLAIGSFIGYHFLKKVNPVQF
FT                   KWLIRIMSGIAAVKLFLF"
FT   gene            complement(209994..210845)
FT                   /locus_tag="Mmwyl1_0180"
FT   CDS_pept        complement(209994..210845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0180"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4247 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69122"
FT                   /db_xref="GOA:A6VRP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP3"
FT                   /protein_id="ABR69122.1"
FT                   /translation="MIYPLNGNLLKTLNIRSLRINFWLQCVFILLLALAIFGPIMNLLI
FT                   WTVTESWYFPHALPSQWGFKYWQQVFNPYSDVSGSLFTSLLIAVLTVLVCLIVSVPAGY
FT                   ALSKRSMPLRVFWMLLFLIPQAFPNLTVYMNIARLFYDFGLNGTLLGVILVHSVHGLMF
FT                   SIWISVAAFSSTDPMLERASRNLGAGPFYTFFHIVLPQAAPGLIASCIFVFLESLDEFT
FT                   GTFFVGSPNISTLPLLLYTASMEGNYQIASITALILLVPSILFMIIINKFMRPDMLSKL
FT                   GK"
FT   gene            complement(210845..211693)
FT                   /locus_tag="Mmwyl1_0181"
FT   CDS_pept        complement(210845..211693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0181"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4248 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69123"
FT                   /db_xref="GOA:A6VRP4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP4"
FT                   /protein_id="ABR69123.1"
FT                   /translation="MRQTTSHNLLKNHLWLIAPAALMVGIFFLYPLCFSLYSAITLDSG
FT                   EFTLTHLNKAFELYSKDILFTIIIVLISVAILAVLSITIAALITLSPFRSLSKILGFLY
FT                   RLPLFIPFIVTAQMMRSFLAKNGLMNNAFVASGLLTPMDTVSFLGWSGIIITFVWKQLA
FT                   FSTLLISGAMAALDDSQIRAARNLGASRLRILFQIILPQITPTLGVAMVLSIVTMMSVL
FT                   SVPLMIGTGSPTMMTADMAFRINSYGDYHVANALGLVSYCICAGLAWFYLRQNLKEKGA
FT                   N"
FT   sig_peptide     complement(211577..211693)
FT                   /locus_tag="Mmwyl1_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.906 at
FT                   residue 39"
FT   gene            complement(211808..212956)
FT                   /locus_tag="Mmwyl1_0182"
FT   CDS_pept        complement(211808..212956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0182"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: eca:ECA4249 ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69124"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP5"
FT                   /protein_id="ABR69124.1"
FT                   /translation="MFAKTHIAVLAAIGLTQFSSFAHAETTLNVASAGSQNMVDYVKTY
FT                   LAPKFEATHPGVKVNVVGTGPGDAGSHKIMEKLSAQNDSGLDKWDIDVAVVHQQIGGEL
FT                   VKNGLLSKYRSDINTGKMVSRDSATNALGIDVDGYVMPMFHSQTAIAYNSDFITTPPKS
FT                   YDELVKWTQQHPKSFGYNGIKNGMSGVSFVTGWIYAYGTDADKLSSMPYDKSVESSWDK
FT                   AFAELKEFNKNITFTPGNAGTLDMLNRGEIFMGPVWVDMFYSWKEQGKIPPSLKLSLIA
FT                   PGMPGQPMYYVTPTKAEHPQLAREFIELATSPEVQADGIVKQFNWYPGIDANYVKAKLD
FT                   NATWEKLFAEITPSDLSKYGKSFPIGPYFDDIKEGYERNVSN"
FT   sig_peptide     complement(212882..212956)
FT                   /locus_tag="Mmwyl1_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 25"
FT   gene            complement(212946..214043)
FT                   /locus_tag="Mmwyl1_0183"
FT   CDS_pept        complement(212946..214043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0183"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: eca:ECA4250 ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69125"
FT                   /db_xref="GOA:A6VRP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP6"
FT                   /protein_id="ABR69125.1"
FT                   /translation="MAHLHIKNLQAGYGKKLILDNINLTVEQGEMIALLGPSGCGKTTL
FT                   LNALCGFVPVSHGEIFAGNRAVSQLPAEKRNITMVFQSYALWPHMTVAQNIGYGLKVQK
FT                   AKRADIDARVAELLRIVKLDGLDHEKVTALSGGQRQRVALARALAIRPDVLVLDEPLSN
FT                   LDAKVRLSVRHEIKALQKQLGFTSLIVTHDQEEALVMADRIAVLNQGKIEQIGTPEEIY
FT                   HHPSTPFVADFMGAENHIEWPTHDDAFCLNLSNHADQLDIYFRSESAVLSAHPTSENAN
FT                   FNAGLTISGQVEQSVFFGNNYQISVRCGKHTIQVDHDQNLPEHTPATLRIPIDALHVFA
FT                   KKEKHSDHQKTNIVSAKSMRMNHVC"
FT   gene            214240..215037
FT                   /locus_tag="Mmwyl1_0184"
FT   CDS_pept        214240..215037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0184"
FT                   /product="metal-dependent hydrolase of the beta-lactamase
FT                   superfamily III"
FT                   /note="KEGG: hch:HCH_03300 metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69126"
FT                   /db_xref="GOA:A6VRP7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP7"
FT                   /protein_id="ABR69126.1"
FT                   /translation="MKIDVIGSGSAFSKRNNTSSIRIIDCQKNQWLIDCGPTVPRAIWQ
FT                   RNIDVNDIQVIYFTHIHPDHSSGLAALINQWKSFKRTEPLTIFCQAEQQQPLQALVDLA
FT                   VWPETHVCFDIHWQDITDGFEWKHWQIRTANTQHEMSNKAIRITVDGKTLFYSGDGRPT
FT                   LASQALMQGVDIAFQECASFNALPDDSSHGDLPDCERLLVETEVKALGIYHCFDEAIPS
FT                   LLNALVDIPDMFLSRDGLQLDLNDLDLSEKCFNLLSIGQGDKL"
FT   gene            215034..216083
FT                   /locus_tag="Mmwyl1_0185"
FT   CDS_pept        215034..216083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0185"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: bam:Bamb_4155
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69127"
FT                   /db_xref="GOA:A6VRP8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP8"
FT                   /protein_id="ABR69127.1"
FT                   /translation="MTNSRRGRSASAEDVAKLAGVSRASVSRVFSDQGNVARETREKIL
FT                   QAANELGYQVNFLAQGLNRKRSQLIGVVVARLSDPFRSSLLEGLLSEIQRKGYQALVTE
FT                   VRDANELEMTIRRFTQFRVSGVVVTSGQPPADLVKECVQHNIPVVGINRHMDIPDVDFV
FT                   CSDNKMAASLVAEQFIRCGCKSIGWLNYKESTWSGINRGEMFYQVMTEKGICDESDLLQ
FT                   ITAEMDGYEGGRQAAHRFCEQGKRVDGVFCANAQLACGFLDGMRENGFDAPADFHIIGF
FT                   DNTPQTAQYSYRLTTIHQDVTETAKRVLSCLEARGQDPHIVQSIEEIPVKLVIRNTSPN
FT                   FEPTMIRAK"
FT   gene            216085..216858
FT                   /locus_tag="Mmwyl1_0186"
FT   CDS_pept        216085..216858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0186"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG: psa:PST_1593
FT                   inositol-1-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69128"
FT                   /db_xref="GOA:A6VRP9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRP9"
FT                   /protein_id="ABR69128.1"
FT                   /translation="MQDEYQVLESAIKQAGQRAQTIRQSGLSVTTKGRQDFVSQADIAV
FT                   EDELKQVIRSLFPEDGFLGEESGLIQGVDTNTSGVWVIDPIDGTTNYVQGMDYWCVSVA
FT                   YVKNNEIQVGFVYAPDRDEFFMAKKGQGAYLNGARLAIDDPEKGQAIIGLGRSNRRPVQ
FT                   EYCDLILMLDTQNVEYRRFGAGALMLAHVSSGLVHGYFESHLNSWDALAGLLLIKESGG
FT                   QVTDFLNNDGLLSGNPVWAASPQLWENLNKLLFLV"
FT   gene            217007..218416
FT                   /locus_tag="Mmwyl1_0187"
FT   CDS_pept        217007..218416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0187"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; GAF domain protein;
FT                   KEGG: cvi:CV0812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69129"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ0"
FT                   /protein_id="ABR69129.1"
FT                   /translation="MKDSQNNEVRLEDILNTTPIAVSWSSLSSGRIEYINKAFSELFGF
FT                   VLGDILDTESWFLRVSPQPAYYQNVIAPWIHKYRDNASAHDLSATLFCKDNSVRHISMC
FT                   FSTIGDKQLWYFNDITDHWVAEERLRVRSDMLEMVAKSSALKDILNVIVKQIQQESPLS
FT                   LCSVLLFDKDEQCLRLGAAPSFPDFYNQAIDGVKIGLNVGSCGTAAYLGQRVIVEDIYD
FT                   HPYWADYVQLARQAEVAACWSDPIMSSKGELLGTFAIYKRFPSTPSEKDFELINFASNL
FT                   ASIAIESFRAQEALQKRAYFDHLTELANRGYFFQQCETLLNLSREKNFPLAILMMDVDH
FT                   FKKVNDEFGHKTGDLVLQMLAQMSLSILRRDDLIARIGGEEFAILLPFTEKDEALRIAE
FT                   QLRESIESSMVLSLDHQEVVFTVSLGVACRQDGDCTVDDILNKADKALYQAKAAGRNCV
FT                   FLAVPQSNTLF"
FT   gene            218551..219051
FT                   /locus_tag="Mmwyl1_0188"
FT   CDS_pept        218551..219051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0188"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   shm:Shewmr7_2516 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69130"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ1"
FT                   /protein_id="ABR69130.1"
FT                   /translation="MKNYLGAYSPQVQQQAQSLLEAEKSGEWLLKKYPDVHGLNGTRAL
FT                   YEYAMDLKNEFMRSSPPISKVIYDDKIHIINNALGLHTFVSRMQGNKLKAKNEIRISSL
FT                   FRRIPEPLLKMILVHELAHLKEKDHNKAFYKLCCYMEPDYHQLEFDLRLYLSHRDRFGD
FT                   LWS"
FT   gene            219323..220066
FT                   /locus_tag="Mmwyl1_0189"
FT   CDS_pept        219323..220066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0189"
FT                   /product="Oligogalacturonate-specific porin"
FT                   /note="PFAM: Oligogalacturonate-specific porin; KEGG:
FT                   vvy:VVA1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69131"
FT                   /db_xref="InterPro:IPR009331"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ2"
FT                   /protein_id="ABR69131.1"
FT                   /translation="MKIKIVSAAVLIGLTSVAAHATTINIRHEYVPEYDGQDQENKDRI
FT                   EVSHRFANGIGFGVEAKWGSAKGAGPFDELSGNGQQTNISYRYKISDTLTLTPQYKWES
FT                   GSDKVGHQFNLSLGYKVNDDWSVGFRHRYHYDKLADKAKQNSHYNRWTFSTGYKGIEDW
FT                   GFGASVDYTFNQESSGPRWKGDKSGFSEVNFTGEYKGFKSGWSPFAEVGMKPYKSGDTY
FT                   SYKGAQVKSNDSWRPVYKIGAKYSY"
FT   sig_peptide     219323..219388
FT                   /locus_tag="Mmwyl1_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            complement(220226..221149)
FT                   /locus_tag="Mmwyl1_0190"
FT   CDS_pept        complement(220226..221149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69132"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ3"
FT                   /protein_id="ABR69132.1"
FT                   /translation="MNRFKLNSIVGISAGLIISGSVLATENGAPSTAPGIYGFSAGHMP
FT                   PVTDIGAFSIRGSIYKANKNLNGKGDDNLSDFSQTVKALSLTYIKMTDTQFQGANYGYG
FT                   IVIPFLDLDIDGKVPNSNISVVGSDSSIADIQIVPYILQWHPSENLATNTQLQIQIPTG
FT                   HYSKDDTITTGLNHWTFSPAFNFTYMTDSEIEISSSFQLDINTENKDTNYTSGIEYRHE
FT                   FAIGQHLTDWTVGLGGFYYKQLTDDKAPASSNIVNGNKGEVVAIGPELSFFRPGLPFVS
FT                   FHAYKEFKAKNRTQGYTAALLVSQSF"
FT   sig_peptide     complement(221075..221149)
FT                   /locus_tag="Mmwyl1_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(221415..222098)
FT                   /locus_tag="Mmwyl1_0191"
FT   CDS_pept        complement(221415..222098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0191"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   vpa:VP3004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69133"
FT                   /db_xref="GOA:A6VRQ4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ4"
FT                   /protein_id="ABR69133.1"
FT                   /translation="MSTFTSEQKGKALCYLAIFHLLIIASSNYLVQIPFTVLGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGATLARKIIFLVMIPSLIVSYVLSVIFAQGEFQGFGALSSL
FT                   NTFVGRIAIASLMAYLLGQVLDIQVFNRLRQLKQWWIAPAASTLFGNGLDTLAFFGIAF
FT                   YQSPDPFMAQHWQAIALADFGFKLIISLGLFIPLYGVLLNYLTKKITEVKPDFRMPNAQ
FT                   EHGAQ"
FT   gene            complement(222346..222843)
FT                   /locus_tag="Mmwyl1_0192"
FT   CDS_pept        complement(222346..222843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0192"
FT                   /product="HPP family protein"
FT                   /note="PFAM: HPP family protein; KEGG: she:Shewmr4_2802 HPP
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69134"
FT                   /db_xref="GOA:A6VRQ5"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ5"
FT                   /protein_id="ABR69134.1"
FT                   /translation="MLSNFFTSIYQSKLSTICLAGIGATLCIFMIAQGAQFAPEYLGIM
FT                   APFGATMVILFALPKSPLAQPKNILGGHLLTTAIGLITLHFWDVTPLAMAISVGLGVSL
FT                   MMLTNTLHPPAGANPLLVLSLKVSWGFLLSPVLSGCLLIILFGWCYHNWISRIGYPLTR
FT                   KD"
FT   sig_peptide     complement(222739..222843)
FT                   /locus_tag="Mmwyl1_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.981 at
FT                   residue 35"
FT   gene            222966..223520
FT                   /locus_tag="Mmwyl1_0193"
FT   CDS_pept        222966..223520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0193"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   she:Shewmr4_2801 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69135"
FT                   /db_xref="GOA:A6VRQ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ6"
FT                   /protein_id="ABR69135.1"
FT                   /translation="MTKPDLLIHTAFKLFYQHGIHAVGINLILSETGVAKKTLYHHFSS
FT                   KDALVEAVLIYRDQIFMDWLTSKMMAAGKGKAAVLALFDALDDWFHDRVEVLSPFKGCF
FT                   FVKANGEFSDHVVNDLCQRHKQNITTFIQANLVGSSSELVAADLAQSISVLKEGAIAQA
FT                   YLVGDLDAAKRAKAMAVTLLG"
FT   gene            complement(223549..224406)
FT                   /locus_tag="Mmwyl1_0194"
FT   CDS_pept        complement(223549..224406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0194"
FT                   /product="protein of unknown function RIO1"
FT                   /note="PFAM: protein of unknown function RIO1; KEGG:
FT                   ppr:PBPRA1235 putative RIO1/ZK632.3/MJ0444 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69136"
FT                   /db_xref="GOA:A6VRQ7"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ7"
FT                   /protein_id="ABR69136.1"
FT                   /translation="MKIPKRIQPLIEDGLVDEVLRQLMSGKEATVYVVRCGSEIRCAKV
FT                   YKEAGKRSFKQAVQYREGRKVRNSRRSRAMEKGSKFGRDEQENLWQNAEVDALYRLAAA
FT                   GVRAPTPYGCFDGVLLMELVTDDSGEVAPRLNDVVLTEEQAKRDHDTIIKDIVRMLCAG
FT                   LIHGDLSEFNVLVDSHGPVIIDLPQAVDAAANNNAEWMLERDVNNMRNYYGMFAPELLE
FT                   TKYAKEIWALFEAGKLTPHTELTGLFEEPTEEADVDSVLQEIKEAYEEEQDRLARINSS
FT                   DDND"
FT   gene            complement(224512..225420)
FT                   /locus_tag="Mmwyl1_0195"
FT   CDS_pept        complement(224512..225420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_2352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69137"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ8"
FT                   /protein_id="ABR69137.1"
FT                   /translation="MIRDNIDFLDASSERECTFYNDYLLKNIRSASLRNLRGDSLAERI
FT                   KKLNEELENLINKKRAPQNFATQMRMAFKANQLSSNYFRWIDKKDERLCNWAWCYLKSI
FT                   TKNSGIEPEQNPIKENPFLLLSGKAFNTERSNAADRHIDILDAFYNGEADTQQQQDLLE
FT                   KLKAKWQEIRLNEIIVNWLEENNPSQWAWAWSYLQNITQRPLKQAWIPTTEAEKKAAVI
FT                   ATIDLSDNVDRKALIIDKMKKAWSQKKFREKSSGKKPYSISMTLNTKQKLNALAEEKNM
FT                   KINEMVEYLVRNEYKKRDSNE"
FT   gene            complement(225885..226955)
FT                   /locus_tag="Mmwyl1_0196"
FT   CDS_pept        complement(225885..226955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0196"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: acb:A1S_3345 putative domain
FT                   GGDEF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69138"
FT                   /db_xref="GOA:A6VRQ9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRQ9"
FT                   /protein_id="ABR69138.1"
FT                   /translation="MKNQSTPNRQLNTSSMSSTLFRRMLVVAILGFSAIWTIDALSGII
FT                   VPFDAAAYPICIGAFSLVFILSITTKINHQSLHFFVYFIVAGYLISSSIWHHMAANGLF
FT                   SNAAQWLGLNYVIAYLFLEVKKAAPTTIIVFVVTIIGHFIAIIQYHTMADTMGVVLNIA
FT                   IAHLIYIFLLWTVIKLRVKTDQVIERADTLENYAYVDLLTRVLNRRGIEKVFNELNLDS
FT                   TEQKKNYAILIIDIDHFKQVNDIHGHLTGDKVLSSIAGKLSRTVHPNDVLGRWGGEEFI
FT                   VLTLNRTPKQVMALAENLRTAVSNLIIGNISNITVSIGIGYSYEASSKEAVFKIADSHL
FT                   YIAKQSGRNTIRTSNT"
FT   sig_peptide     complement(226827..226955)
FT                   /locus_tag="Mmwyl1_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.753) with cleavage site probability 0.502 at
FT                   residue 43"
FT   gene            complement(227056..228684)
FT                   /locus_tag="Mmwyl1_0197"
FT   CDS_pept        complement(227056..228684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0197"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: ppd:Ppro_2998
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69139"
FT                   /db_xref="GOA:A6VRR0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR0"
FT                   /protein_id="ABR69139.1"
FT                   /translation="MFTTIKSRLLITVLLLNALASICYTVYLYDVRKTDLYDQVDRNLM
FT                   FAANTAAELADADIYDQISRGSFTVAQSDLLQLKAYNVLKSSDVEYIYTMVKTSDDIVF
FT                   VLDTPDPEEVKSNKLPAPLPSYEDPSDKLLKAFSQNGTQPIFDEYTDEWGTFRSIFIPY
FT                   TTKSGQKFVAGADILLSRIQTELQKTLIISSIIGFIIFIISSTIIYWLVSHILKPLAEA
FT                   QVLMRTIATTRNLTLRSKTSSDEIGLLLEDFNHLISELQSTLSASTNSAIENSTVSSQL
FT                   QGSSKEIRSAAQKIASAVDEARQHAVSTSQLLEVSDSDLTTAVKDTQSATTSLERGQHA
FT                   FDKVTEIINETALSHSQLSDELNLLSHKAEEVNKILSSISGIADQTNLLALNAAIEAAR
FT                   AGEEGRGFAVVADEVRQLAIRTQSSLNDTGIAIGSIISAISKVADKMKDSENQFNQLLE
FT                   ESSLALSSITESSTTMSDTRQKMQFTSGNVTNVLRDIHQMLSLMSNVESQAIFNRNSTE
FT                   EIAEAADRLQTSSLSLKNELNKFVV"
FT   sig_peptide     complement(228622..228684)
FT                   /locus_tag="Mmwyl1_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.562 at
FT                   residue 21"
FT   gene            complement(228762..230018)
FT                   /locus_tag="Mmwyl1_0198"
FT   CDS_pept        complement(228762..230018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0198"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   ppr:PBPRA1748 putative ATP-dependent RNA helicase, DEAD
FT                   boxfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69140"
FT                   /db_xref="GOA:A6VRR1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR1"
FT                   /protein_id="ABR69140.1"
FT                   /translation="MSFASLGLHQDIIQQVTELGYTTPTPIQLAAIPAVLAKKDLMAGA
FT                   QTGTGKTAAFALPLLHQILQAKDSNTTKGIQVLVLTPTRELAQQVHASFLKYSAKLPIQ
FT                   SVVAYGGASINMQLDALRQGCDVLVATPGRLLELIMKNLIDLSKLQTLVLDEADRMLDM
FT                   GFIIDIQRILKKLPKSRQTLFFSATFNDEIFALSKTLLKDPQLIEVNSRNTTATQVEQT
FT                   IYAVDQDRKSALLSFLIGSKNWQQVLIFTRTKQGADELAKEMEKDGIATQSIHGDKSQG
FT                   ARDRVLADFKAGKVRALVATDVAARGIDIEQLQYVVNHELPYNAEDYIHRIGRTGRAGS
FT                   TGLAISLVSEKERYLLTDIEKLVGEQFVPQWLPGFEPDLNKVNNAQKKREPSKKELRAK
FT                   ALGIHPSKDKKPNKRRRSK"
FT   gene            complement(230188..231672)
FT                   /locus_tag="Mmwyl1_0199"
FT   CDS_pept        complement(230188..231672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0199"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaC; PFAM: Na+
FT                   antiporter NhaC; KEGG: rsh:Rsph17029_1769 Na+/H+ antiporter
FT                   NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69141"
FT                   /db_xref="GOA:A6VRR2"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR2"
FT                   /protein_id="ABR69141.1"
FT                   /translation="MAINTKQSETQKPSLALALVPVILTLALLGVQIFYFGDFTPHIPL
FT                   AIGLAITALVGIKQGLKWKQIEEGIFHVIHVSMPSVSVLILVGMLVGVWIASGTVPTLI
FT                   YYGLTLLSPQIFLAAAMILCSVVSLSLGTSWGTVGTVGLALMGIGAGFEIPMYWTAGAV
FT                   VSGAFFGDKVSPLSDTTNLAPAVTGTDVFSHIKNMMPTTIPAMLIALVIYLIAGFTLID
FT                   NDNGSFERITAITSSLQRNFEISAWLLAPALVVIVLAVRRMPPIPSLFAGVIAGAIVAA
FT                   FTQGAGIHDILTYANSGYSITTSSDAINSLLNRGGIQSMMWTISLILIALGFGGALERT
FT                   GCLEAIISAIMTKVKTFKGVQTSATLTSVATNLVAGDPYLSIALPGRMYAPVYRGMKYS
FT                   TLNLSRAIEEGGTLVSPLVPWNAGGAFVIGALGLSIGDGNFENLLYIPLAFACWISPVL
FT                   GLIYAQLGFFSPKATEEEQARWKKNNELVMDYSTAK"
FT   gene            232409..233140
FT                   /locus_tag="Mmwyl1_0200"
FT   CDS_pept        232409..233140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0200"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cps:CPS_2473 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69142"
FT                   /db_xref="GOA:A6VRR3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR3"
FT                   /protein_id="ABR69142.1"
FT                   /translation="MLMSDIKILVVDDSSVIRETLESYFAEEGYTVSGADTAEAAEQLL
FT                   SEQEFDLILLDIRLPGKDGLTLTRELRSRSEVGIILVTGKQDDIDRIIGLECGADEYVC
FT                   KPFNAREVLARGKNLIRRVRNQRELAKKPIEEPVFRTIGTWQLDTSRRVLLKSDRSVSQ
FT                   LTEGEFQLLLALKANEGVALTRDQLMDRIKNRTWNATDRTIDVLIGRIRRKLSEDPHCP
FT                   QMIITVHGVGYLLSNNPQDDL"
FT   gene            233266..234066
FT                   /locus_tag="Mmwyl1_0201"
FT   CDS_pept        233266..234066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0201"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="KEGG: cps:CPS_2474 bacterial extracellular
FT                   solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69143"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR4"
FT                   /protein_id="ABR69143.1"
FT                   /translation="MLFSWSALAENDALSVSHPPQNGLSGLTIKVCGNSAYPPVSWVNA
FT                   DEKIDGVNVAVIRMLLEPLGVKVDARQNSNWRRCLKEAELGNVDMLSGFKTSKRQQFLT
FT                   YLDAPVIRESIYLYYPIEHPLVFTDWKSLASLRVGSLMGDSFGNKVDAALHEYPNLELV
FT                   STQDQNLLKLADNRLDVVPMGKLSGQLDVQRLGLEGKIGHTKTDVSDFWYLAISKKSPL
FT                   VKWLPLLNQRLDRLLKDPSMVLELVERYHQIYNADLGFNGEFDY"
FT   gene            234069..236414
FT                   /locus_tag="Mmwyl1_0202"
FT   CDS_pept        234069..236414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0202"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   cps:CPS_2475 sensor histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69144"
FT                   /db_xref="GOA:A6VRR5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033414"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR5"
FT                   /protein_id="ABR69144.1"
FT                   /translation="MRRSIRFTLFPNLLRYKQMHPLAYRIFIKLLSLSLLLALISTSVQ
FT                   VFNEYRRERASMQQQTDYITSSHIEGVRKGLWDLDSEQLELQLKGIMNFSNVNAVTLHS
FT                   ADWQDDIIVGDKDSIVNNNNGTTLPIYYIDRDGKQTQRMLGELTVYHDMAAIQSKLLRS
FT                   AIEIALFQSLLVLINGVLLLLIVHFMVTRHLEYMASYTRSIGAGNLKKKLILPHKTPRS
FT                   ESDEIDSVVNAMNDMREAILADIKQKDVIEAELRYHRDQLQEQVSRRTRRLQDAKETAE
FT                   KANLAKSQFLATMSHEIKTPLNGILGMVELLQSQPQSSQSHEKLSAIYQSGEALLEILN
FT                   GLLDYARLEEGMYSPEILPFSISELVNSTSLLFLAQAQQQNTQLNVQISDQLQDRYQGA
FT                   VGALRQILSNLVSNAIKFTRDGSVTISVMPAEENPEQSSGVLIEVEDTGMGIPDRYLSH
FT                   IFERFSQADESVTRQFGGTGLGLAITAQLVRLLEGEMGVESEEGRGSVFWFYVPLIAID
FT                   KADIASVEAIEPPRKLAPMSILLVEDTPINQAVTTELLEQDGHQVTLAVDGQEALHKAN
FT                   NSHFDLILMDIHLPSLSGLDVADQIRNGGQINAQTPIVALTANVLPSNVKQCHDIGIRA
FT                   VIPKPFKRELLYQVMGEQLNLNNQIALDQQASSGLLNISLIYSHLTALGQQRLQKLVSL
FT                   FSSSIERGLDELTEMNAQKDLYELADITHRLAGDSDAVGAQTLAAAFRELENHCNDSTK
FT                   MDFSVEINALRPLYEETLDLLLNTVHGH"
FT   sig_peptide     234069..234209
FT                   /locus_tag="Mmwyl1_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 47"
FT   gene            complement(236411..237703)
FT                   /locus_tag="Mmwyl1_0203"
FT   CDS_pept        complement(236411..237703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0203"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   cps:CPS_2746 oxidoreductase, FAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69145"
FT                   /db_xref="GOA:A6VRR6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR6"
FT                   /protein_id="ABR69145.1"
FT                   /translation="MENNTQSPTLDNKKPETTSSFAVVGAGVVGLCVALEAQRRGHKVT
FT                   LIDDKAPGKSTSSGNAGYLATEIIDPLGTPEVLRSAPKLWLNPKGPICTPIRYITKAAP
FT                   WYWRFIKAAQPDQAQRGTEMIHQLNKESVGAWKRTLTDIGAEALLIKGGHLVVWENPDK
FT                   RDEASKLIEKMHSYDISCELVDGNKLALLEPELSQTLSHAVFFPEIHRLSDPYDVCKAL
FT                   FEAFIKRGGSFISARVNAIQPYEDSIRLVTTQQIETFDRVSICAGAWSKTLLEQVGIHV
FT                   PLEAERGYHVTFPNDKTRIHHTILSADRKLVLSPLDAGLRAVGMSEIGGLDLPPIKKRY
FT                   QVLRKHTKGLLPKLFDNPNLQSSEWMGHRPSLPDSLPVIDQHPIYSRLSFAFGHQHLGI
FT                   TQAAISAELLLEKLELRPTRIPMKALRVDRF"
FT   gene            complement(237768..238718)
FT                   /locus_tag="Mmwyl1_0204"
FT   CDS_pept        complement(237768..238718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0204"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: cps:CPS_2747
FT                   ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69146"
FT                   /db_xref="GOA:A6VRR7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR7"
FT                   /protein_id="ABR69146.1"
FT                   /translation="MQISAETLRERLTWPKVINALRDIFIDDVQSPVRHHHFIDVPGEA
FT                   QATLLLMPAWIEGKYLGVKQVSVFPSNNAKGLPGLTSLYTLSCGNTGQTLAQMDGNVIT
FT                   AIRTAAASALASSFLSRPNSRSMLMVGAGRMGHHLVPAHCSVRPIETVWVWDRTVSTAV
FT                   EFVAELQNQGIDARVGNTEQLPEIAGTVDIISCATLANEPIILGEWLKPGVHVDLVGSF
FT                   TPTMREVDNLAMQKAEIFVDTRAGALSETGDLIIPIREGAISADDIHAELTELCGNTHQ
FT                   GRSSLRQPDQAITLFKSVGDSREDLAAAILAYQSS"
FT   gene            238968..239663
FT                   /locus_tag="Mmwyl1_0205"
FT   CDS_pept        238968..239663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0205"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: cps:CPS_2748 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69147"
FT                   /db_xref="GOA:A6VRR8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR8"
FT                   /protein_id="ABR69147.1"
FT                   /translation="MTCELPQSSGALGRGHFALAPNNIPHLFSGQTKDCELLVVDMHRQ
FT                   DPLMTYIAESSGSSLDILLSSAPFFSQLPVELIGCLEFTAKQLQHASEQVRRRVSTQML
FT                   PMVLLQVTDIVTEQDSTWRSVAHQRLDLVILNSLIDSKPDQTFSNEWLAHYFNMSESHF
FT                   YVVCQKQFGMSPQKYILTRKLQQAHQLIMTSSIPIALLAEKYGFSNASSFSRAYRKIIG
FT                   FSPTHKRSK"
FT   gene            239840..241510
FT                   /locus_tag="Mmwyl1_0206"
FT   CDS_pept        239840..241510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0206"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase HAMP region domain
FT                   protein; KEGG: maq:Maqu_3791 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69148"
FT                   /db_xref="GOA:A6VRR9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRR9"
FT                   /protein_id="ABR69148.1"
FT                   /translation="MAIKSRFLISTTLILLLTGFFSWLSMRVLAEDIIVSWVERYAEKQ
FT                   IQYDKVRTLLPLIQEVKLSKEFAELESLKAWAKHPFNDALKQQALYDTEAFRHRFSDKS
FT                   YFIALKGNEHYYYSDGKEASNLDPYRYTLHESNPDDAWFYQIMAKKLNLHLNVNPDVEL
FT                   GVIKLWSDVLIRNGDDVLGVVGTGLDLSGFLRQMVEKQDIYSAIVFINNEGSIQLYQRE
FT                   ELIDYSSLTKQSENKSLVFQLLDDEQSRMQLKQTLGMAKEAPNHVKTSPVYKDGVRQLA
FT                   SVVYIPEIDWFQVNFIDINGFLPLTEFSGLLVVFFISLVCALIVFYLLLTLIVTKPLSE
FT                   LDLSIGSLDKKQYRAPKLGRFAGLEIKKLVSHYQKMSTSLLEYQLELENKVAERTEALS
FT                   RLAKLDPLTELYNRRGFEVHMTEYMQRWQKNHHSFGLINVDVNRFKLVNDLHGHAAGDL
FT                   VLQEIATYLTNVVGDKGEVARWGGDEFLILVKQNSDQDLVTISEQLQSDRESLVIRINK
FT                   QDITIQFSVGSALVEDNDTLESLLHRADKAMYAVKFSNR"
FT   sig_peptide     239840..239932
FT                   /locus_tag="Mmwyl1_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(241614..242909)
FT                   /locus_tag="Mmwyl1_0207"
FT   CDS_pept        complement(241614..242909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0207"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: jan:Jann_4136
FT                   TRAP dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69149"
FT                   /db_xref="GOA:A6VRS0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS0"
FT                   /protein_id="ABR69149.1"
FT                   /translation="MSFEFSLCLLVVFTLAAFGAPVALSMIIGAIAYLAASGQDIALAG
FT                   EQIIQGIYGSFILLAVPLFIVAANIMNAGTISERLLNFCVAMVGHLRGGLGHVNVVSSL
FT                   IFSGMSGSAVADAAGVGKVVIEMMTKENRYPPGYAAAITAASATIGPIIPPSIPMVIYA
FT                   LVSDVSIGYLFIAGLVPGLFMGVVLMAFNAYQARKLDIQKEPRIPARDIPKVAWQAFPA
FT                   LMMPAILLYGIYGGVTTPTEAAAVAAGYALLLAATVYRSISFKELVNVFKQSVLSSASV
FT                   GLVISAALIFNYIVSTENIPTAVANTLVAWDLSPLQFLIAVNILFLLLGCLLDTATVVL
FT                   VIVPLLIPACRELGIDLVHFGVITLVNLMIGMITPPYGILLFVINGTTRIPLADIIKGV
FT                   LPFTGVLIFALIVMTVFPDLVLFVPRLFGYAG"
FT   sig_peptide     complement(242850..242909)
FT                   /locus_tag="Mmwyl1_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.682 at
FT                   residue 20"
FT   gene            complement(242906..243403)
FT                   /locus_tag="Mmwyl1_0208"
FT   CDS_pept        complement(242906..243403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0208"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: jan:Jann_4137 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69150"
FT                   /db_xref="GOA:A6VRS1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS1"
FT                   /protein_id="ABR69150.1"
FT                   /translation="MKRVLRVLQSTADNIAAAMLAAMFITFIVQIVSRYFFNMPLAWTE
FT                   EVCITLWLWLVFWASAFCLKETDHIRFDVLYAVSPRKIQRVLALIAALGIAGGMAYAFF
FT                   PTWDYISFYKIKKSANLRIHLNYVFSIYGLFMIVIVLRYSWSALTQIFPRLNSLFSDEN
FT                   PS"
FT   gene            complement(243416..244429)
FT                   /locus_tag="Mmwyl1_0209"
FT   CDS_pept        complement(243416..244429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0209"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: rde:RD1_0742 C4-dicarboxylate-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69151"
FT                   /db_xref="GOA:A6VRS2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS2"
FT                   /protein_id="ABR69151.1"
FT                   /translation="MKKSTMQMKSVKRWIAGTTLLASVLVAQTALAAPEKLRLSAATSP
FT                   TDQRAIAMTEVFGKEIQDITTFEPHWNAALFKQGTELEAMARGNLDMTISSAQQISEFF
FT                   PEFSIFTAGYVMQDAEHQQRVFNADFMTPLKEKVEDELGVKLLSVMYLGRRQVNLRTDK
FT                   EIQTPEDLKGIKLRMPATESWQFLGNSLGANATPMPFSEVYTGLQTGAIDGQDNPLPTD
FT                   KDAKFFEVTKQIVLTSHLVDFNYIAISKSTWDKFSPAEQARIQKAADNAAESARQKQLA
FT                   LEQSLVQFFKDQGLKVYEPNLEAFRKHVQNEYLKSDLSKSWPKGMLEKINALGTTK"
FT   sig_peptide     complement(244331..244429)
FT                   /locus_tag="Mmwyl1_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(244448..245041)
FT                   /locus_tag="Mmwyl1_0210"
FT   CDS_pept        complement(244448..245041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cgt:cgR_0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS3"
FT                   /protein_id="ABR69152.1"
FT                   /translation="MNHTVILTIGFPGSGKSTVARAIANSLGATYLDKDTICNGFTGLL
FT                   LELNGESANARDNSTLYKEKIMPMEYQTLFKAANDTLSSNQFIVIDAPFISFFDDPSYI
FT                   KNQREALNWTDVNVCVIEVTARLDITKERLIQRGEKRDLWKLDNWESFSQRISQQTCSW
FT                   DHVNKFSFDNSATSPNVDQLVQDIKNTTLKSDNQ"
FT   gene            245257..246045
FT                   /locus_tag="Mmwyl1_0211"
FT   CDS_pept        245257..246045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0211"
FT                   /product="Transcriptional regulator IclR"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: chy:CHY_1273 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69153"
FT                   /db_xref="GOA:A6VRS4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS4"
FT                   /protein_id="ABR69153.1"
FT                   /translation="METIKLNKSAERVVDVLFLLSKADRALTLNEVCKALNLPKSSAFE
FT                   LLQTLVYKGFLEIEDARLKTYKLGIGSFETGIAYLSKMSVSQLARPLLQELNRQTGSTV
FT                   FLGVEDKGKIVYLDKAENFSVMRPTAKLGSRRFMHTTGLGKALLAALDDEKIHYILGLD
FT                   ELLPKTAYSNVAMQDVLKDIQEIRARGYSIDNREDNIETYCIGSAIYDQWSQPIAAISV
FT                   ASMYSTMNSEREQTIIALVKETALKLSQQLGYGGNKLYAN"
FT   gene            246083..246739
FT                   /locus_tag="Mmwyl1_0212"
FT   CDS_pept        246083..246739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0212"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; KEGG: mta:Moth_0420
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69154"
FT                   /db_xref="GOA:A6VRS5"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS5"
FT                   /protein_id="ABR69154.1"
FT                   /translation="MWKKFENLKAIADTGILLIIRLDDEQEALAVAEAAIAGGIRALEV
FT                   TLSVPNALGIISTLSKKYKEQGILIGAGTVLDAETARAAILAGAELLVSPHVTASMIQV
FT                   ANRYQAVSVCGAYTPTEVVLAMEAGADIVKLFPADMLGPQYVKTIRAPLPQAPVAPTGG
FT                   VTPENVGEWLTAGCVSVGVGSFISKAAQGTGDYSKVTEAAKIFLAAVAEARQVQK"
FT   gene            247191..248198
FT                   /locus_tag="Mmwyl1_0213"
FT   CDS_pept        247191..248198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_06066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69155"
FT                   /db_xref="InterPro:IPR016963"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS6"
FT                   /protein_id="ABR69155.1"
FT                   /translation="MKKTILATAIVSSILSVSAAHAAPIFDANFELNTDAVDTETGDTT
FT                   YDQNGRVELNAYSKHTAGDNFFAGKGTVLLNTDGEATVDDAFIQLGNSTWDFQLGRFEA
FT                   INLFPLAKDTLIVHVSDDYVYQANKVRGRIGDGGGQIAFHYNASEKLKFEIDTLYGDGS
FT                   TKADDTSPYGDNTTAISGIRPSVTFITDAATISVGYESVKYDTLTGPANAPTATGKVDL
FT                   SGYAVTANFDVADANVNVSAAFSKDDVTDKKISSFVANMVYGNFGLGVIGSNVDNKTGN
FT                   DPSMLTTYIAYTVPLLDIENATVTFAGSYSTADDVAVDANDKTTAARVRFNYGF"
FT   sig_peptide     247191..247259
FT                   /locus_tag="Mmwyl1_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(248472..250874)
FT                   /locus_tag="Mmwyl1_0214"
FT   CDS_pept        complement(248472..250874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0214"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: cth:Cthe_1256 glycoside hydrolase, family 3-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69156"
FT                   /db_xref="GOA:A6VRS7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS7"
FT                   /protein_id="ABR69156.1"
FT                   /translation="MSDTRIKQLLAELTLEEKAMLCTGKNFWNLHGIERLDLPSIMVTD
FT                   GPHGLRKQAGEGDHVGLNAAVKATCFPTASGLAASWNTKLIEEMGIALGKECRAEGVSV
FT                   LLGPGTNIKRNPLGGRNFEYFSEDPLLAGDMSAAWIKGVQSQGVGTSLKHFAVNNHEHC
FT                   RMTVDAIVDQRTLREIYLPAFERAVTQTQPWTIMCSYNKVNGTYAAEHKQLLDDILVNE
FT                   WGFEGIVVTDWGANNDRVEGVKNGQHLEMPSSGEMNTKKIITAVENGQLTIEALDKSVA
FT                   RVLELILKSQASLEANTVQADLQAHHELAARIAEETCVLLKNDGLLPVPVGKKIAVIGA
FT                   LANNTRYQGAGSSKINPFKLEQPLDEIKKQFGNDNVSYTAGYHLNDAEDSTEIAKAIEL
FT                   AKQADVVFLFAGLTPKYESEGFDRQHLNLPQVQLDLIAALGEQLNKTVVVLQNGAPVLL
FT                   PFVDKTAAILEAYLGGQAGASAIAKILSGEVNPSGKLAETFPANLEDVPSQPYFPGTTK
FT                   QVQYREAIWVGYRYFNTTKTKALFPFGHGLSYTNFTYYHLKLLSGDKTQFNESDSIKLQ
FT                   ITISNMGDKAGAEVVQCYVGQKSPSQPRPAKELKAFEKVFLEPGESKEVMFELDYRAFA
FT                   YWHKEKAAWIAESGDYQIHIGSSVNDIRDTATIALETGIVAEQPNCALATYFDPAKHDF
FT                   NDAAFSALLGYDIPTPTPITPYTVNSTLGDIANEPLGKPLFDDMLSVFTQMMGGDQNNS
FT                   AAEADRLMAESMVADMPLRNLPVFNGQQYSEEDILILIHSMNSRSMM"
FT   gene            complement(250888..251544)
FT                   /locus_tag="Mmwyl1_0215"
FT   CDS_pept        complement(250888..251544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0215"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: oih:OB0328
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69157"
FT                   /db_xref="GOA:A6VRS8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS8"
FT                   /protein_id="ABR69157.1"
FT                   /translation="MTSRMVHQTEATRDKIINIAEALFIENGFADTQMKDIAIAIGMSR
FT                   NTLYRYYQDKYDLGFAILVVVLARKISVYEGIIEKIQAHHYSSIHEGLGVLMQAYSDLQ
FT                   YADDDRFIAEFDGYYAGSRIPSGFRENLKQLLMPDSISQSLYNLVLIGQKEGSIRSDIP
FT                   ADYLMVTIFNAITTFFRRMLLRRDALMEIEQEATPKLTPVLIQLLMDGMKPSPQS"
FT   gene            complement(251740..253617)
FT                   /locus_tag="Mmwyl1_0216"
FT   CDS_pept        complement(251740..253617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0216"
FT                   /product="Glutathionylspermidine amidase"
FT                   /EC_number="3.5.1.78"
FT                   /note="PFAM: glutathionylspermidine synthase; CHAP domain
FT                   containing protein; KEGG: pha:PSHAa2455 bifunctional:
FT                   glutathionylspermidine amidase (N-terminal);
FT                   glutathionylspermidine synthetase (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69158"
FT                   /db_xref="GOA:A6VRS9"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRS9"
FT                   /protein_id="ABR69158.1"
FT                   /translation="MTSDSNRPMAPFGTLLGIAPGNVPVYSSDYDSADDNELPNRHAYR
FT                   SYVDGIFMGYKWQCVEFARRWLYLNKGYIFDDVAMAYDIFRLTSVRLIADESRLPLKSF
FT                   RNGSLRHPEVGALLIWNEGGEFEVTGHVAIVTKVLPDRLYLVEQNVGHQVWQEGQDYSR
FT                   VLDARVSEDGGYWLRCSYGDASVMGWVIQTDDETHSEQIEPDDPALFDLQIRHVPNKGQ
FT                   ASRAWLNVANPAEEAFVDMMGGHKLASRPEDDYKYMVMTESAERELKRATNELHALFMH
FT                   ATDYVLQNDDLLSSFNIPPALWPKIHQSWDNRRNQMITGRFDFSLSSQGIKVYEYNCDS
FT                   ASCYMEAGIIQEKWAKHYGANEGEGSATELVDELIEAWKNSKVKGVIHIMQDTDLEENY
FT                   HALFMKRTMEKAGLNCKVIKGVSSLRWDEDGDVVDADGVKIRWVWKTWAWETALDQIRA
FT                   ECDDDEQRLRNYKTDVPRSEAPRLVDVLLRKDVMVYEPLWTLIPSNKAILPVLWMLFPD
FT                   HPYLLESSFELSDSLKHHGYVSKPIAGRCGFNISMYDGEDALMEETAGRFSHQDQIFQA
FT                   LWKLPDIEGYRSQVCTFSVAGHYAGSCLRVDPTLVITKDSDLMTLRVID"
FT   gene            253872..254948
FT                   /locus_tag="Mmwyl1_0217"
FT   CDS_pept        253872..254948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0217"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   neu:NE2510 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69159"
FT                   /db_xref="GOA:A6VRT0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT0"
FT                   /protein_id="ABR69159.1"
FT                   /translation="MTSTETNLFSPVKLGSLELPNRFIMAPLTRTRAPGHLPNALMAEY
FT                   YAQRASTGLLITECTMVTEGSSTFGDDPGIYSQEQIEGWKLTTQAVHEKGGRIFMQIWH
FT                   GGRAAHPLLNGGKESVSASAIAIDGETHTPEGKKPYAVPRALTVEEIKDIVNDFRQAAI
FT                   NAKEAGFDGVEIHGANGYLIDQFLRESSNQRTDEYGGSLENRARFLTEILEAVTDVLGS
FT                   GRVGLRLSPLNTFQSMRENDPVTWTRFLSEHLNQFNLAYLHLMRADFFAEQQADVVSVA
FT                   REYYKGHLMVNMGYTPEEANQVIESNQADSVAFGKGILANPDFVERVRVGAELNEPNPD
FT                   TFYTSGKEGYTDYPFMTA"
FT   gene            complement(255062..255172)
FT                   /locus_tag="Mmwyl1_0218"
FT   CDS_pept        complement(255062..255172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0218"
FT                   /product="putative malonate transporter, MadM subunit"
FT                   /note="KEGG: pau:PA14_02640 putative malonate transporter,
FT                   MadM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69160"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT1"
FT                   /protein_id="ABR69160.1"
FT                   /translation="MGTSSEVAAGLATTDARLISYGCITAAFYTALGCLF"
FT   gene            complement(255190..257511)
FT                   /locus_tag="Mmwyl1_0219"
FT   CDS_pept        complement(255190..257511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0219"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: vvy:VVA0893
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69161"
FT                   /db_xref="GOA:A6VRT2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT2"
FT                   /protein_id="ABR69161.1"
FT                   /translation="MSIKAKTTFIFLLSTILSLSLLTSVIYFQTKEKSSESLEQSATDK
FT                   LIAVREARKKSIERYLNATVNQITAQSNNPTIKTAMVDFSSAFESENADGSLTTEENTN
FT                   LASYYETVFSKEYERLNHKSIDINMLMDSLSTKEKSLQFRYISNNKQPLGAKHKLDAAN
FT                   SAAIYDQVHAQYHPYIRSYLETFGLYDIFLISTSGEVVYSVYKEIDFATSLMNETNIDS
FT                   GLANVFRQANELSNNEKYAIVDFSPYTASYGAAASFIAKPLFVDGKKVGVLAFQIPIDQ
FT                   INNIMTGDNDWSNSGLGLSGESYLVNDNLKAASINRFLAENPDSYIASLKSTKIPQIEI
FT                   EEISLRKNNVGVQTIDTPSVRAALAGESGNKKIFDYRNISVLSSYTPVKFSGLNWVLIS
FT                   EIDTKEAFQAATDLAHSTLKTALLSLLGASILAVIIGLFFSKKLTTPIMKLNRFINDIS
FT                   LNKDLSRRVAIAGKDEISEISNNINNLLETFENIVKQITGTTNQLATSSEHLADVSHQT
FT                   QKNMLQQQGESEQLATAMHEMVATVNEIANNASMAATSARDADNAAKIGLQTIESTESH
FT                   LQKLNVELKNSSNVVHRLSEDSQQISQILDVINGIAEQTNLLALNAAIEAARAGEQGRG
FT                   FAVVADEVRTLAARTQESTLRINDIINMLQNRSKEAVSAMAVNEEHANQTIEQAYKAKD
FT                   ALSEISRGVTAITDMNIQIASAAEEQSLVAEEINKNVTQIVILGNSSSEGANEVSSASE
FT                   NLSKISSELLSLSAQFKVNK"
FT   sig_peptide     complement(257440..257511)
FT                   /locus_tag="Mmwyl1_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.819 at
FT                   residue 24"
FT   gene            257782..258939
FT                   /locus_tag="Mmwyl1_0220"
FT   CDS_pept        257782..258939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0220"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   stt:t2265 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69162"
FT                   /db_xref="GOA:A6VRT3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT3"
FT                   /protein_id="ABR69162.1"
FT                   /translation="MTIASVLISKLPSVGTTIFTKMSTLAAEKGAINLSQGFPDFPPDS
FT                   RLLERASQAILTGNNQYSPMTGLPMLREAIARLIEGHYGRKVNSNDDITVTSGASEAIF
FT                   DAIAALVHDGDEVILFDPAYDLYEPAVTLAGGVCRRVILKAPDFRPDWQAFSELLTDKT
FT                   RLVIINTPHNPTGSCWLEEDLESLWQAIAQRDIYVLSDEVYEFIHFGKSAVSVHQHPEL
FT                   IKRSLVVSSFGKSFHLTGWKVGYIVAPKALTVELRKVHQFVSFCTATPLQQALAEHLIA
FT                   EPEASAGLSGFYQQKRDVLRNALADSRFTLLPCTGTYFQLLDYSEISDLDDVAFCEWLI
FT                   DQVGVAAIPVSVFYQQPPTNQRLIRLCFAKEESTLLDAAQRLARL"
FT   gene            complement(258978..259385)
FT                   /locus_tag="Mmwyl1_0221"
FT   CDS_pept        complement(258978..259385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0221"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: sde:Sde_3850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69163"
FT                   /db_xref="GOA:A6VRT4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT4"
FT                   /protein_id="ABR69163.1"
FT                   /translation="MSHLHTGSCLCGAVKFELEGEFKKFFLCHCSRCQKTSGSAHCANL
FT                   FAPGAKLTWLSGEDKLSFYQLENTHFSRTFCSVCGSNVPTDAKARGVVVVPAGCLDSEV
FT                   DITPQAHIFMDSKGNWDEHLSEVPAFETLPQ"
FT   gene            complement(259417..259692)
FT                   /locus_tag="Mmwyl1_0222"
FT   CDS_pept        complement(259417..259692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0222"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   dps:DP0751 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69164"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT5"
FT                   /protein_id="ABR69164.1"
FT                   /translation="MVTAIIMLSVEKKHINQVAEKLASIEGLAEVYSVSGPYDIAAIAR
FT                   VQSNDEISDLVTQQLAQIDYIIKTETMLAFKAYSKDDLEGMFSVGV"
FT   gene            complement(259816..261153)
FT                   /locus_tag="Mmwyl1_0223"
FT   CDS_pept        complement(259816..261153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0223"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: maq:Maqu_3218
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69165"
FT                   /db_xref="GOA:A6VRT6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT6"
FT                   /protein_id="ABR69165.1"
FT                   /translation="MSTNASLKKSLSIGLTIGVSLLWLFGAISSGLVVQKEMNESFDKA
FT                   LKKSALQILPLVISDSLQKKKDNSQEIPTRENDDEYLTYTIKDRHGNVLFHSKDANPKV
FT                   FSGSLQMGFSNTESHRIYTTSTLDNRVYIQVAEQLARRNEDLIEAGIALLLPLLFLAPI
FT                   SLFGIWWIIRLSLRKVAVFQFDIEERGAGNLSPVEMEKLPKEFKPIAVAVNRLLERLRR
FT                   TLEAERSFTANSAHELRTPLAIALAKVQRIKSAATDEPLKTQITDVENSLKSLSKQSEK
FT                   LLELAKAEGGGAISQQPNNLVPILKMIVGDFSRQFPERIKLTLAKNEINSLLDPDAFAI
FT                   LARNLIENAFKHGRTNSPVEISLLEDGTLRVVNECDLVAPQDLALLRNRFMRANTTAPG
FT                   SGLGLAIVDAIAKGAELTLQLRSPANGKQDGFEVELNLGISISKPC"
FT   sig_peptide     complement(261046..261153)
FT                   /locus_tag="Mmwyl1_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.479 at
FT                   residue 36"
FT   gene            complement(261143..261808)
FT                   /locus_tag="Mmwyl1_0224"
FT   CDS_pept        complement(261143..261808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0224"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: maq:Maqu_3217 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69166"
FT                   /db_xref="GOA:A6VRT7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT7"
FT                   /protein_id="ABR69166.1"
FT                   /translation="MRVLLIEDTTGLGEAVRDQICDDGHAVDWVQSLNFAEASVQATSY
FT                   DLVLLDLMLPDGNGFDFLKSLRKSGNSTPVIILTARDQVSDRIEGLNAGADDYLIKPFD
FT                   LSELSARVGAVARRYRGDPNPLVKLGHLEIDLGEHRIKANGLPVELTAREWALFEGLVQ
FT                   RPGTLLSRSQLEDRLYQFGAEIESNTIEVYISRLRKKLGRDVIITVRNMGYRLETYEH"
FT   gene            261987..262463
FT                   /locus_tag="Mmwyl1_0225"
FT   CDS_pept        261987..262463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_3214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69167"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT8"
FT                   /protein_id="ABR69167.1"
FT                   /translation="MMKHILLTFSILSCLALSMSAQAREVTFTTQLARYSGSGAYFAIY
FT                   LLDANNKYQQTIWVAGKKRKYYSHLRGWSRASGKRAVEYDGKTGASVTSGRSLTISQNI
FT                   DDSLIDSGYKIVIDSAVEDANSNQADVSTPLTTAGAGKAVIGSGYVMSFTYDFK"
FT   sig_peptide     261987..262058
FT                   /locus_tag="Mmwyl1_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            262482..264692
FT                   /locus_tag="Mmwyl1_0226"
FT   CDS_pept        262482..264692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0226"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; PepSY-associated TM helix domain protein;
FT                   flavodoxin/nitric oxide synthase; Oxidoreductase
FT                   FAD-binding domain protein; KEGG: maq:Maqu_3213
FT                   flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69168"
FT                   /db_xref="GOA:A6VRT9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRT9"
FT                   /protein_id="ABR69168.1"
FT                   /translation="MLRKIHGLPSLAVMLFVVLLAGTGAILSLMPTFQRAAAVIPAAGE
FT                   ISVATLAQHVVTHFPQVERIERDLSGEVIVHYQQDNKVHADLVNPLTGESIAPYKPSAV
FT                   MVWVKNLHRSFLLGDTGRIMAGVTAGFMVLICLSGTVLLVRRIGGWKALVKPFKGKGSK
FT                   RIHSELARFAILGLLLSSLTGAYMSALRFGVFTDHTYVEAEFPNAVSGGQPASVSSLIA
FT                   LKNIDLSELRELTFPAPNDRQDVYSVTTRSGVGFVDQSTGQWLSFAALPESGVLQQWVT
FT                   KLHTGEGLWWLGLILGASALTVPVLSYTGARSWWIRRRSAISQVNSQINTVDIEQADTI
FT                   ILVGSEGNTTWGFARDLQANLCKAGCKVYCAEMNQLADYYPQAKRLFILTSTYGNGDAP
FT                   SSAHNFLAKLASFRPDQTMQFAVLGFGDQQFPQFCQYALDVDAALQNKGIARLHSVGLI
FT                   NRGSSAQFREWGNDIADVTGIPLVLTHNPLPTPTAKLTLIGREDYGLDGLAATSIFRFS
FT                   ATGKDPLPLFEAGDLLGIVPPNDDVARFYSLASSTTDGVLEICVRKQPYGLCSGYLHNL
FT                   RLGDGIKGFIRQNPEFRPAVGGNPIILIGAGAGIGPLAGFIRKNTQRNPMFLYWGGRNE
FT                   ESDFLYQPDLGRYLEDHRLTGLQTAFSQTKSQAAEKAYVQDKLLEDQTAVRQMLEQGAQ
FT                   ILVCGGRDMAAGVAQAIDDILKPLQINVDALKAQGRYLEDVY"
FT   sig_peptide     262482..262592
FT                   /locus_tag="Mmwyl1_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.516 at
FT                   residue 37"
FT   gene            264877..266166
FT                   /locus_tag="Mmwyl1_0227"
FT   CDS_pept        264877..266166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0227"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; GAF domain protein; KEGG:
FT                   pha:PSHAa1380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69169"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU0"
FT                   /protein_id="ABR69169.1"
FT                   /translation="MRETMMLKINDDVDLLSAILSMQSKGEIQAEDSLTMALHQDLDHL
FT                   IQTIRQHLGMDTAFLSRFHHGYREMLHVDNSVGSTTVLHQGHKDKNEETYCRLIADKKL
FT                   PSIIPDTSKNKLTKDLAVTKALNIGSYIGVPIYLSDDSIYGTLCCFSERADKSLSNKDL
FT                   SLLTLFAKFAARNIEKELIVSKVQQIARDDLFDIINKKRLNIVLQPIYDLKKKSVQGFE
FT                   CLSRFQTEPYRSPDYWFNKANVSGIGEVLELFAIEEALNLLPDIPEQYYITLNISPKHL
FT                   TSPYLQAMLDKAPLHRIVLEVTERECIPDYKAFRNAIRPFRKRGMRLAVDDAGAGFASF
FT                   QHILELQADIIKLDRSLISNINSDHRKRALVAALIGFAKETKSNVLGEGVETLAELEAL
FT                   QELGAQTIQGYFFCHPLPIDDVLAFCSSRV"
FT   gene            complement(266237..267298)
FT                   /locus_tag="Mmwyl1_0228"
FT   CDS_pept        complement(266237..267298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0228"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: hch:HCH_06979 ABC-type sugar transport system, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69170"
FT                   /db_xref="GOA:A6VRU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU1"
FT                   /protein_id="ABR69170.1"
FT                   /translation="MADLQLKSIEKNYGSTRIIKGVDIDIKDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDISGGELTIDGKVVNDLQPKDRGIAMVFQSYAIFPHMTVRENVGFGLTVSG
FT                   VPKDEKVQRVNEAAQILQMEHLLDRRPSQLSGGQRQRVAIGRAIVRNPKVFLFDEPLSN
FT                   LDAALRMDMRMEISKLHKKLDATMIYVTHDQVEAMTLADKIVVLKDGEVQQIGSPMELF
FT                   HKPANRFVAGFLGSPSMNFVKVKVVAHDNDSITVSSDVIDEVVLPRHDRDVAIGDTLEL
FT                   GIRPQYLEPHHGEIKGSMHGRVSLSERLGTETVLDITLADGNKVIASINEDKVFEVDEE
FT                   ISLCFDIEKVHVF"
FT   gene            complement(267301..268293)
FT                   /locus_tag="Mmwyl1_0229"
FT   CDS_pept        complement(267301..268293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0229"
FT                   /product="Glycosyl hydrolase family 32 domain protein"
FT                   /note="PFAM: Glycosyl hydrolase family 32 domain protein;
FT                   KEGG: ace:Acel_1363 glycosyl hydrolase family 32, N
FT                   terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69171"
FT                   /db_xref="GOA:A6VRU2"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU2"
FT                   /protein_id="ABR69171.1"
FT                   /translation="MTIALEKKWIWDSWYHKEGDVWHGYFLQADKSLIDPELRHLNVSQ
FT                   AHAISKDLIHWEHLGTCFEPSTTTAWDDSTTWTGSVVKDDDGLYHLFYTGTCLAEKSLY
FT                   QRVGHAISDDLHNWKRVGDGLCLDIIGENAQYYEDQHQVGHWHDRAMRDPWVMKNPNGK
FT                   GWLMYFTARAPGIEEPNAGGAIGFATSDDLYHWELQKPVFVGGFGQLEVPQVFELEGRW
FT                   YCLFCTSSSHWADAFIKARVGKPVTGNHYLVADNPEGPWSLPESEFLDGDEPCYRYAAR
FT                   ILQTDTGPVIIGFHDQGPNGFVGEILDPVAVHVNDEGLLSTDNNNKKGQ"
FT   gene            complement(268316..269194)
FT                   /locus_tag="Mmwyl1_0230"
FT   CDS_pept        complement(268316..269194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0230"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_pAT_376 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69172"
FT                   /db_xref="GOA:A6VRU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU3"
FT                   /protein_id="ABR69172.1"
FT                   /translation="MFQLDKDNPTLRLIVRYMVLTLIALIFVTPILFMMMSSLKPDQQL
FT                   LADTSSIRAFLPIGDISFDNYKAAFERAPIGMFMLNSLLVTGVTVVLGLLVCSMAGFSF
FT                   VFLNWRGKSIAFSIILATLIVPFETIAIPMLLMVSKLPWLGLDGFSWGWLNSYRVQIIP
FT                   FIADGLTIFLFAQYFKDLPKELIEASRIEGCSWWQVYWRVVMPLSGPIIATAAILKFLA
FT                   MYNQYLWPIMVTQQEQYRPVLVGLQYFFQLNTAWGEVMAYLTIITVPVLAFYLALQRAF
FT                   IASIASTGVKG"
FT   gene            complement(269194..270273)
FT                   /locus_tag="Mmwyl1_0231"
FT   CDS_pept        complement(269194..270273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0231"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_pAT_377 ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69173"
FT                   /db_xref="GOA:A6VRU4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU4"
FT                   /protein_id="ABR69173.1"
FT                   /translation="MKKNSILTRHNTTGWLFASPGFGLMLLFIVIPFILAIAFSLTNQR
FT                   LMSPNAAEFVGLENYTNMLDVGILVVDPEIDASGNILVDKNGDNKYPRLRKFTRNNPDY
FT                   PNVQGMKEWFSFSWGEQKVAIMASDLVFMKALVNTLTFVAFVAPIQGALALILALLINQ
FT                   PLRGIQIFRSIYFMPVVVSIVVVSLLWRFIYDGQNGLLNSVLNTLTFGHFKAVDWLGNQ
FT                   DTALGSIMAMSIWQAVGFHMIIWLSGLQTISPTLYEAAKIEGASPWQTFRYVTWPGLRN
FT                   TAVLVVIVITMQAFSLFAQIDVMTSGGPLDSTQTIVYQAVERGYGKQDISGGSAMSVVL
FT                   FLLVLSISLLQRYLTREKN"
FT   sig_peptide     complement(270157..270273)
FT                   /locus_tag="Mmwyl1_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.445 at
FT                   residue 39"
FT   gene            complement(270365..271642)
FT                   /locus_tag="Mmwyl1_0232"
FT   CDS_pept        complement(270365..271642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0232"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: atc:AGR_pAT_379 putative sugar transport sugar
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69174"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU5"
FT                   /protein_id="ABR69174.1"
FT                   /translation="MKITKRLALTMLSASALGGTFGSTSAFARTDLSLWYHGAGNKVEA
FT                   KVINQIVNDFNSSQDDWNVVLESFPQGSYNDSVVAAALANNLPDILDVDGPVMPNWAWA
FT                   GYLRPLLIDEAKIADFLPGVKGYWDGKLYSIGLWDSAVAMMTRRSTLNEVGARIPTIDS
FT                   PWTEEEFNDVLKKLKATGKYDYPLDLGMAESGEWFPYAFSPFLQSFGGDLIDRSTYKTA
FT                   EGTLNGPEAIAFGEWWQSLFVNGYAPGNSQDPADHETGLLEGKYAMQWYGNWAALKNLN
FT                   KFGDDALFLPAPDFGHGPKIGAASWQFGVSSASKHPQGASDFIEFALQDKYLAAFSDSI
FT                   GVIPPTQSAAALTKNYRQGGALAVFYALSKAQALVRPVTPGYIVEAKVFEKALADIADG
FT                   ADVADTLDSAADEINADIEKNRGYSH"
FT   sig_peptide     complement(271556..271642)
FT                   /locus_tag="Mmwyl1_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(271753..272802)
FT                   /locus_tag="Mmwyl1_0233"
FT   CDS_pept        complement(271753..272802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0233"
FT                   /product="regulatory protein LacI"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ret:RHE_PE00360 putative transcriptional regulator protein,
FT                   LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69175"
FT                   /db_xref="GOA:A6VRU6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU6"
FT                   /protein_id="ABR69175.1"
FT                   /translation="MTTIYDVAEAAGVSPKTVSRVLNNDVPVGEKTRKKVEAAIAALGY
FT                   VPSTAARSMRSNKSGLIGLVTGAISHFSDTSNAPTGLPDLFIVQGIQKVMQASGKTLLI
FT                   ADTGDSAASVPHLIRTFQEHRVEGLIYVANYHKQIDLPIASKSIHTVLANCFDTNHTTS
FT                   VVPNDQMGQKSLVDKIIKEGHSRIAYLTLDPSMVATHQRLEGYQQALHENDIAYDPELV
FT                   LCADTLDLLDNEKLIIDAIDHLLSLACPPTAICCGNDKMALKLYGILRVKGIRIPEQIS
FT                   IAGYDNYLAITEGLYPALTTVHLPYQEIGQEAARQLLKLIDGKDQKAPNSAITIVDSPV
FT                   IWRQSILKI"
FT   gene            complement(272962..274002)
FT                   /locus_tag="Mmwyl1_0234"
FT   CDS_pept        complement(272962..274002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0234"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bvi:Bcep1808_1701 alcohol dehydrogenase, zinc-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69176"
FT                   /db_xref="GOA:A6VRU7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU7"
FT                   /protein_id="ABR69176.1"
FT                   /translation="MKAVVYESFSTTPKIMNVEDPTPENHGVVIKVEATGVCRSDWHGW
FT                   MGHDPDIVLPHVPGHEFAGIIEAVGKDVQRFKVGDRVTVPFVSGCGSCPECHGGNHQVC
FT                   GNQTQPGFTHWGSFAEYVSIHHADVNLVTLPETIDFTTAASLGCRFVTSFRAVVDQGKV
FT                   SAGQWVAIHGCGGVGLSAIMIANSIGANVIAVDVTNDKLELAKALGAYATINATSVADV
FT                   AEAIKEITRGGAHVSIDALGHPTTCINSIKSLKKLGKHVQVGLLLADQATPPIPMNLVI
FT                   AHELEIIGSHGMQAFRYDAMLAMIKSGKLSPEKLLGRTISLEESIVALTNMDKINPPGV
FT                   TVVTSF"
FT   gene            274143..274604
FT                   /locus_tag="Mmwyl1_0235"
FT   CDS_pept        274143..274604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0235"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bvi:Bcep1808_1700 putative transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69177"
FT                   /db_xref="GOA:A6VRU8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU8"
FT                   /protein_id="ABR69177.1"
FT                   /translation="MAALDKVDTDIVRRMQQDGKLTNAKLASELSLSETPCWRRLKRLE
FT                   EEGIITDYQANLDRRKLGFGVMAFVQLTCNQHDAETTQTFEEMIQRCDNVLSCHNTTGA
FT                   ADFLLQVVAKDLDDYSRFVDQVLRKLPGVSAIASNISLRELKASTRLPI"
FT   gene            274746..276035
FT                   /locus_tag="Mmwyl1_0236"
FT   CDS_pept        274746..276035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0236"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: hch:HCH_03503 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69178"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRU9"
FT                   /protein_id="ABR69178.1"
FT                   /translation="MTNNYDHLIHIRDHSEVALYELIPDVVWIFDLDKHGWWWGNSASL
FT                   KFWGLNTLEDLMNKDLSGDTQGAKDRTAQTFELAAKSGLTIDPWTTYPNGKPKTLYMRH
FT                   RAVLVGPDKHRAIIAFINEEVNIGDIPENLLLVEAMRYTSVVVTSFSFAGDPIIENPAS
FT                   TEAYKHLSRQNTSEGQSFFTSRFASLAEGQKVLAQAIEEKGGQWTCDVNTSAGPRKHSL
FT                   DVRMTRHPLTGEFLLLMSEYDVSALHTALEAEKVAQDKLRRLAHYDAVTGIPSLHYLLE
FT                   KEGELIAKAKQDNHLLSILYLDLDGFKQVNDNHGHEAGNQVLTSIAERLHSQTKDVGQI
FT                   VRVGGDEFVIWLDRLDDRDEVLKLANIILNVVLEPVMISDTNKTVQVSTSLGIAHYPEH
FT                   GEDMKSLIQTADSTMYRVKKQGKCDVQVAI"
FT   gene            complement(276099..277109)
FT                   /locus_tag="Mmwyl1_0237"
FT   CDS_pept        complement(276099..277109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0237"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   cps:CPS_3853 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69179"
FT                   /db_xref="GOA:A6VRV0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV0"
FT                   /protein_id="ABR69179.1"
FT                   /translation="MKAAVASKFGAILKIEDVVKPKIEPHQVLVKIHACGVCHTDLHAC
FT                   HGDWPVKPTLPFIPGHEGVGEIVEVGSAVKHLALGDRVGIPWLYSACGHCEYCLTGNEN
FT                   LCLSQQNAGYSVDGGYAEYCAAHAEYVVKVPEGLGYVEAAPLFCAGVTTYKALKVSGAK
FT                   PGDWVALFGVGGLGHLAVQYAVAMGFRVVAVDTGSAKRELAMSLGAEYFFDFKTDDVVK
FT                   EILDTTSGVHATVCTAVSKAGFRQSYDVVRRGGKCVLVGLPPEDMPLPIFNTVLNGVSV
FT                   VGSIVGTRKDLEECLEFAARGKVKAIIAEKSLDDINEIFADMEKGEITGRIVMTL"
FT   gene            complement(277304..279307)
FT                   /locus_tag="Mmwyl1_0238"
FT   CDS_pept        complement(277304..279307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0238"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /note="PFAM: 67 kDa myosin-cross-reactive antigen family
FT                   protein; KEGG: ilo:IL1599 monoamine oxidase family protein,
FT                   membrane associated"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69180"
FT                   /db_xref="GOA:A6VRV1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV1"
FT                   /protein_id="ABR69180.1"
FT                   /translation="MSHKDISTFTISTTAPEGFEHEPDSTRDYWHHQALNTLPPYDFIA
FT                   PYARHKTLPTPGIQNRKAWIVGSGIGGLAAAFYLLRDAHMPAENITILEEMTVEGGSMD
FT                   GAGNPEEGYIIRGGREMNWNYDTLWDLFQDVPAVELPEGYSILDEYRLINDNDPNYSAA
FT                   RLMHKCGELLDAKDFGLSKSQQWELIRLMLKRKEELDDISIEDYFSEGFLKTNFWFLFR
FT                   SMFAFKNCHSLLETKLYLHRFLDSIDGFADMSALVFPKYNQYDTFIKPLADMLREKGVT
FT                   FQFGTRVEDLDINFSGDKKTVTGIRAVVIKEGKEEAKHIHVGLGDLVFTLTGSMTEHTA
FT                   YGDMENVPELTCDKHDPGEKSGWTLWKNLAKKSPVFGKPEKFYGNVDKSIWESATLTCK
FT                   PSPLIDKLKTLSVNDPYSGRSVTGGIITITDSNWLLSVTCNRQPHFPDQPEDTLVLWVY
FT                   GLLMDKPGNRIHKTMAQCTGKEILTELCHHLGIEDQLDEIVANTKIRLALMPYITAQFM
FT                   TRAAGDRPHAVPEGCTNLGLIGQFVETRNDIIFTMEASIRTARIGVYKLLNIPKQVPDI
FT                   SPTQYDIRNLIKGARALNSGKPFMGERLLHRLLDKTYFAHILPPLPEPEESKQSLFEEE
FT                   MHELLGKGSTVMHKFGGWISSLRESLSNKNKS"
FT   gene            279586..280038
FT                   /locus_tag="Mmwyl1_0239"
FT   CDS_pept        279586..280038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69181"
FT                   /db_xref="InterPro:IPR011971"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV2"
FT                   /protein_id="ABR69181.1"
FT                   /translation="MQNQTAHAHHITDIIKVMNGGIEFYQEAKTKLDDSTYNAFFDRMI
FT                   GAKTQAVTELQPFAIDQQGEVENDTDNLVKARQAYTKLISKISSESTAFTYVDQLEEVE
FT                   DKVLEELDLALERNQTQDCEVTLRRVKVRMKECHDEMKALQVAAQH"
FT   gene            280317..282305
FT                   /locus_tag="Mmwyl1_0240"
FT   CDS_pept        280317..282305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0240"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: pha:PSHAa2041 high-affinity
FT                   choline transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69182"
FT                   /db_xref="GOA:A6VRV3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV3"
FT                   /protein_id="ABR69182.1"
FT                   /translation="MTNSQKTATGAILLPVFIPTVIVTLFLIVGTLSNPELAGEVFQSA
FT                   LAWVTKTFGWFYMLATAIFLVFLVCIGFSRWGNIRLGPDHGDPEYSFPAWFAMLFSAGY
FT                   GIALLFFGVAEPVLHFSQPPNATAETIGAAREAMQIAYFHWGLHIWGIYGLMGLVLAYF
FT                   AFRHGLPLSVRSALYPLIGDRIYGPIGHIVDVFAILGTLFGLATTLGLSVTQINAGLHY
FT                   LWEDIPINTTVQITAIGLITLAAIGSVVAGMDKGVKNLSILNMGLAVFIMVIVFFVGPS
FT                   IHILDAFVQNTGSYLSNIVERTFNLQAYTQSDWIGNWTLFIFAWTIAWAPFVGLFIAKI
FT                   SRGRTIRQFIFGVLAVPTLFTFLWFAIFGDTALYLIMEQGKDVLIGEVQADHSVALFQF
FT                   YDLLPWSTFLSVITVFLIITFFVTSSDSGSLVVDSLASGGALETPVWQRVFWASLEGII
FT                   AATLLLAGGLGALQTMSILAALPFAIIMLIAALGLWRALVIEGHRGAAVEAAATPGRAF
FT                   SNEGSWRKRLSTLFKFPGEAKVTHFIKDVVEPAMEEVQKELAIHGWKANITREENGVTF
FT                   QLERDEKLDFYYQVVATEHEIPEAHSENSKYDTHWQADVYIRNGALGYELYGCSQDEVI
FT                   RDLIDQLEQYFNFVDAAPGQLPWNTVS"
FT   gene            complement(282384..282971)
FT                   /locus_tag="Mmwyl1_0241"
FT   CDS_pept        complement(282384..282971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0241"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: pmy:Pmen_3234
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69183"
FT                   /db_xref="GOA:A6VRV4"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV4"
FT                   /protein_id="ABR69183.1"
FT                   /translation="MTFHIENTGIINQSDTKWRDSQNYYGRVSRTLHWLTAALVILQFF
FT                   VVLAWRGTGKNAVTLFLANIGPHGSLGLLILVVTLVRLYWTWLNRKQRPLKTLGWDGKL
FT                   ARLVHAAFYVLLLLLPAIALLRQYGEGYEIRLYGITMLPEAERHIAWMVAPADLLHSPL
FT                   SWLLAGLMIGHIAMALIHRFWFKDKVLARMAG"
FT   gene            complement(283173..284774)
FT                   /locus_tag="Mmwyl1_0242"
FT   CDS_pept        complement(283173..284774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0242"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: Dual specificity protein phosphatase;
FT                   diacylglycerol kinase catalytic region; SMART: Protein
FT                   tyrosine phosphatase, catalytic region; KEGG: pha:PSHAb0333
FT                   methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69184"
FT                   /db_xref="GOA:A6VRV5"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV5"
FT                   /protein_id="ABR69184.1"
FT                   /translation="MTNNIYFQLAWAWFALSFFTVSLAYLLNKPTIFRKRSDGTVPVYV
FT                   RWVFMPFLWSTQLYNSWARSTDSVPALQKIDEGLYLARRLFPSDIHQIKSENISAVLDV
FT                   TAEFSSLNWMLYQADVDYLNVPILDHSVPSDTQIHRALNWIHTHRKTGRSVVVHCALGR
FT                   GRSVFMMAAYLLSQNPKSSPSDIMDKIREIRQTARLNKRQFKYLKRALDNKLLVVHNSA
FT                   WLIANPVSGTRQWEEQQDLILRYLSAYFDITVKTTTPEINGTDLAKEAVKASPDMIIAC
FT                   GGDGTVTEVAAAMVGTNIKLGIIPFGTANALSHVLCGTMSKIAPLETICLNLIDGCEQR
FT                   IDTATCNGELMLLLAGVGFEQQMIEKADRSKKNTSGQLAYLKGLWEAIGQNDVYEFTVQ
FT                   LNNEEPFTIKTPSLTIANAAPITTLLAQGKGVPNIMDGELDLTWLDPERMQILNLAELA
FT                   MLGMGDRNEDSELPEDSNSPEGNNGIFHRSAQRVTVDISQVGHYVVDGEEREAEKLEVV
FT                   VRPQSLSVIVPESVVS"
FT   sig_peptide     complement(284700..284774)
FT                   /locus_tag="Mmwyl1_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.944 at
FT                   residue 25"
FT   gene            complement(284995..285864)
FT                   /locus_tag="Mmwyl1_0243"
FT   CDS_pept        complement(284995..285864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0243"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rpb:RPB_3829 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69185"
FT                   /db_xref="GOA:A6VRV6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV6"
FT                   /protein_id="ABR69185.1"
FT                   /translation="MRDLPINLLRTFMVVAETLNLTEAAKQLHKAPSTVSMQLNRLEGL
FT                   ITNPLMERGQHGVRLTAAGVQLRAHAQQLLNLHDQIVGSFQNIEISGVVRLGTHDQYAS
FT                   RTLAPILQDFILSYPEAELEAFCDYRPDYLVDLLEKGKLDIALVEMLADTEGGIRLRRD
FT                   ELVWVGSKDHFVHTQAVLPLVVFAEGCKHRQFACEALTKAKIPYRIAFTSQSRSGVIAA
FT                   VRAGIGVAIIPYHTLEEDLVIYDNLPNLPDMEVTLFTSEKANEATLRLEKIIVENNVFN
FT                   PQAITRND"
FT   gene            286000..287211
FT                   /locus_tag="Mmwyl1_0244"
FT   CDS_pept        286000..287211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0244"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cps:CPS_4013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69186"
FT                   /db_xref="GOA:A6VRV7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV7"
FT                   /protein_id="ABR69186.1"
FT                   /translation="MRIPITFGFNQVISHGFGIFLFAALVPTMQSTLDINSWHLALAGA
FT                   LTQVSYLVGAMLLGVIGPRLDSAHLLLITGTLTTSLLFTMAWLDNTIIMIFVLTIMAAS
FT                   AAMSWGSIVELVTRYGRADRTATNLSIASSGTAWGYSVNGLIILLIVPLLGWRSGWVAA
FT                   SIFGLVTLLATFSLLKSVRSKAQDQEIDVTFAMGTRQLFKTVFSERTAFLACLILLLVG
FT                   ASTMTFTTWLNTYLAELSLPPALGGYTWGIIGLTGMIAGFFVGKLADKKGHGVALLSIF
FT                   GVFALGLLVFTYRPAQFVMIAGFGYGMMYFPIWGVIAGWVSKQYSSKATMQINGIGMVA
FT                   FGLGGALGNVLAGIVYDATGSLSNVYLLICGLSVVLFVVAIYIFLHDRQSNKPHADSFL
FT                   QSEI"
FT   gene            complement(287243..288781)
FT                   /locus_tag="Mmwyl1_0245"
FT   CDS_pept        complement(287243..288781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0245"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: reu:Reut_B4996 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69187"
FT                   /db_xref="GOA:A6VRV8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV8"
FT                   /protein_id="ABR69187.1"
FT                   /translation="MSFDQQLQDAITLFQQQNYDAAEERFTTLATSYPDQGICQLYLAQ
FT                   LGILKGNGSNHIESLNTLLNLLPALSDGHHILGQCYLQSGKLPDAARSFYQALMAKWSG
FT                   EQPINSVETKHRTPKPKAINFDSDMALQLLWQVLAQFYAAGIYAFPTAGTLLGLERSGA
FT                   LLPNDKDIDIGVDWIQMSQAIQLLESNGWVEFSRSYNLINPRCFRHSSGLIVDLCGYGT
FT                   NEATGEAISGLWMKEVPFDWNRITYFPAISLLSKVSPAGPIYYLTSPESILESLYGPNW
FT                   KQEDPYFDTIVCAYNLKGLSWLHRCYAYSRLYEHWRNSNIEPCKRILDSLTTKLPQDIF
FT                   LKKLANHISSINNPKISERKKRVLALGYFDLFHIGHLNYLRYAKSKGEQLIVGVAPDSF
FT                   SLLSKGYGPIQTEIERKTLIENLAEVDDAQLVLVRMDDTENAATWIKSLDIDTVVCGEE
FT                   WQGSSRWKKLETILNSMQITVLYAPKTQEISTTILKKRMHQNYYESMHTPKPDH"
FT   gene            complement(288897..290840)
FT                   /locus_tag="Mmwyl1_0246"
FT   CDS_pept        complement(288897..290840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0246"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sdn:Sden_1155 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69188"
FT                   /db_xref="GOA:A6VRV9"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRV9"
FT                   /protein_id="ABR69188.1"
FT                   /translation="MQRQAMTVLLMTPPMTQLNTPYPATAYLTGFLRSRGYEATQRDPA
FT                   IELFLEMMTSPALDIIRQHVEENFESFEDDELPDAIFTFLAEFDRYRLCVEPVIRFLQG
FT                   KDSSLALRIVSRRFLPEGPAFDAIAQMEAVSGDILKTAFGQLGVQDKAKYLATLFINDL
FT                   SAVITQGVDPYFEVSRYGERLAAANPSFDDLYNTLMGEPSFSSEILEQLVEQYLEETQP
FT                   SVVALTVPFPGNMLGALRIAQTCKDINPDLPVVLGGGFVNTELRALRDPRVFEFVDFIC
FT                   LDDGERPFMTLLEFFDGKREIDELVRTYFLAEDENGKSYVHYNENAELHDIPQTDVGTP
FT                   IYDGLPLTEYLSLCEMLNPMHRIWSDGRWNKLTIAHGCYWRKCSFCDVTLDYIDRYDAA
FT                   GADILVDRIEELIAETGQTGFHFVDEAAPPKALFALARRLIERGVVISWWGNIRFEKTF
FT                   TPERCQLLADSGCIAVSGGLEVASDRLLKLMKKGVSVEQVARVTKAFSDAGILVHSYLM
FT                   YGFPTQTEQETIDALEMVRQMMANECFQSAFWHRFAATAHSPIGINPEEYGITLAERPD
FT                   ILFAENDVDFSDPTGTDHDMLGDGLRKALYNYMHGIGFDQTMDFWFDKPVKRTLVKKDL
FT                   ISKALNDLIVSS"
FT   gene            complement(290961..291374)
FT                   /locus_tag="Mmwyl1_0247"
FT   CDS_pept        complement(290961..291374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0247"
FT                   /product="UspA"
FT                   /note="KEGG: sit:TM1040_2126 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69189"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW0"
FT                   /protein_id="ABR69189.1"
FT                   /translation="MYQSIAMPVDLSHTDKLEKALKVTGDLAKLYSSKVYLLAVTASAP
FT                   SSIAHNLKEFKERLDSYAKAQEGEFGVIFEAVVIPCADPAADMDKSLNHWLHENPVDLV
FT                   VMASHVPSFKDHIFHSHGSFLASHTDKSILLVR"
FT   gene            complement(291530..292660)
FT                   /locus_tag="Mmwyl1_0248"
FT   CDS_pept        complement(291530..292660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0248"
FT                   /product="MOFRL domain protein"
FT                   /note="PFAM: MOFRL domain protein; KEGG: rde:RD1_1981
FT                   hydroxypyruvate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69190"
FT                   /db_xref="GOA:A6VRW1"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW1"
FT                   /protein_id="ABR69190.1"
FT                   /translation="MHSNDRNSAVTIFNAAINAVAGYNATYRAVNSFADFTPDQIIAVG
FT                   KAASGMCAGALAALGNDCPALLVTKYAHTDQAMWDANNVTVIESAHPVPDQNSLNAGKQ
FT                   MLATVNSMEAGSKLLLLVSGGASALSEALPADVSLEDWQKLTNQMLAAGYNIDQINTRR
FT                   KETSLIKDGKLLENFTGTDVRVLAISDVEGDDISVIGSGTGSIKRCPSTASVTLIGTNQ
FT                   VAREAAANKATELGYHVIDNKENLYDDVEVLSSYIGQQLINAEPGVYIFGGEPTVKLPE
FT                   NPGNGGRNQALALGIAENIVGRDNILVLVAGTDGSDGPTDAAGGIVDGSTAKDLHAVRD
FT                   ALKRADAGTYLREQDAIFITGPTNTNVMDIVVAILH"
FT   gene            complement(292767..295742)
FT                   /locus_tag="Mmwyl1_0249"
FT   CDS_pept        complement(292767..295742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0249"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: ret:RHE_CH01024 probable
FT                   phosphoglycerate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69191"
FT                   /db_xref="GOA:A6VRW2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW2"
FT                   /protein_id="ABR69191.1"
FT                   /translation="MTSIEQLKSARASALSLTQNGAPQATSNQFFGVGPITDMTQNEVD
FT                   ARLLRFEFDAWIEENYPKLDDKGNRIGSFTTAEIGRGMHRGYPADKVLNDMMREIHRYF
FT                   GFPKANSMAVGLGGGHSGFTAAALHLMTANDPSQIVFVDTPKPESAEGKAGGFFRQSWG
FT                   TQLTELQRYATNGDESRILFAEGEGSIPSANFLLEKGVKLFFGVGHETTGATTYTEQEI
FT                   ANLLAWVDANPKEHHAVIDATSLLGAMPWAKELVDGVLTKCNLFMPFQKAIGGISGYFI
FT                   VSLTRPALARINANQKDPSWAIPRQLKIAVPRDAKEPLSSEKTTDLGPIYDAEKDQMLG
FT                   GIINTFSTLAFAETTFAILRNERMIGDVYELNARSAANRDLVNQWIENNDLFELGVSNS
FT                   DSRGAAVTLLKVTDKDITDADVHNRIIVKSKQMLGYEGITHTDGAHEKGLDVARYVNAF
FT                   PGSPGDYRAWIGGIRPAQDITALLDNIQYCYLRAKNAVLEEILAEKGESFESAVSATTK
FT                   DDVRIDDANRAYKVLIADLVGMIFDAKGNADFSQVAAYIKSKGGEFHVGSITDAGELAT
FT                   GKVHFFYQPSLSREDELLAETGEGQYDAVIAAATFFPAESKFELGGVRIGAGTGNMGSA
FT                   SWGGGNGEGGIAPLMNTPSFNSRATAQAAMKALLKVLPDLQVSTMHDRVVAGDFDTGKN
FT                   LAEFPTTKLEGKKLAVVGYGNIGREMAKLGAAFGMQVSVYARPAHQKWIESEGFTYASS
FT                   IIEAAQDADVLSPHTGLGALNSDSGKFSNSDIINADVFSAMKHGAVLVNYDRGEVVDIE
FT                   ALDAALTSGQIRYAAIDADLFKDPNTGELSGPMVPYRNIYEKHVGKMELLPHAAADTEH
FT                   VSRVEGAKQAVDQILSVIQYGKVINLKGDLPEGFTNDGAKTVNGVGKVNASSVTTLSAK
FT                   QIKQLADSATQIAAYWGAINATEDADKRAALVAEYTEMMVLNSNIYTTLLAKNGLQGPL
FT                   GN"
FT   misc_binding    296287..296481
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 125.56"
FT   gene            296543..298336
FT                   /locus_tag="Mmwyl1_0250"
FT   CDS_pept        296543..298336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0250"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: abo:ABO_2371 TonB-dependent receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69192"
FT                   /db_xref="GOA:A6VRW3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW3"
FT                   /protein_id="ABR69192.1"
FT                   /translation="MKTQCISPAFTRTLVAFSVVSAVSAHAETTADSSSTLSPLVVTAT
FT                   STSVSVADSLSSVTVINREEIKAQQAQEISELLAAQPGVDISSNGGYGKTTSVYMRGAS
FT                   AESTKFLLDGIPLYSATSGGAPFENIPTSLIDRLEIVRGPKATLYGADAVGGVIQAFLP
FT                   KADDDSHMNVSVGGGSFNTKTIDATVSGSSDNTQYLLSAGKFETDGDIVKEGEGAQGYR
FT                   NENVLLNVGHDFSSGARISGLIMNSEGRNHYVGDENDYQVQVIGLSVSLPVTEDWDTEL
FT                   KLSQTRNDSKTISSEDKYNTKTQTARWSNTISAGEHEFVLGAETSEDKVDVTSYQAPDR
FT                   SNNAVFAQSQFDFGATHLQLNIRQDHNSAYGDSTTGGVAVGYKLDGIHTLRASYGTAFE
FT                   APTFNDLYYPSSGDPTLKATKSKTVELGVRADYDNMYWDAAVFDASYGDMVIWSNYTGS
FT                   WAAYNVDSKVQGVELSSGLTLEQWQLKAALTWLDAKDDDTGFQLPKRAKRSARLSADRL
FT                   FEKGRVGVTLIGADGRATTLGSSETLAGYVTMNLRASYDFAADWNAEISVKNALDKEYQ
FT                   TAKGYFNPGRGVFLTLNYSAF"
FT   sig_peptide     296543..296626
FT                   /locus_tag="Mmwyl1_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            298336..299238
FT                   /locus_tag="Mmwyl1_0251"
FT   CDS_pept        298336..299238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0251"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   maq:Maqu_0274 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69193"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW4"
FT                   /protein_id="ABR69193.1"
FT                   /translation="MVNPMRSLLSISALLLSGWAFVSNALADPICVVDDRGRDVCIDHA
FT                   AMRIAALSPGATELIYAAGAGDNVVAVVSYSDYPEAAKSVTSVGSHTRLDLERLISLQP
FT                   DLILAWGTGNPTEQIETLERLGLPVYYVEPHEFEDIARNIDNLGALAGTSKRAKEEAKR
FT                   FRTGIDVLHERYKQAPRVKTFYQVWDEPLMTMNGSHYISKVVDLCGGDNVFADSPRLIP
FT                   RLSQEAVLLKNPEAIIAGGMGERNANWLEKWRVFAELLATQKDNLFFVPPSLIQRPTPR
FT                   LLEGAQILCEKLDIARARR"
FT   sig_peptide     298336..298419
FT                   /locus_tag="Mmwyl1_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.784 at
FT                   residue 28"
FT   gene            299291..300229
FT                   /locus_tag="Mmwyl1_0252"
FT   CDS_pept        299291..300229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0252"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   maq:Maqu_0275 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69194"
FT                   /db_xref="GOA:A6VRW5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW5"
FT                   /protein_id="ABR69194.1"
FT                   /translation="MCVSMLSVVFAITQGSVNLSPYAVWQALLGQGSGLNQTLVLELRL
FT                   PRVMAAFATGGLLAVAGALMQILLRNPLADPYVLGISGGASVAALAAILLGISGVLMSG
FT                   MAFLGAVLSTLLVFGLSARLGNTATMRLLLTGVVIAAGWGALITLMLALAPPHKIPGML
FT                   YWLMGDLSYASTPWLAWLVLVPTCLILMPLGRSLNVLARGPLQAAALGVNVKSLERFVF
FT                   LLASLLTAIAVTTAGSVGFVGLVIPHMLRMVLGNDQRLILPASALAGGCLVTLADTLAR
FT                   TVIAPEQLPVGVITALLGVPTFLYLLQRGRL"
FT   gene            300226..300999
FT                   /locus_tag="Mmwyl1_0253"
FT   CDS_pept        300226..300999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0253"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: maq:Maqu_0276 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69195"
FT                   /db_xref="GOA:A6VRW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW6"
FT                   /protein_id="ABR69195.1"
FT                   /translation="MTKLKLTQLLAAIPNKSAQPTHALSLTFQAGQMWGILGPNGVGKT
FT                   TLLHTLAALKAPALGTIELNDQPITELHRLKLAQQIGIMFQEHQDGFPASVLETVLLGR
FT                   FPHLSPWEMESEQDLALAYSALERLDLAEFAQRALNSLSGGERQRAALAALMAQTPDVW
FT                   LVDEPTNHLDLHYQVAVMGLLAEQASMEKVVVMSLHDVNVAAQWCSHVLLLYPDRPPIW
FT                   GKAASLLTQQNLEPLYRQKLAMTELNGKPLFVPIA"
FT   gene            complement(301001..301678)
FT                   /locus_tag="Mmwyl1_0254"
FT   CDS_pept        complement(301001..301678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0254"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: sfr:Sfri_3569 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69196"
FT                   /db_xref="GOA:A6VRW7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VRW7"
FT                   /protein_id="ABR69196.1"
FT                   /translation="MAKRKQGIFGRIWFVAWRFLLLFVIVLFLFRFVPLPTTSFMLQSQ
FT                   YPVKHTWISIDKLPTYMPLAVVASEDQRFPDHFGVDFTAISKALDQYDDGDGLRGASTI
FT                   TQQTAKNLFLWSGRSFIRKGLEAGLAIGLETLWGKKRILEVYLNIAEFGKGIYGVEAAS
FT                   QHYFGRSASKLTMNQAARLAVLLPSPRTRNPNDLTFYLRERVDWVERQMQQLGPDYLKP
FT                   IIE"
FT   gene            301882..302604
FT                   /locus_tag="Mmwyl1_0255"
FT   CDS_pept        301882..302604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pin:Ping_2624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69197"
FT                   /db_xref="GOA:A6VRW8"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW8"
FT                   /protein_id="ABR69197.1"
FT                   /translation="MADFKTHVTVAAVLSAPLAATCFIMGFANMNEAIFYALAGTFGGL
FT                   LPDIDADDSAAIRLIFRLFGALAGGLAIAFGMDKLLHWQILALAIVSYLVVRFPIRWVF
FT                   EQFTIHRGTLHSVLANMMFAILAVPAAYYLFALPEKTAWGIGAFVFLGATIHLVLDELY
FT                   SIELSGMRIKRSFGTAMKITDWGEPLASILLVLGCVVGYWLSPSADAWLDTFAWWPEHE
FT                   TLATWLVQELKALPSLWS"
FT   sig_peptide     301882..302001
FT                   /locus_tag="Mmwyl1_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.388 at
FT                   residue 40"
FT   gene            complement(302632..303015)
FT                   /locus_tag="Mmwyl1_0256"
FT   CDS_pept        complement(302632..303015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69198"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRW9"
FT                   /protein_id="ABR69198.1"
FT                   /translation="MSTYKNGVSLNAKRYNDKLLLNMKTSGHPSEMDFEKITPQLEAAI
FT                   YSIHSPYAGLLVDISEFEGWSMKSAWTEFLLSQRLGGEFDRIAIYGKSPWQNRLIRVIS
FT                   WFISADIKVFKRKKEATDWVMSS"
FT   gene            complement(303301..303897)
FT                   /locus_tag="Mmwyl1_0257"
FT   CDS_pept        complement(303301..303897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hne:HNE_2363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69199"
FT                   /db_xref="GOA:A6VRX0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX0"
FT                   /protein_id="ABR69199.1"
FT                   /translation="MEFNIKLIFSGIAIVLAIIGFVPYIALILRGQVKPHVFSWVIWGI
FT                   TTTIIFFAQLEAEGGVGAWPIGLSGFITIFIAFLAYIKRGDATITKLDWGFLVVALASL
FT                   PLWYITSDPLWTVVILTTVDMIGFGPTFRKAYHRPFEDSRVFFIIMILRNACSVVALEA
FT                   YSVTTVLFPFCLAVGFLILLIILQHRRGVLSQQAA"
FT   gene            complement(304177..305565)
FT                   /locus_tag="Mmwyl1_0258"
FT   CDS_pept        complement(304177..305565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0258"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: ppu:PP_2948 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69200"
FT                   /db_xref="GOA:A6VRX1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX1"
FT                   /protein_id="ABR69200.1"
FT                   /translation="MARASTLIESVMKDIESKITSRAYLPNTRLPSVRAQAKAMQVSVS
FT                   TVVEAYDRLVAEGCIVSRPGAGFYTCGPIAPLNLTHIGPTVAREIDPLWVSRESLESTP
FT                   GSLMPGCGWLPSEWFYQSGIKRALRNLARTHSLDLTEYAPPKGSQAFRHFLQRRMLSHN
FT                   IEVTAEQIMLTESGTHAIDLIGRFLLSPGDTVLVDDPCYFNFHALLKAHRVNIIGIPYT
FT                   PNGPDLERFAQAIKDYNPRLYITNSSVHNPTGAHLAPHVAHKLLTLTQASELVIVEDDI
FT                   FADLETTRSPRLAALDGLNHVIEIGSFSKTVSASVRCGYIAARQDWIEQLVDLKIATSF
FT                   SGNRLDSEIVLQTLTDSGYRKHMDKLHNWLAKQRQSTTKKLVNLGIQPWIQPKDGMFLW
FT                   CQLPTGKNATQLARDCLSKGVVLAPGNVFSQSQNAHDYLRFNVAQCTDQKIFDVLAWAL
FT                   DQQR"
FT   gene            305695..306555
FT                   /locus_tag="Mmwyl1_0259"
FT   CDS_pept        305695..306555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0259"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: nmu:Nmul_A2052 protein of unknown
FT                   function DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69201"
FT                   /db_xref="GOA:A6VRX2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX2"
FT                   /protein_id="ABR69201.1"
FT                   /translation="MKPVTQGWLSGFVGVATFAGSLPATRIALQGFDPTFLTVARASIA
FT                   GLLGLLFLLLLKQPRPNTSQIFTLLLSAMGVVVGFPLLTAFALQYVTSAHCVVFVGVLP
FT                   ICTALFAVLRGGERPSWPFWLFSLVGAALVVGYAALGAGEVSLMGDGLMLAAIVVCGMG
FT                   YAEGARLSRVLGGWQVICWSLVVSLPVMLPLLYFLWPSSFALVTTSAWLGLGYVSLFSM
FT                   LFGFIFWYRGLALGGIAAVSQLQLIQPFMGFILAAWLLQESISLTMLWVTLAAVLCVVG
FT                   AKKFC"
FT   gene            complement(306888..307805)
FT                   /locus_tag="Mmwyl1_0260"
FT   CDS_pept        complement(306888..307805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0260"
FT                   /product="protein of unknown function DUF1526"
FT                   /note="PFAM: protein of unknown function DUF1526; KEGG:
FT                   shn:Shewana3_4223 protein of unknown function DUF1526"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69202"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX3"
FT                   /protein_id="ABR69202.1"
FT                   /translation="MPNTINNQSALINQLISNKRLESYKAVFHCSNEAELIGAYLWNIE
FT                   VCSALFPLLTSAEVTLRNSIDHALTQSFGRFWWRKGRLRYNSYAPDKEPPFSVSAITNN
FT                   FSKATNQVKRDKQARYNIANVRPLHQEIIAKTEFSTWEFILDNEFMGDELIWPAQLGKV
FT                   FQGKWPSTSAASMLSSTKDLVKTVREFRNRVSHNEPIWKRYGVGSQEDSIAHLHEKIDR
FT                   IYKLILLISPRKAELVKEQNFLSSAMRVCSTNEITICQNKAKTHNIDSIKELRHAMMEA
FT                   TAQNHTIIIETSEAPHCKLIPLRY"
FT   gene            complement(308325..309185)
FT                   /locus_tag="Mmwyl1_0261"
FT   CDS_pept        complement(308325..309185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69203"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX4"
FT                   /protein_id="ABR69203.1"
FT                   /translation="MKILPNNPSIEYLHRAARALRSKHRAGDPSVVELISHFDTSFQNL
FT                   QTEQVLLQPFSILDAQRVTARQYGFASWRRLKLFIQKSTQQSADYDPALAEQLTRRNAM
FT                   RIALMRRYTSKKAGWFDHLDDFNEESVEMLEAIYDKYGWVGPQIVGREGMEACYWLGIN
FT                   CLKNSQFQYRSAELMREALPLGECYGGYYAVSIDRWLTLSYQPSIFGAFNDFNERSDRV
FT                   EYSDNVVDPKNLNKRRAQVGLMNLSKANEEWADMIRQRKAYRYTKDEWQALIRKWALEG
FT                   GYIAA"
FT   gene            complement(309532..310299)
FT                   /locus_tag="Mmwyl1_0262"
FT   CDS_pept        complement(309532..310299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0262"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: plu:plu4091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69204"
FT                   /db_xref="GOA:A6VRX5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX5"
FT                   /protein_id="ABR69204.1"
FT                   /translation="MAWLQAQDSFNPDALDNRVLGIAAELAQHDSGVHYHDKGQLLFCK
FT                   QGSMRITLDNSLCLLPPARVAWIPPHVEHRVKVNDVVGYRSIYIDCNHYHGMPEEVTVL
FT                   TASPLLREVLERIALAPFNTNWQDGAYANILAVCLDEITSAPLEVTLLPLPTDRRLRHL
FT                   VAQEALPPLNRLSHLIGASEKTISRIFRRETGLSYQQWRQQWRLNKAIELLSIGWCQSE
FT                   VASQLAFSSDSAFTTFFKNMVGCPPKIYMDRRK"
FT   gene            310369..311562
FT                   /locus_tag="Mmwyl1_0263"
FT   CDS_pept        310369..311562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0263"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   plu:plu4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69205"
FT                   /db_xref="GOA:A6VRX6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX6"
FT                   /protein_id="ABR69205.1"
FT                   /translation="MYLIFGYGFFMKRRLTLTLATSLMMFPQVVETIYSPALIHIADGF
FT                   QVSAAIAAQTLSCYFFAFALGVVFWGRMCDIIGRRPSILLGLMLYLIASIVALLSSSFI
FT                   VLLAARMLAAFGASVGSVGTQTAMRDRFDGPELAKIFSIMGIAMAVSPAVGVLSGALLT
FT                   YYWGYQGVFGGLVILAAVLFGYAYLKLPETCPKQISASSFGETLVKMLKDGDIWLSASL
FT                   VALFNICMFSYYQLAPFLFSKLELPDDWFGYTGLILAAGVGVGAVINKFLVSKHWQFPS
FT                   QLTLACILSLSGGVLLLLFEETVWFVLPMMLVVMAYGIAIPNILARALRNYKECMGTAG
FT                   AILGSMYYLMLGGGLVLVGLSQHLGIVLTLCSLCILFFVYLVVYNERRLPLPESEKA"
FT   sig_peptide     310369..310461
FT                   /locus_tag="Mmwyl1_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.578 at
FT                   residue 31"
FT   gene            complement(311851..314136)
FT                   /locus_tag="Mmwyl1_0264"
FT   CDS_pept        complement(311851..314136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0264"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_1999 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69206"
FT                   /db_xref="GOA:A6VRX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX7"
FT                   /protein_id="ABR69206.1"
FT                   /translation="MSPVHSPYQDMEIIGARNNNLRSVTVKVPKHCITVFTGVSGSGKS
FT                   SLVFDTIAAESQRQLNESHSAFIRHRLPHYGQPQADALCNLPASIVVDQKPLGGNARST
FT                   VGTATDIQPLLRLLFSRLGEPFVGYSNVFSFNHPQGMCPTCQGLGMVDEFDLDVMFDRS
FT                   KSLNQGAIRFPTFARGTFRWKRYAYSGLFDCDKPLADYTADEWQTLLYADDLAVSNPLP
FT                   GWPSSARFQGVVPRFRRAYLDHEPSRLTKAEREGLAHVITRQRCQACGGARLNPTILSC
FT                   KIKGKSIADCGNLEISDLLLFIRTIDSEAIATVLTAIIERLEQMRAIGLDYLSLGRETA
FT                   SLSGGESQRVKMVRHLGSSLADIAYIFDEPSVGLHPSDVHQLNTLLRSLRDKGNTVLVV
FT                   EHDPDVIAIADHVVDMGPGAGKDGGHVVYQGDYAGLRQADTLTGRYLLRATPMIREPRS
FT                   ATGQIALQHLSLHNLQDVNVSIPTGVLTVVTGVAGSGKSTLVNRLLLRHCPDAILIDQK
FT                   SLGGTRRSSVSSYTGVLDEIRSGFTKASGQPASLFSNNAQGACPACKGLGLIHTDLAFM
FT                   DSVETPCDACSATGFNEAARAITWMGCNIAQVLAFSVEQALRHFQAYQEIVEPLHRLSN
FT                   VGLGYLSLGQRLNTLSGGERQRLKLACRLAEEGSLYVFDEPTSGLHMSDVDRLLTILDD
FT                   LTQRGATVIVVEHNLDVMAHADWLIEMGPGAGKKGGKVIFEGLPTAMISASKSVTGPFL
FT                   RHHLTEQQ"
FT   gene            complement(314133..314597)
FT                   /locus_tag="Mmwyl1_0265"
FT   CDS_pept        complement(314133..314597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0265"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bam:Bamb_1998
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69207"
FT                   /db_xref="GOA:A6VRX8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX8"
FT                   /protein_id="ABR69207.1"
FT                   /translation="MITVQTNVEPGVLENALSHLQCILVARRTRYTPEAVSWAQYDILE
FT                   LLRLQGPMTPSLLGDKLGAARTGISKSLRVLKDFNLVEQMQGDGDRREQVTTLTQQGRD
FT                   FLIRAATGRHDAAQCVMAALTPGEQAMFTELCEKVSAALTSHAAEQGPRA"
FT   gene            complement(314754..314996)
FT                   /locus_tag="Mmwyl1_0266"
FT   CDS_pept        complement(314754..314996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69208"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRX9"
FT                   /protein_id="ABR69208.1"
FT                   /translation="MAVVATLDHVLRDANQTKSWKSRHISSAPNFTQFKELEELGIVLS
FT                   ARTTHSTQLPHARERAPRDAQSRHGIQLHAMTAGD"
FT   gene            complement(315042..315356)
FT                   /locus_tag="Mmwyl1_0267"
FT   CDS_pept        complement(315042..315356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0267"
FT                   /product="transposase and inactivated derivatives"
FT                   /note="KEGG: hch:HCH_01378 transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69209"
FT                   /db_xref="GOA:A6VRY0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY0"
FT                   /protein_id="ABR69209.1"
FT                   /translation="MPRKPRFFLPNIQVHVIQRGASREPVFFEDEDYKAYAFWMKEAAV
FT                   KYNVAMHAFVFMTNPVHILLTAQSSMGVSQFMQHIGRCYVPFMPTVCKLFNVKLFGVFR
FT                   "
FT   gene            complement(315805..316788)
FT                   /locus_tag="Mmwyl1_0268"
FT   CDS_pept        complement(315805..316788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr2321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69210"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY1"
FT                   /protein_id="ABR69210.1"
FT                   /translation="MYSEKQNQISISEIGSFFSGGRIITLEGQPTREVQVARNAKPRFV
FT                   DLNGDYVTGQAYVQFTRQAKPVFDSPLMFWHGGAMTGVTWETTPDGRPGWQMYFLRKGF
FT                   DTYVCDAVERGRAGWSPYPEIYDTSPIFRTRNEAWSLFRFGPASSCKDENRLAASFPEL
FT                   KFPIEQLDYFCSQFVPRWTDHGAITLDAYYAAVEKIGPVWLVAHSQGGNFALEAAAKHP
FT                   ELFRGVVVIEPASAPADIGNAAQVPHLFVWGDYIGGSETWKGYRAQVDAYVAQLQDLGG
FT                   NVEIIDLPALGIVGNSHVPMMDSNSDQVADQVFDWIKRNDNELGEN"
FT   gene            complement(316800..317135)
FT                   /locus_tag="Mmwyl1_0269"
FT   CDS_pept        complement(316800..317135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69211"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY2"
FT                   /protein_id="ABR69211.1"
FT                   /translation="MPVIKIFYSETLDAAVREQNETIQAGLEHMMREVLQADPAKCQVV
FT                   FSCSTFVTPLPVYVDMQFRANEYRQGAVIETAMDKIVDVVGKALSTGIRIRAFAIDQST
FT                   LYARDVD"
FT   gene            complement(317145..318422)
FT                   /locus_tag="Mmwyl1_0270"
FT   CDS_pept        complement(317145..318422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0270"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG:
FT                   pau:PA14_68290 probable C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69212"
FT                   /db_xref="GOA:A6VRY3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY3"
FT                   /protein_id="ABR69212.1"
FT                   /translation="MEFLYVGVALLLALALGIPIYIVLGLLAAVMFYIEGTPLMALAQI
FT                   YVDHLDSITLLAIPFFIISATFMQRGGIAQALVDWANAWVGRFTGGLGIVCVTATTIFA
FT                   AISGSSVATAVAMGLIMVPAMLNQKYDRSFAVGLVGASGTLGILIPPSLAFIVFAIIAE
FT                   ESVPRLFLAGVIPGLIQAALFIAYSVWIAKRRNYPRQPSLPKDEFIAVNIRALPAIAVP
FT                   VVILGGIYSGIVTVSESAGIAALVSIIVSVLVYKGCGMKDIIPIIGDSMKSTISIVMII
FT                   ITALAFGHWLTKSGAPQNLADWVISLNLATWQFLIVINILFLVLGTFLEVFAIMLITLP
FT                   ILLPLLAPMGIDPIHFAVLMVINMELALLTPPIGLNIFVLSSITKTPVAETIKGVLPFM
FT                   VILLILLIAVTYIPSLSLWLPTLIYG"
FT   sig_peptide     complement(318336..318422)
FT                   /locus_tag="Mmwyl1_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.707 at
FT                   residue 29"
FT   gene            complement(318425..318946)
FT                   /locus_tag="Mmwyl1_0271"
FT   CDS_pept        complement(318425..318946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0271"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: mgm:Mmc1_2138 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69213"
FT                   /db_xref="GOA:A6VRY4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY4"
FT                   /protein_id="ABR69213.1"
FT                   /translation="MVIFATWLTRASRWLAGAVGACALLLLCAVVITRYFFPHAFPDWG
FT                   TEVIIYLTVWALFLSIGELALNAGHVNADFVVAQLSTKKQRALGVLATLMGLTFSVLFF
FT                   YQGYAVVEFAHMLGEEGDSTLRFPKWIYYLALPTGMALQCIAYLTRLWCELVDPNQLPS
FT                   TSHSDELLGD"
FT   sig_peptide     complement(318824..318946)
FT                   /locus_tag="Mmwyl1_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.450 at
FT                   residue 41"
FT   gene            complement(319001..320014)
FT                   /locus_tag="Mmwyl1_0272"
FT   CDS_pept        complement(319001..320014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0272"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: dde:Dde_0754 TRAP-type C4-dicarboxylate transport
FT                   system periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69214"
FT                   /db_xref="GOA:A6VRY5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY5"
FT                   /protein_id="ABR69214.1"
FT                   /translation="MKRFFTGLISACTLAVFTPLVFAADYQLDISLDTAPTHVRNVAMV
FT                   KFANELNKRSNGQLEVRVFHAAAQYKGANVPTALAQGAIDMGAPMHQHFSKIIPEAGTV
FT                   LLPMFYGASPEKIHGVWDGPAGDELNRLIEKKLRVKVIGRWFDLGYGTVFTTNKRLEKP
FT                   EDMDGMKIRVPGGAANVQRYKTFGANPVSIPLSDLPQALQRGTVDGIWSTQETVRSAKL
FT                   WESGIRYGFEDRQAYLQYVPMISLRSWNKYPTEIQNLITLTWNDMIDEVRYVATEHQLE
FT                   ARNIGTRNGIETVDPAPKSLENMRQRLLLGQPEVVEELGISKDFVAMVSAELDKLN"
FT   sig_peptide     complement(319943..320014)
FT                   /locus_tag="Mmwyl1_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            320187..321074
FT                   /locus_tag="Mmwyl1_0273"
FT   CDS_pept        320187..321074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0273"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pde:Pden_4118 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69215"
FT                   /db_xref="GOA:A6VRY6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY6"
FT                   /protein_id="ABR69215.1"
FT                   /translation="MTRAAKELNTTQSAVTQRMQRLESALNTSLMKRHSRGIEPTEQGK
FT                   ILLSYISRLNLLVDDAIAEIAAWEGSPVGAVSIGLPPSVSAVLTTPLIFAVKNSLPGVE
FT                   LTVAEAFSGYLEGWLETGEIDFAFVFNRTSTPQIEVTHLLCEELYLICNSELNSRLPDE
FT                   LEVKDLERIPLIAPSRRHGLRTEVQKEANKQGIDLNIVLEIDAGHQLIRQIELGLGAAI
FT                   LARSSVMPELTTGTLFNKRIVKPSFTRTVSLAVRRQKAESYLLKRVEEVLLKVVTELIQ
FT                   TDKWPADIYDQSTR"
FT   gene            complement(321156..321287)
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0274"
FT   gene            321652..322587
FT                   /locus_tag="Mmwyl1_0275"
FT   CDS_pept        321652..322587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRC0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69216"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY7"
FT                   /protein_id="ABR69216.1"
FT                   /translation="MKTRVYIDGYNFYFGCLKGTPYKWLDPVSLIETLLIRSGAPESVL
FT                   DELAVKFFTAEISERAASDSNSLNDQRAYHLALYNHSQDRLQTIKGNYSIDKTKFPKVE
FT                   LDERGKEKEPKFSERVKIWKMEEKQSDVNVALEAVYDAVTDLTLEHIVFVTNDTDIIPA
FT                   LRKIQSHNALKQRSPVKIGLIIPMRKSDSERKGNQSLKDFADWTIKYIHEEELQISQLP
FT                   CRVAGAKSAIKPVSWFKYPEKVEEILNTLSQKGVEGSVPKAWKWLERPLHHADGLENMK
FT                   GIPADLMDDEIALGIIHQHVKAYANYKKRS"
FT   gene            complement(323162..324658)
FT                   /locus_tag="Mmwyl1_0276"
FT   CDS_pept        complement(323162..324658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0276"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: dar:Daro_2666 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69217"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY8"
FT                   /protein_id="ABR69217.1"
FT                   /translation="MTNTSVGYAYLLKRTDIKALPLQVSARVMPVTKVQLIDNTLATPA
FT                   SLKPSDKILDHILFALKYEDLNLQILSQALLQVDESELLAVYESSPMGKYIRIACLLWE
FT                   HFHQQSLPRTTELTRGNYIPLLDPKRFITADNQTNKRWRVHVNVIGSLDYSIIVKRTER
FT                   LEKALAKNTLQKAKEFTDGLDDAMLNRALSWVYLSETKDSFAIEKEQPDTNKIQRYTNL
FT                   LRQAHIPRAIDEDYLAELQKATINNPYEWAVSYRNEQNYLSNGHGSIGVTYVPPSPNLC
FT                   RELMKEWEQLTNQLPEQVDPIVLGAVISFGFVFLHPFMDGNGRLSRFLFHHVLCRSGQL
FT                   ANGLLLPVSAVLHNKEREYLATLSAYSSGIRTFWQVDYLDAENYVFEFKGHESIYRHWD
FT                   GTACAELMAEACDEAMEHYIKQEVAYLNQYDALKRHINKLYDINDRTLSKLVVFCLEQS
FT                   GKISKKRRDQFQYEVPTDAFDALEQAYLEILFKEELDNTP"
FT   gene            325226..326236
FT                   /locus_tag="Mmwyl1_0277"
FT   CDS_pept        325226..326236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0277"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: sfu:Sfum_2600
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69218"
FT                   /db_xref="GOA:A6VRY9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRY9"
FT                   /protein_id="ABR69218.1"
FT                   /translation="MSLYCGIDLHSNNHVVVVIDEEDKKVVDKRIDNNLDATIELLAPF
FT                   KKQIKAVAIESTFNWYWLVDGLIEKDYQVDLVNTAAVKQYDGLKYSGDHQDAFHLAHLM
FT                   RLGILPTGHIYPPEFRQVRDLLRRRRQLVKQASSHMVSIQNQIWRSLGYRVSCADIRKA
FT                   NFELPFDVGSFLYHSAHSNLMMLKALDLQIDLIEQQTLSAVKLKDEFKLLTNVTGIGPI
FT                   LGLTILLETGDINRFSAAGNYASYCRCVNSIRESNGKKKGTGNRKAGNKYLSWAFSEAA
FT                   HYLVRFDKKAKRFYERKKQKRNGIVAIRAVAHKLARAVFHMLKNNQAFDIDRVFG"
FT   gene            complement(326809..327681)
FT                   /locus_tag="Mmwyl1_0278"
FT   CDS_pept        complement(326809..327681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69219"
FT                   /db_xref="GOA:A6VRZ0"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ0"
FT                   /protein_id="ABR69219.1"
FT                   /translation="MELVYIIIYIFLFSIIAFMIKEEDNLKPINLYLFKIKNLKNLIPF
FT                   MLCFIAISIIWTYNLSDIEIIKIEIAFILFLALIIFYLIMEFSFERIKWWLSLYFLSGG
FT                   IINYIASSFLTIYISEYSNVSVEKISTLINNATFIFFPYILLFYTAIILSFFSFFNFIY
FT                   LLIIWLSIKTKIFKYNEKSKKFRHSGLFIKGDNTLYLLLLMTTSSLTLFVLSIENRKGI
FT                   ESQTDNIITLFMSKNNGKCNSINNEKKIYFYESNRVIIYQEKSAVKFKDSICNIKTQIP
FT                   FDIIKSKQL"
FT   gene            complement(327708..328865)
FT                   /locus_tag="Mmwyl1_0279"
FT   CDS_pept        complement(327708..328865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69220"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ1"
FT                   /protein_id="ABR69220.1"
FT                   /translation="MNFNTINDLIRELDIDKNHWINKEALEFAKLKNYKNTSVTLKHIP
FT                   KWLLAKKFKCTNGHLFSPKWLEKRPPVSIFMDKNGNYLQQTSTDIICPICKVKLSLPLP
FT                   AAKFGGEISIFGDEAFRTSGGNLISVYSFVSFSGNSDSNNRFHREVVEIKKKNNLEIFH
FT                   LKDMDFEKQGLPISDFIKLIKKFNDSGDLNIYSSILITDNDKPQNKEKQKIQTHCFSAA
FT                   MLSIIQECTVHNLAPIFFFERTERDGWAKNFFKGARLNLSWAVITNGLPVGNPSFVIPE
FT                   TSPLLEVADLISYLVARKIYQVAERKKKRIVKLKFHPDSLGGIRYILSDKNRSFWKVYS
FT                   KKIPLNIILNGHEWEKEINKTELVNQKKIGLNDNFLYLHESQIPQ"
FT   gene            complement(328942..331692)
FT                   /locus_tag="Mmwyl1_0280"
FT   CDS_pept        complement(328942..331692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0280"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: vpa:VP0107 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69221"
FT                   /db_xref="GOA:A6VRZ2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ2"
FT                   /protein_id="ABR69221.1"
FT                   /translation="MVLVDGSSYLYRAFHAIPPMHTSDGQPTNATRGVISMIRSLIKTY
FT                   PDSPMVIIFDAKGKTFRDEIYSEYKAHRPPMPDDLRPQIEPIHRVVEAMGLPLVIVDGV
FT                   EADDVIGTIAKQVGEQGREVVVSTGDKDMAQLVTDKVTLVNTMNNTVMDIQGVKDKFGI
FT                   PPELIIDYLALMGDKVDNIPGVPGVGEKTALALLQGLGSIKDIYTRLDEIADLGFRGSK
FT                   TMKQKMEDNKEMAELSYTLATIKCDVELPFEPQELKNGEADKEKLREWFTKLEFKTWLS
FT                   DLDKAPSVETASDTVGNASSEQNGQVEIPVKSDLEANYETVLDKASFNKWLEKIQAAEL
FT                   VAFDTETTSLNYMAAELVGLSFSVEAGEAAYVPVAHDYEGAPEQLDRDWVLEQLKPWLE
FT                   DDSKAKVGQHLKYDANVLNNYQITLRGIAYDTMLESYVYNSVSSRHDMNTLASKFLGHT
FT                   CVSFEDIAGKGAKQKTFNQIDLEVAAFYAAEDADITLRLHQAIWPKIETTPELVSIFKD
FT                   IECPLIPVLAKMEQTGALIDPELLHAQSSEIAAKLQELEIKAHEEAGESFNLSSPKQLQ
FT                   VILFEKQGLPVIKKTPKGQPSTAEPILQELAQDYELPRLIMEHRSLSKLKSTYTDKLPE
FT                   MIQKTGRIHTSYHQAITATGRLSSTDPNLQNIPIRSAEGRRIRQAFIAPKGYKLVAADY
FT                   SQVELRIMAHLSQDSGLLDAFTKDADVHKATAAEVFEVSLDEVTTEQRRRAKAINFGLI
FT                   YGMSAFGLAKQLGIGRPEAGKYIKRYFERYPGVQQYMENTREGAKEKGYVETIYGRRLY
FT                   LPDIKAKNAMMRQAAERTAINAPMQGSAADIIKRAMIKMHDWLQGTDLDVKMIMQVHDE
FT                   LIFEVAEKDLEAAQKKIVDIMQNSSKIDVPLLVEAGVGDNWDEAH"
FT   gene            complement(331897..332298)
FT                   /locus_tag="Mmwyl1_0281"
FT   CDS_pept        complement(331897..332298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0281"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mav:MAV_1244 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69222"
FT                   /db_xref="GOA:A6VRZ3"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ3"
FT                   /protein_id="ABR69222.1"
FT                   /translation="MTLFSTRLIVNDIKKMVSFYEFISEREADWLAPVFAELKTEKAHL
FT                   AFGSIETVALFKEGCAEPSFNRTAILEFLVDDVDKEFERLENRVDLVHPPKDMPWGNRT
FT                   FQFRDPEGNLVSFFTPKTSEAKDRFNLGT"
FT   gene            332384..333079
FT                   /locus_tag="Mmwyl1_0282"
FT   CDS_pept        332384..333079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0282"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   bja:blr7851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69223"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ4"
FT                   /protein_id="ABR69223.1"
FT                   /translation="MRRADRLFQLIQILRRVNRPVTAAKLAEELEVSKRTVYRDIADLV
FT                   GQRVPIEGEAGLGYTLSEFYNMPPLMFTQDELEALVLGVQLVQSLPDKTIGNSAKDVYA
FT                   KIRDVIPPSFITTLSDAGVRIKPRELEPEKQDTRYLREAIRANKKIRITYSDRDENKSE
FT                   RVVWPIMLGYDEAYCLLIAWCEQRQQYRHFRVDRIRHMERLDISVPIAGNELRQRWELW
FT                   REQIFLNKR"
FT   gene            complement(333129..334217)
FT                   /locus_tag="Mmwyl1_0283"
FT   CDS_pept        complement(333129..334217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0283"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: sat:SYN_01324 response regulator
FT                   protein with GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69224"
FT                   /db_xref="GOA:A6VRZ5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ5"
FT                   /protein_id="ABR69224.1"
FT                   /translation="MMIYDDEKKITVSAVYRLLIASFLTSTAFAIFFNTYPTAHIIDSI
FT                   IPSIDAIVLLIVLIYYHYNPHTDINKIIVFYIIFFILTFSPSAIYYVFMAWNSEWRFVD
FT                   EYPPITGLMMAIIMLGIIMLPKRYKRYIVLMWASTALPIICYLLNHPEELQTPRGYELI
FT                   GTFGPASLLLYTVFPYQKSIRRHINKVTGDLRRYELEAGRDYLTDIYNRRGLDLWLGQL
FT                   NHDDKVAVLLIDVDHFKQINDRHGHSIGDRVLVEVASRLRTIYFEKHTIARWGGEEFAV
FT                   VLVNPKTNTLPFIGSMFQHALGTLPYKSVGKITVSVGVSSIAHHDNFLDLINQADKALY
FT                   TAKDNGRDQAVMYNRIHPQLAD"
FT   gene            334460..335422
FT                   /locus_tag="Mmwyl1_0284"
FT   CDS_pept        334460..335422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0284"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: aminoglycoside
FT                   phosphotransferase; KEGG: bbr:BB2102 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69225"
FT                   /db_xref="GOA:A6VRZ6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ6"
FT                   /protein_id="ABR69225.1"
FT                   /translation="MAVYTSLSDSDMRALVADYYLGELVSFQGISGGVENTNYFLTTTT
FT                   GKYVVTLFEEFDLDEVPYFLDVVAHLKHKGFNVPAALIDIHGERLREVNGRPTIIVDCF
FT                   PGGELKGTDETSCRLMGEALAKLHIAGEDFPVHRDSHRGVAWWHKTSQAIANELEPEQA
FT                   QLLLSQIAEFDAFIAQHPDLPKTTIHGDLFYNNTLFEGNKLSAIIDFYNACHSWVMYDL
FT                   AIVVNDWCSDMATGELDKAKYKALIKAYLHEREASPEEVLAWPFMLKIAALRFWLSRLE
FT                   AWHGAKHDPERLAQQHDPLEFQRILEARVRFTPSLVEFQ"
FT   gene            335479..336042
FT                   /locus_tag="Mmwyl1_0285"
FT   CDS_pept        335479..336042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0285"
FT                   /product="ABC-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: csa:Csal_3209 protein of unknown function
FT                   DUF1007"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69226"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ7"
FT                   /protein_id="ABR69226.1"
FT                   /translation="MRFLLCLCVTALFAGSAMAHPHVWVDSQYRVKVDQANVESLEATW
FT                   SLDLFTSTSLIAEYDVDGDGELKGQEKLDMIDVLKSFENYGFFIKMKQDGADFIPKGVR
FT                   ILDVRIRDQMLWIRLGIDLPTPVNLETSTLSLAFGDDELYFAMEPLEEGLVQLSGALAE
FT                   ICTPVEREATETSVAVWVDLTCRS"
FT   sig_peptide     335479..335538
FT                   /locus_tag="Mmwyl1_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            336083..336718
FT                   /locus_tag="Mmwyl1_0286"
FT   CDS_pept        336083..336718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0286"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   csa:Csal_2500 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69227"
FT                   /db_xref="GOA:A6VRZ8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ8"
FT                   /protein_id="ABR69227.1"
FT                   /translation="MLEHFQWLPFLAAITVLTMSPGVDTILVMRNAASGGWRLGFLTSL
FT                   GICMGLFAHATVSALGLSVILLGSAGLFTAFKLVGAAYLVYLGVQAIRSAMNPVGMTFK
FT                   DAKNPKSLTSWGSFRQGVLSNVLNPKPIIFYMAFLPQFIDPSHSALAQSLFMASLHFVI
FT                   AMVWQTFLALMVHKARVWLARPKVAFVLDGLTGVLLLGFGVKLALSQR"
FT   gene            complement(336742..337287)
FT                   /locus_tag="Mmwyl1_0287"
FT   CDS_pept        complement(336742..337287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0287"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: psp:PSPPH_2905 transcriptional regulatory
FT                   protein NfxB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69228"
FT                   /db_xref="GOA:A6VRZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VRZ9"
FT                   /protein_id="ABR69228.1"
FT                   /translation="MTEHETNNTLLNSLALALVEHPRASLQELACAIGVSKATLYRFCR
FT                   TRENLIERLIQRSIESYQEAIRDADLDTAEPREGIRRLLENYYMNKELTIFIIQYWQPE
FT                   LLENGECLKAQEKIDAFFLRGQQSGHFRVDISAAAIAECFHGLFFAMIEAERLGRVPRT
FT                   RVLTIIELILLEGASTAS"
FT   gene            337522..338667
FT                   /locus_tag="Mmwyl1_0288"
FT   CDS_pept        337522..338667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0288"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pen:PSEEN3125 multidrug efflux RND membrane fusion protein
FT                   MexC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69229"
FT                   /db_xref="GOA:A6VS00"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS00"
FT                   /protein_id="ABR69229.1"
FT                   /translation="MVRILKNGRALLPVLAVLFAVSGCTSSEPEAQASPPPSVRAATVI
FT                   TVQPIEYEENAILPGRIEPIREAEVRARVPGIVLHRTFIEGSDVKAGDVLFEIDPASLK
FT                   IALASSKGKLAMAEATLFDAKMLVDRYAPLLKSQAVSKQTFDAAQAAYLSASASVASAK
FT                   ADVANAELNLEYATVRAPISGRIGRANVSEGMLVGQNDTTLLATIQQLDSVYIDFTQSV
FT                   TDTLKYRQSVEDGTSANSTKLMAKLDGYNKSFEGKLLFSDSQVDEKTGNVVLRGLFPNP
FT                   NKVLLPGMYVRVEAVQSHSDKAILIPQRAVMRGNGGHAFVYVVNSQNAVESRSVVTGSM
FT                   SQNLWRITEGLNAGDKVIIDNAAMYQAGEKVTASVNVASNT"
FT   sig_peptide     337522..337605
FT                   /locus_tag="Mmwyl1_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.621 at
FT                   residue 28"
FT   gene            338719..341823
FT                   /locus_tag="Mmwyl1_0289"
FT   CDS_pept        338719..341823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0289"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   pst:PSPTO_2592 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69230"
FT                   /db_xref="GOA:A6VS01"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS01"
FT                   /protein_id="ABR69230.1"
FT                   /translation="MSNFFIARPNFAWVMAIFILLAGLLALPTLPVSQFPVVAPPQVEI
FT                   TATYPGASAQVLVDSVTSVIEEELNGAKGLLYFDSSSNANGIAQITASFEPGTDPDLAQ
FT                   VDIQNRLKKAEARLPSSVIAQGVQVDQASSGFLMIYALTFKGDDSSKSIIALADYAARN
FT                   INNNIRRVKGVGKLQYFGTEAAMRVWVSPEKLLSYGLSIGDINNAIRNQNVQVPAGSFG
FT                   GRPADDAQELTASLVVKGFLEDPEEFGNIVLRSNVDGSAVYLKDVARVELGKQDYNFET
FT                   RLNGHKAIMGAVQLSPGANAIETVKAIKARAAELEANFPDDIQISFPYDTSKFVSAAIE
FT                   KVIYTLIEAIVLVFLVMLLFLQNLRYTLIPTIVVPVCILGTFAVMSLMGFSVNMMTMFG
FT                   MVLAIGILVDDAIVVVENVERIMVEEGLPPKDATIKAMGQVSGAIVGITLVLSAVFVPL
FT                   AFMSGSVGIIYQQFSMSLAVSIMLSGILALTFTPALCATLLKPINKEAHHEKGGFFGWF
FT                   NRKFARLTHRYSILNGMLVNRSGRFMLVYLVLIIGLGYAYLRLPESFVPTEDQGYMIVD
FT                   LQLPAGATFSRTNETMKDAEKFLGQRDAVENVVTVMGFSFSGMGANAGLLFPTFTDWSD
FT                   RQQSLFDETMAYNQFAGSITDGRSMAVEPPSIEGMGNSGGFSLRLQDRSNLGREALTNA
FT                   RNIVLGQANASPIIAYAMMEGLEDAPQLRINIDRQKATALGVGFESINNAVSTAYGSAS
FT                   VNDFTNAGRLQRVVVQADVADRMTPERVLELQVLNDEGNLVPMRSFASSSWEIGPVQVS
FT                   RYNGYPTYKISGSPMPGHSSGEAMAEIERIISTLPKGIGYEWTGLSYQEKAAGSQAPML
FT                   LTISILVVFLLLVALYESWSIPFSVILIIPIGALGAVAAVYLMGMSNDVYFKVGLITII
FT                   GLSAKNAILIVEFAKDLYQQGHSLKESAIQAAKLRFRPIIMTSMAFILGVVPLTIATGA
FT                   GAASQHSLGVSVIGGMISATVLGVLFVPVFFTWVLGRFKASNKTV"
FT   sig_peptide     338719..338823
FT                   /locus_tag="Mmwyl1_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.560 at
FT                   residue 35"
FT   gene            342146..342766
FT                   /locus_tag="Mmwyl1_0290"
FT   CDS_pept        342146..342766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0290"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: maq:Maqu_3814 multiple antibiotic resistance
FT                   (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69231"
FT                   /db_xref="GOA:A6VS02"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS02"
FT                   /protein_id="ABR69231.1"
FT                   /translation="MSLLISTWIKFFFLFAPFFVLSMFLALTRGESSASRRQVANKAII
FT                   ASVAISLVLLFFGGSLFAVLGITLDSFRIGSGILLFMSALSLVRDGTRNHAVGMPSEER
FT                   DDVSVVPLAVPTIIGPATIGTILVYGAELQGWDLFIGLCGLLLALGTLAIILYSGSLIE
FT                   KMLGRTGLNVLSKITGLILAAMAAQIFMSGVMGFLHPVTSTIS"
FT   sig_peptide     342146..342232
FT                   /locus_tag="Mmwyl1_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.423 at
FT                   residue 29"
FT   gene            342882..343841
FT                   /locus_tag="Mmwyl1_0291"
FT   CDS_pept        342882..343841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0291"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   bja:bll7754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69232"
FT                   /db_xref="GOA:A6VS03"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS03"
FT                   /protein_id="ABR69232.1"
FT                   /translation="MAKNVAFLLLSFLCLNSPLYAAIDFALYQDFIQWIISQQAIFHRE
FT                   LVSLVRSISKGGSPVLLWGLISTSFFYGVFHAAGPGHGKAVISAYMLASKAPLRRGISL
FT                   AFLCAGVQAVMAVLVIVVLSQVFSLAGKAMQISRFFEVASFTAVGLIGVWILLRLLRGQ
FT                   SGCGHDHSQDHLEEHHHDHSAEHHDHSHEHSHGHACCSHHKDEAKTARRSIWAMVAAVG
FT                   IRPCTGAILVLLFSLSTGIFVWGLVATFAMALGTAITVAALAGVSVFVRDTGFALSSEH
FT                   RVWRQRVSRTFGFLAAFALIIISTSMIWSYVSNAGRAF"
FT   sig_peptide     342882..342947
FT                   /locus_tag="Mmwyl1_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 22"
FT   gene            343841..344365
FT                   /locus_tag="Mmwyl1_0292"
FT   CDS_pept        343841..344365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0292"
FT                   /product="putative ferric uptake regulator, Fur family"
FT                   /note="KEGG: pen:PSEEN0072 transcriptional repressor of Zn
FT                   transport system Zur"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69233"
FT                   /db_xref="GOA:A6VS04"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS04"
FT                   /protein_id="ABR69233.1"
FT                   /translation="MKHEDSHQHSQQDSHQHSHHNHNDCIDTALETAETLCAEQGQRLT
FT                   KVRRRALELIWESHRPLGAYQLLAKLAEEGFNSAPPTVYRALDFLLSAGLIHKVESMNA
FT                   YLGCAHADKAHKGYFLICDECHNVMEFDYQDIHAALIEKAAHQGFELRAETIELTGLCA
FT                   KCKEKSAGANA"
FT   gene            344362..345138
FT                   /locus_tag="Mmwyl1_0293"
FT   CDS_pept        344362..345138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0293"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pfl:PFL_0077 zinc ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69234"
FT                   /db_xref="GOA:A6VS05"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS05"
FT                   /protein_id="ABR69234.1"
FT                   /translation="MNKRLVAFDKIGISFDGRVLLENIDMTISEGEIVTLIGPNGSGKS
FT                   TLIRTLLGLQEATSGEIVRHKTLRIGYMPQKLHIDPTLPLTVKHFLALVRGVDKQQILP
FT                   TLEKLGIGHLLKSQVHVLSGGETQRVLLARALLNRPNLLVLDEPVQGVDVNGQVELYNL
FT                   IENIRNELNCGVLMVSHDLHLVMAKTDTVVCINQHVCCSGSPQHVTGHPAYQALFGVPG
FT                   ADESIAIYAHQHDHVHDEHGSILSDDGDAHVHCKHH"
FT   gene            345178..345969
FT                   /locus_tag="Mmwyl1_0294"
FT   CDS_pept        345178..345969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0294"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: ppr:PBPRA1053 putative
FT                   ABC-type Mn2+/Zn2+ transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69235"
FT                   /db_xref="GOA:A6VS06"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS06"
FT                   /protein_id="ABR69235.1"
FT                   /translation="MLDLLLRALLGGLGVAAVAGPLGAFVVWRRMAYFGDTLAHSALLG
FT                   VALGFLLDINLNLAIIVLCVGLALVLVTLQKKHIIATDTLLGILAHSALSLGLVAVSFL
FT                   DNIRIDLMAYLFGDLLAISQTDVYWIYGGGLAVITLLVAFWKPLLAVTVNEELAKVEGY
FT                   PVEAIRLLLMLLVALVIAVAMKIVGVLLITSLMIIPAATARKLSSTPVQMASFASLIGC
FT                   LAVCSGLWASYRWDTPTGPSVVVCAALLFLIAYTLPFKRLR"
FT   sig_peptide     345178..345252
FT                   /locus_tag="Mmwyl1_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.494 at
FT                   residue 25"
FT   gene            346155..347741
FT                   /locus_tag="Mmwyl1_0295"
FT   CDS_pept        346155..347741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69236"
FT                   /db_xref="GOA:A6VS07"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS07"
FT                   /protein_id="ABR69236.1"
FT                   /translation="MKVAIVKNWFGKFIAAMRPSKEITAFYQDEAGAVLPFAVLIIVGG
FT                   VIAVSFAVDTTRMVNSSAQLKRATDVAALAIGNIQLTNGNDDDVDLQKIASGYVLSNLG
FT                   MDSGLINQIEAEQVTVTKGEVDGSPTYKVSVSLIAQSDLLKAGGQEQVIFSTVEVVSRP
FT                   TEVALILPNSGTEDRGELAALRKVSKEFARNLLGDESAGVSPTQKVWLSLVPFSQSVNV
FT                   YDESDPDRINRWAAFGELNPPELRSLFRTGKARSLADPRFPDRKANLLCVHRGLSAGQN
FT                   FFWDQPPSGQFEIYYRHDLPENGSPGAPPISWVGPNPDFPDTQAEDTRWIVADKGCPDA
FT                   ALLPLTDNLAEIDARLDKMSTRFNVNYAIAMSWAGAALSPNMRGGAGWGNNELPLDFSL
FT                   DGNNVKVIVMLVNTIGDWFDTDAYNFNDGETTNDSMAFARQRFSDLCRDFNSKNIKFFF
FT                   IGVRPGDPEDWGRTLFADVAGPGLRECASGDGNFHFADASNFSEGQSQISSSLEKIADD
FT                   IRRNYYARLIE"
FT   gene            347787..352886
FT                   /locus_tag="Mmwyl1_0296"
FT   CDS_pept        347787..352886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0296"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; Two component regulator
FT                   propeller; KEGG: eca:ECA0799 putative outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69237"
FT                   /db_xref="GOA:A6VS08"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS08"
FT                   /protein_id="ABR69237.1"
FT                   /translation="MLFPKKIRSSQALALEPRMMFDAAALGQLTETLPDTPDASVTDAD
FT                   NTSQTVVATDEAPVLEVDPTTIEYVGKVKDRDTNVYADVLASARDVAVSADGKYVYAVS
FT                   TNSDSNNSNSPSVLSIFSVDESGELTLLKGYYNYDNSDKSVQNEGLAGASIVGLSEDQN
FT                   YLYVFGEGDNSLVVFSRDADSGELTFVGNTDVSAFGVNGVSDFVYDIEESNGYLYVAGA
FT                   DSLIVLSIGDEGTLSQISNYTNGTNGVEGLTGANSIAISADGNTLVVGSSGEDSVVALF
FT                   SVNENGSLDYVSSVSGDSDAYYIQSVAVSSDGKTVYALNENQGATLLVMTYDDNGVLVV
FT                   TGTYDTSEEARTILLSEDGTGVFVMGASIDIFALNNATLTKVSSVEGSFNNEDFYFNSI
FT                   TQAYLSADNTKLFAVVNNAILTFELSIPVALYTENADATPLLPTGRISDSELDELDDYK
FT                   GASYTVVRESGALLEDAFSFQDGNNLELKDGKILNDGVEIASFEVVDNALTVVFTAAAN
FT                   QATAQNVLRQIAYSNSSNDPVANGASPTFVITINDGDGNKTSLDVNVDLTGVNNPAVVT
FT                   TTPAQLTYKTGDDYTTPLFSGTSIDTIEEGQKIAQVVLTITGASADDVIRVGTGKILMA
FT                   NVDSFVSTPEGVEYRVSVDGDVVRVTLYMQRSAAETAGIIDNITYKYEGDEVTGEREIT
FT                   LSIVEYEDYNLDGNSSREELTTTYTERAVITLAAATVNNVAPVLSGNAVTIPYTENDPA
FT                   FTVFPNATLSDVQMDAYNGGSGSYHGAVLTIATGGASPNDVLSFSDGNGLSLNKGTELV
FT                   KDGKVIGEVLVSDGLLTVTFTENNGVIPTTEDVTNVLNQIQYRSSSDTPPSSMIISATL
FT                   TDQLGLISNALTRQIDITTVNDAPAVVIDPVLVAGDMDLIDIIDSVTGIDTVVASTVSG
FT                   DGSIFYVADGDGNIVAFSQDADSGKWLQVGTLTIDGLNSVDKLIATSDGKSLYVIGSHD
FT                   VPSGWGDTMMSVNTVIVITRDSINNELTETQKITGESTLNTITDLALSDDGQNVYYLHN
FT                   GGLGIMKRDALTGTLTFDSSISDIEDGEEKRNIGSPSSLIVSGNYVFLTTESGYQKPSA
FT                   LFVFERTSSGLSLVGYIENYAVDSNGAIAKLDSPSHIAATEGGEYVYVVNGNSLASYSY
FT                   DSVTKSFSVVDTNVLTFENVTDMVMSDNDKELFISTSDGTLNRYVITDKGGLILVDAPK
FT                   EVTNGKTITVTEDGLVFLQGDSVAIFDAPGRETSNYEIGFEAVALAPTLAIYDAEFSAV
FT                   DNYKGLTFSIQSTSPNADDVFNILSDSGFSIQGGNLFFNDALVGTFTADNGVLSVAITD
FT                   DLTQNQVNTLVQNVSYENSSLTEAITQTFIVSTNDGEINGIELQAELNVVRNSIPEAIG
FT                   GYVMPSIMETAPTSILLPEGLFVDAGGDPLAWSVSGLPSGLTFDPLTRTISGRTSETGN
FT                   FTLTFTATDPRQQSASLELSLVVGRLPVVDHSSDENDAFISSTATRPSPFINEIGSTLA
FT                   QGGLDSLLSTTLHSGSAFDSFSANDLRMTSLSRENADSDSQSDAQSPLPMETYRFTSLT
FT                   WFGGDSKATISLLESVLSSEEKTILAVTLADGVSLPDGVEFDADTGELTINKAVLEATD
FT                   QIELHILVVDEQGNASVVPVEVTLQAAQQASAVPFAKQVKNAGLMSLSDDSQALLAELS
FT                   VN"
FT   gene            353003..354616
FT                   /locus_tag="Mmwyl1_0297"
FT   CDS_pept        353003..354616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0297"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   eca:ECA0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69238"
FT                   /db_xref="GOA:A6VS09"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS09"
FT                   /protein_id="ABR69238.1"
FT                   /translation="MLALTACSVTPTPMTFDQKLALVESDRAAMFKNQEPVVKPITLEE
FT                   AMARAVKYNLQERLALMEKLAQDNILGLKSFDMLPQVAASAGWKTRNNEAASSSKSIAT
FT                   GQESLVSSTSQDKTTNSADLSVSWNILDFGIGYFGSKAQANNVLAAEERRRSVVADIIQ
FT                   NVRGAYWDAMTAQQLQPVVKRTLKDAYAALETSKKTGAERLISPLESLKYQKSLLEMIS
FT                   RLETLEGDLATSKSRLAGLMNLPPSTRYELAEQDALPTDMRYSLDDLEALAMVNRPEIN
FT                   EEAYQARNVALETRSALTRLLPGASLFVGAHYNSNSYSMNKDWADAGVQVSWNLLGAFS
FT                   YSDIKRVGEVKQSVADLRRQALRMAVLTQVNIAWQQYKQANNQYQRASELSRIQNAILT
FT                   QSTGAYQNNTQSLVERVRIATESVLANRSRDRSFSAMQSSYGAIYQAAGLDPLPKEIVG
FT                   TSVAALSGSIAQQDNLLKQGKITQATLFSKDVLAEQYPSMVDGYKKNSSSQSASIQRVV
FT                   LENRGSLQEVSVTDYTDYSQ"
FT   gene            354613..355428
FT                   /locus_tag="Mmwyl1_0298"
FT   CDS_pept        354613..355428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0298"
FT                   /product="Membrane-fusion protein-like protein"
FT                   /note="KEGG: eca:ECA0801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69239"
FT                   /db_xref="GOA:A6VS10"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS10"
FT                   /protein_id="ABR69239.1"
FT                   /translation="MIMTLVAWCRAKSFACLLGLGGVFALPSSFANEVYTESGMADNHA
FT                   IRVQLKAQDKMVLSSQLSGRIETLVWKEGQSFKKGQQLVAFDCGIYKAKLDYAIAAETT
FT                   AQKKHAIAQRLDNLQSISVLDVSQAESDFIMAEVERKIGEVMVKRCAIAAPFSGRVSKR
FT                   LVEQGEFVSEGEPLLEIYNTSAYEVELIAPSRWISRVNIGDTFTVQLDETNQEYEARVT
FT                   RLGSVIDPLSQSFSVFGQIFSKSKALLLPGMSGSALFSYSTVSEGNTAQ"
FT   sig_peptide     354613..354708
FT                   /locus_tag="Mmwyl1_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 32"
FT   gene            355425..356777
FT                   /locus_tag="Mmwyl1_0299"
FT   CDS_pept        355425..356777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69240"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS11"
FT                   /protein_id="ABR69240.1"
FT                   /translation="MTTFSSTPLATEVTTEHALLNVLQLEVKARSAQSLDELQFIALNE
FT                   TRLLLSYDQSLLWDAQSGKLVGASGLVDIDANAPFCTWANGVFKGISQTDKAQRIHTID
FT                   PTQLAFDDAARFADYFSARLIWLPIQNANGDLIASLLLSKEQELNLREKKLLSFLLNAY
FT                   GHAWQSFIRQRRHFFKNKSWRWWAVGGSMLAGLLCIPIQQSVIAPAEIVPQQPNILRAP
FT                   IKGIVRELTVRPNDTVVAGQVVARLDAKELQQQLETARQTYAISRAELRMAQQQSFIDE
FT                   QRKAALAVLEGRQVQAQLDMTYLQQQLTRTEIVAPYDGVVIFDNQGDWLGKPLALGDPI
FT                   MTIADPNKTELEIRLPLQDVIELEIGSSLKLFLNSDPANSVAAELVKIAYKASPTEDGQ
FT                   YALQLKGRFTDSVHSLRLGKKGVAKLYGEYTTLFYYLFRKPLSELRIWLAW"
FT   gene            356771..358930
FT                   /locus_tag="Mmwyl1_0300"
FT   CDS_pept        356771..358930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69241"
FT                   /db_xref="GOA:A6VS12"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS12"
FT                   /protein_id="ABR69241.1"
FT                   /translation="MVDVASVLEREKVKEESLGELRNELRLFEGPTDRDGAPTWTLEDP
FT                   LSGQFYRLGWPEMEMLARWSLASSAAIVEDIRRHLTLDIDLQDVKTFYAFLSRHHLLKN
FT                   HSNDAVQQLADAKTQRQLSPLRWLLKHYLFFRVPLCRPDAFLEKTLPIARFFVSPIFLF
FT                   LSLLVLLVGGFLVSRQWGAFTHTFLHFFSFEGAVMMALALSLTKMLHELGHAYTCKYFG
FT                   GRVATMGVALLVLWPVLYTDTTSSWRLKNRRQRMLIGAAGVMVEMVVGAWAILLWSFLP
FT                   DGVWRSLAFMLGTSTWLLSLLVNLSPFMRFDGYFLLSDLLGIANLQQRAFAFTRWQLRE
FT                   WLFGFKDAAPEVFSSAMQRVLLLYSFVTWVYRLFLFIGIALMVYHFAFKLLGIFLFIVE
FT                   MAVFVVSPIMREVKEWYLRRSRLSWNKHTLFSAGLLILIIGLLFIPWRGEVIAYGVLRA
FT                   KQESRIYVPEGACLQTVFVSAGENVKQGQVLYLFSSPELEQERDVLESRITTLRKQIEV
FT                   NQFDRHVSANLQMIREELYASSKRLATLFEQIESLSIRAPFDGVMAEVSDQFQEGSWLS
FT                   SGAWLGTLIGVQGNWLEAFVDEVDVGRIQQGNDAHFIPENISYSVLPARLMSIEDTGLS
FT                   YLSSAPELASVYGGPIASLKGKGSDGVPRSENVLYRIFMSLEDKSIEQAGFVIRGKVVM
FT                   EATSQSIASRLWTRVVSVFVRESSF"
FT   gene            complement(358927..360303)
FT                   /locus_tag="Mmwyl1_0301"
FT   CDS_pept        complement(358927..360303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0301"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: eca:ECA0786 two component
FT                   system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69242"
FT                   /db_xref="GOA:A6VS13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS13"
FT                   /protein_id="ABR69242.1"
FT                   /translation="MFIKPLLHSSSFRQAATIAFICLLISSASVFICDYVLDNIMKSHV
FT                   RGMIFENIENQTLKTAFSSSNELAEKLKNENKKEVRKDHFTFIFDENGRILSDNSQYIS
FT                   NQHITTLQQNNINPPSIISLENNDMELLGLLVPLADGGMYFNAYNIQPMIQQTRIIPLM
FT                   TGAGLLAIQLMILLISLPFSLHNLYRVNHIIEALEHYARGKHSVRVDYKNNGDEFGQLG
FT                   QEINLVLGRTQRLMGEVRDITSHVAHELRTPLTRLQHKLINISERVEGEELKELEQAIK
FT                   ETEQIQVLFRSIMRLSEVETGQVSHQKNKINAYEILHEVYEYYQPLAENYDIQLAIEAS
FT                   KKHFFYADKILIFQAIANLLDNAIKYAPESKVITLSIDSSLGNTFIKVTDQGKGIPDES
FT                   LEFVTQRFKRLSSKSDVFGHGLGLTLIRAIASLHNGELILSNAQLGLCACLKLNSNEIN
FT                   "
FT   sig_peptide     complement(360211..360303)
FT                   /locus_tag="Mmwyl1_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.480 at
FT                   residue 31"
FT   gene            complement(360308..360973)
FT                   /locus_tag="Mmwyl1_0302"
FT   CDS_pept        complement(360308..360973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0302"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: eca:ECA0785 two component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69243"
FT                   /db_xref="GOA:A6VS14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS14"
FT                   /protein_id="ABR69243.1"
FT                   /translation="MRILVVEDDASVSHWISSKLHVSGHTCKLVDNGEDALKLVKEEVF
FT                   DVILLDRIIPKIDGIQLLGLLEDLPHPPVLILSANDQTSDRIEGLRAGADDYLGKPFDF
FT                   TELLLRLERLYCRTKKVASSNFIKIKDMMINLELHEVTRSGQRIDLTNKEFKLLYVLAE
FT                   HPGQTVTRSMLLEKAWGYHFDPQTNILDVHLSKLRHKLDGDSKNPIIRTIRSVGYALG"
FT   gene            361358..361555
FT                   /locus_tag="Mmwyl1_0303"
FT   CDS_pept        361358..361555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0303"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: vvy:VV2013
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69244"
FT                   /db_xref="GOA:A6VS15"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS15"
FT                   /protein_id="ABR69244.1"
FT                   /translation="MKASVRRFLSDERGVTAIEYGILAAAMAAAIGVIFGSDGVFVTAL
FT                   KERFSSIADQITNTSNPGAE"
FT   gene            361570..362130
FT                   /locus_tag="Mmwyl1_0304"
FT   CDS_pept        361570..362130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0304"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   eca:ECA0787 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69245"
FT                   /db_xref="GOA:A6VS16"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS16"
FT                   /protein_id="ABR69245.1"
FT                   /translation="MTDLLISSVLMFTSVWVILTDLFYRRIHNILIVGLLLGWCGIAIL
FT                   SFWSVGPYSNIHSGDLLSYLGYSIAGAAGVLIVGFGLFLIGQMGAGDVKLMSVLCLWVG
FT                   YDNQLVFLVVTALVGGMLALLMPVLSLLEIAGAKVIVQISSRFPRLKIPAPLVFSREGV
FT                   KGLPYGLAISGGAFYLLISPFSH"
FT   gene            362149..363078
FT                   /locus_tag="Mmwyl1_0305"
FT   CDS_pept        362149..363078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0305"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: eca:ECA0788
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69246"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS17"
FT                   /protein_id="ABR69246.1"
FT                   /translation="MKVSSVFFISGALVFAIGGALLVRVLASTPPPPAPVVKAAPAPKP
FT                   VFTPVLAASKDLVPGDFIDNSAVQWLAVDKQYESHSYFLKGVDQVDAVFGATVREPVAK
FT                   GDVLGSRVVVLPGDAGFIASVLESGMRAVAIPADAVTSNAGLVSAGDRVDVVLGLKRDQ
FT                   ENGGEADPMASIELPKLASQTLLRNVRVLALNDAVEEMAKEKPTEEKSGAKKRKFYETV
FT                   TLEVFPKDVERLTVAREIGVLQLALRSVRNEMLVGSSDENRIAARDEVTTLGQVTDIYD
FT                   SFKPRKNAEKSSVVMFRGESKEVSEFAN"
FT   sig_peptide     362149..362232
FT                   /locus_tag="Mmwyl1_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.951 at
FT                   residue 28"
FT   gene            363126..364517
FT                   /locus_tag="Mmwyl1_0306"
FT   CDS_pept        363126..364517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0306"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: eca:ECA0789 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69247"
FT                   /db_xref="GOA:A6VS18"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS18"
FT                   /protein_id="ABR69247.1"
FT                   /translation="MSFKCNLLVVPLLFGVFLLSGVSRAAYLEPMNNTSESQSVIGTSA
FT                   YQQVEVSGNVNLVVNRGKLLTLPQNAAKVLIANPDIASFQMPSPDNVFVFAKKSGSTSL
FT                   YALDDENQVILALTLNAGYDLNSLTKQVAQEVPGSNVQVGPATENGLIVRGSVQTPQQA
FT                   KRVIDSVEAFVGGDATGSAGAGSQTLRIVNQLKVELSSQINISVRIVEVSRNLSSSLGF
FT                   SWDALFDNGKYFARNSASLFDATTGAFTGSGVTNAVFGGASGNLGGVLSALSNDGLASI
FT                   LAEPNLTAMSGETAGFAVGGEVPIVIITNNNVTIEYKQYGVIMRMTPTLLSPNRISLHI
FT                   APEVSDLTEEGAVELQGLTVPAFKVRRADTTVELASGQSFALAGMLRSSVSQTVTGVPG
FT                   LRSIPGLGRLFESETNQKEETELVIIATAYVVAPTSSGDLQTPAKGISTIDAHLPPLAS
FT                   AGYLY"
FT   sig_peptide     363126..363203
FT                   /locus_tag="Mmwyl1_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.945 at
FT                   residue 26"
FT   gene            364536..365180
FT                   /locus_tag="Mmwyl1_0307"
FT   CDS_pept        364536..365180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0307"
FT                   /product="pilus (Caulobacter type) biogenesis lipoprotein
FT                   CpaD"
FT                   /note="TIGRFAM: pilus (Caulobacter type) biogenesis
FT                   lipoprotein CpaD; KEGG: eca:ECA0790 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69248"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS19"
FT                   /protein_id="ABR69248.1"
FT                   /translation="MRIITFTIAILVLLSGCDRTVHQLRNGPDSSMRQNESFSVKPTAS
FT                   SISLKVRPSGSLTSSSLSGLNSLLKNQGRLSNQTIRIQPLSEQGEQFAQRLGQSLLELG
FT                   VQGESLLIQPLVYQKAETTWDLSVVSEAIIVVTPDCVIEDSTTWSVKPFDAVGTLGCAN
FT                   RSNIARMVVNPRDLIRARTLDSADGINAVGAVKRYHEADIIPLLDIDFNED"
FT   gene            365195..366439
FT                   /locus_tag="Mmwyl1_0308"
FT   CDS_pept        365195..366439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0308"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: eca:ECA0791
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69249"
FT                   /db_xref="GOA:A6VS20"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS20"
FT                   /protein_id="ABR69249.1"
FT                   /translation="MSDSNQKQNNESQFLAIFAADSAQVKQFGDSLSRLGYSSDRVFLG
FT                   GVEAAESWVKEHAIPSLLFVDIDNEVATLVSISALIELCGPTCKIVAFGSEQSIDLYRA
FT                   LLSNGVFDYLLKPIPLDMISAVIQRAERGKVDDATTGRTIAVTGTSGGVGASLVSLGLA
FT                   QSLSKKRHMMTALVDFDRKNGSLGLMLGYNGDAGLGSALSAENIDARLLGRSIGKVDTR
FT                   LSLVAQVPDFHAEELVDSYPALVLGSSLCRMFNQVIWDLPSAKPFGSMDVLAHAQTRII
FT                   VTDFTVADARNTLRLLNEIGDESSGQRIFLVRNSSKHMDKEFISQKEFEEFIGCKIDMV
FT                   LPYAGSGLGSSLLQGKLSLEAFPDFALGLLNLADMACGKLPQQSIKKSSALSALLRRLL
FT                   RTNKSPEMTLKGGRL"
FT   gene            366436..367803
FT                   /locus_tag="Mmwyl1_0309"
FT   CDS_pept        366436..367803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0309"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: eca:ECA0792 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69250"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS21"
FT                   /protein_id="ABR69250.1"
FT                   /translation="MIINHVPRAKTAAQRVSATEVMAPEESSSKKSARQTSLQNNGDTL
FT                   SLKNKRLIREQLYEQIDPVKASTLSHDSLNHQIEMMIRSICDTNRLQLSQDDEQAICRE
FT                   MFHEMVGIGPIEPLLADDSVNDILVNGAGQVFVERYGKLELSNIRFIDEEHVLNIAQRI
FT                   AAAVGRRIDETQPMVDARLADGSRVNIITYPLAIDGTTISIRKFMRRNMSLEILEQRGA
FT                   LSNDMVDVLRRAMQGKLNIIVSGGTGAGKTTLLNALSQKISNEDRIITIEDAAELQLQQ
FT                   VHVVRLETRPVSAEGTGKVDQRDLVRNALRMRPDRIILGEVRGGESFDMLQAMNTGHDG
FT                   SLCTVHSNTPRDAIMRLENMVMMASMQLPLEAIRRQIASAVDLIVQVERMRDGSRRIVS
FT                   ITEVCGMEDDVIQTQELFAFETDSIDGQGRVSGRFVSSGQRPSFYTTHSHYFDEAV"
FT   gene            367804..368793
FT                   /locus_tag="Mmwyl1_0310"
FT   CDS_pept        367804..368793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0310"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   eca:ECA0793 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69251"
FT                   /db_xref="GOA:A6VS22"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS22"
FT                   /protein_id="ABR69251.1"
FT                   /translation="MSDVINLLSLLVFLSIGCFFLFLRSINGKRKQEQRSKQYLQSLKQ
FT                   QVLDESSLSESLELDSVSRQVEVFLWSKTPIIGAWLERFWMDLSLLGWQEKCRTRAMML
FT                   AGPCFLLGFTLAKDSLSPFLLSLVLSVVFFFCAVLVLYRNAMAKHLKEFKQNLPQAIDS
FT                   IVRIARAGVPVSNAFNLVAENLPGPLAKEFSLVDKWLRLGVPLRQAMQDSAKRVPLNEY
FT                   RFFVVILIINQEAGGRLSDTLERLAHTLRERQELALKIRAKTSEVRASAVIVASLAPLS
FT                   LAYMYLNSPKDFQFLLNDSTGNNVLFYAFGSVLLGLSITHFMIKRVIR"
FT   gene            368790..369740
FT                   /locus_tag="Mmwyl1_0311"
FT   CDS_pept        368790..369740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0311"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   eca:ECA0794 putative type IV pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69252"
FT                   /db_xref="GOA:A6VS23"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS23"
FT                   /protein_id="ABR69252.1"
FT                   /translation="MTNDMMFPVLAGIFLCTTGLVLLGLYFRTKPKTLADRLQSSGIMD
FT                   KDILQVEAVLLSQNDERRKLQKWLQPLDRIGQELAGTESDKFATRKLLLMAGFRRQNAL
FT                   GVFTFCKFSLGIICILLFLFGVLESGNRLSLNGLAGSLMLLFFGSFAAEVWLKMRAASR
FT                   GGRLSSSLPDALDLMVICAEAGLPLGRIFKTVSKELAFSAPEIAEELGYTHAELQILSD
FT                   RTKALLNLSERCGVENVEAMVSTLIQAERYGTPLSQALRTISEESRKRLVLDLEEKAGK
FT                   LPAQLSVPLMVFILPPVIAMMGTPAMIRIIRMLGS"
FT   gene            369744..370625
FT                   /locus_tag="Mmwyl1_0312"
FT   CDS_pept        369744..370625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0312"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: eca:ECA0795
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69253"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS24"
FT                   /protein_id="ABR69253.1"
FT                   /translation="MNIVKGMIGSTRGFYLLLVCFVVLLGGCSTQVTKSGSQISESKTV
FT                   ETDTAEEALKLAHLLRNNGRYQAAYEVYEKMDEKGQLEGPFVLEYASLSASILPASEAI
FT                   ALYKRAQDELGKEVSNSQQQAICVGLGRAYLELAQLNKAKEQFQCALEASPKSVMALNG
FT                   LGVIASMNGDVSTAQENLQDALDIAPSNEIVLNNLALSWLSSGEFQKAISLLKTKQSSQ
FT                   NISTRLNLALAYVLIDREDMARELLLKNISRNKTETILDSYVTSKYRIKNGSDISAEIL
FT                   AFTNSPFSLKSE"
FT   gene            370622..371119
FT                   /locus_tag="Mmwyl1_0313"
FT   CDS_pept        370622..371119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69254"
FT                   /db_xref="GOA:A6VS25"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS25"
FT                   /protein_id="ABR69254.1"
FT                   /translation="MIVIDSIRFFIIKEKAVVSIEVALIFPVILFIAMMFFELARIALI
FT                   ISVVGVSLERTTQEFRYNQDFISIGEEVIKKKVSDKVVENSYGLIYENNIKVDLQSFSD
FT                   LNDFASVDIESGSYRSLPILNFSVLLNDNFITPLPSFFGLGNSFQHEYRQVLGDLIGKS
FT                   SS"
FT   gene            371116..371676
FT                   /locus_tag="Mmwyl1_0314"
FT   CDS_pept        371116..371676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69255"
FT                   /db_xref="GOA:A6VS26"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS26"
FT                   /protein_id="ABR69255.1"
FT                   /translation="MMLRFFRDENANAVLEFALFVPVMIGIILVSADLYNINRMRGVME
FT                   QTAHNLSSILSNQQELNIKSFDYLVEQVVDVKSLGNYSLVVSKVNLDRTMDWLPIYRGE
FT                   LDAVCPSKSEGNRYLDDMPEEDEDVDNISLIVVQLCRYTNSLVLNSGLLGNKLMESVAI
FT                   NRLLYHSIILDKPLSEEVGVEYQ"
FT   gene            371715..372056
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0315"
FT   gene            372171..372761
FT                   /locus_tag="Mmwyl1_0316"
FT   CDS_pept        372171..372761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0316"
FT                   /product="Haem oxygenase"
FT                   /note="PFAM: Haem oxygenase; KEGG: nme:NMB1669
FT                   iron-starvation protein PigA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69256"
FT                   /db_xref="GOA:A6VS27"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS27"
FT                   /protein_id="ABR69256.1"
FT                   /translation="MKTIDKEQEIVTFSKRLKYSTRTNHDSVDSLVMQSEPFANEENYR
FT                   KFLRLQHIFHLSVAPLYQHDDLQTLFPGLAELPRLSAVESDLNDLGLKADVDASLLATP
FT                   TDLYQAIGWLYCSEGSNIGAAFLYKETQKLSFDADHGARHLAAHPEGRAPHWRKFVAQL
FT                   DALSLTEEQEALAIKGAMDAFAFYKKTLASLNS"
FT   gene            complement(372787..372978)
FT                   /locus_tag="Mmwyl1_0317"
FT   CDS_pept        complement(372787..372978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aci:ACIAD0936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69257"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS28"
FT                   /protein_id="ABR69257.1"
FT                   /translation="MIKCKQATQMLSEKLDRTLSAKEKINLAMHTAICTPCRQFGKQME
FT                   TIRELSKSYTKAKKPDEK"
FT   gene            complement(372979..373608)
FT                   /locus_tag="Mmwyl1_0318"
FT   CDS_pept        complement(372979..373608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0318"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-24 related; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: aci:ACIAD0935 putative RNA
FT                   polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69258"
FT                   /db_xref="GOA:A6VS29"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014289"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS29"
FT                   /protein_id="ABR69258.1"
FT                   /translation="MSNANLSVEMDSSAAVNVFQDAVFIEELRAQMLKFAKLQVRDNQL
FT                   AEDAVQEAMFSAYQNIDRFARQAAFKTWVFSILKNKIIDLLRKEKRHTAASQLEDGPNL
FT                   SGEALIEHLFEENGHWQKDERPKKWDQPEHGVENEHFWRIFDACLDALPAKYGRLFMMR
FT                   EFLEMDTPEICHNEDVSVSSLNVTLYRARLRLRECLEDHWFQKEKS"
FT   gene            complement(373688..374227)
FT                   /locus_tag="Mmwyl1_0319"
FT   CDS_pept        complement(373688..374227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0319"
FT                   /product="transferase hexapeptide repeat"
FT                   /note="KEGG: psb:Psyr_0044 transferase hexapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69259"
FT                   /db_xref="GOA:A6VS30"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS30"
FT                   /protein_id="ABR69259.1"
FT                   /translation="MKSFRGKTPQLGDRVWVDDSAVIIGDVTIGEDSSVWPLVAIRGDM
FT                   HSIRIGARTSVQDNSCLHITHASTYKPEGYPLNIGDDVTVGHMAMLHGCTIGNRVLVGM
FT                   GTTILDGAVIEDEVIIGAGSLVPPGKRLETGFMYMGSPVKQIRPLNDKEIEYFQYAGLN
FT                   YVKLKDEYLAEAATSK"
FT   gene            374392..376422
FT                   /locus_tag="Mmwyl1_0320"
FT   CDS_pept        374392..376422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0320"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: son:SO4699 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69260"
FT                   /db_xref="GOA:A6VS31"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR034005"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS31"
FT                   /protein_id="ABR69260.1"
FT                   /translation="MSQSVWDATSLPNFNDIDVANIEADLEKLLKYNQEAIDACVSENT
FT                   NPTWESLVLPLDQLHDDLNNFWSPISHLNSVKNTPDLRTAYNACLPKLTQFYTDLGQNK
FT                   ALYQAYKNLAESEAAKDLNQAQSEALTQTIRDFELSGVGLEGEAKKRYGEISQRLSELS
FT                   SQFGENVLDATQAWSKLVTDENELSGLPESALAQAKQMAEAKEKDGWLFTLDFPSYMPV
FT                   MSYADNAALREEMYRAFATRASDQGGDIKFNNAPLIDEILALRHEMAQILGFDNYAELS
FT                   VATKMADNGQQVIDFLEDLAKKSKSSAEQDLAQLTAFAKDENGVEKLNAWDMTYYAEKL
FT                   RQHKYSISQEELRPYFPMNKVLSGLFHVAQTLFGVDIREEKEFDSYNKSLQLFTISKDG
FT                   EDVSRFYLDPYAREAKRGGAWMDSCRTRRRLSDNRLQLPIAYLVCNFTPPIGDKPALLT
FT                   HDEVTTLFHEFGHGLHHMLTQVDVSSVSGINGVAWDAVELPSQFMENWCYEPEALAHIA
FT                   GHYETGEPLPQDLLDKMLAAKNFQSGMQMMRQLEFSLFDFRLHMEYQKGISVQSVINDV
FT                   RSKVAVTTPPEFNRFQTSFSHIFAGGYAAGYYSYKWAEVLSADAFSKFEEDGIFNKDTG
FT                   ARFRDTILANGGSRPAAELFAEFRGREPSTDALLRHSGIAA"
FT   gene            376522..376782
FT                   /locus_tag="Mmwyl1_0321"
FT   CDS_pept        376522..376782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69261"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS32"
FT                   /protein_id="ABR69261.1"
FT                   /translation="MTVKRFIAGAVCPRCSEMDKIRAWRDDDAEKQYRECISCGYTDEQ
FT                   STTVQAQPTEIPTRVNTPHSSAPQAEEMVINFIPNPSSTKH"
FT   gene            376811..377527
FT                   /locus_tag="Mmwyl1_0322"
FT   CDS_pept        376811..377527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69262"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS33"
FT                   /protein_id="ABR69262.1"
FT                   /translation="MKMIVEVIGKVEQGYSNPYECLDEDGNSFIVKGLPRSSQINEWIC
FT                   ANLATAFGLPIAEYELVEIPEELYFELDFDTQFDLGCGPIFGSKKIQLAQWFEPKTMQH
FT                   IVTEEEKLKIFLFDYWVKNADRNSDNTNLLVSDKRIRVIDHNNAFDKKYTRDDVLNHLF
FT                   YDQINKKWLNDLVFRADFIGQIEDILLNLNNIIGSLPEEWQYSDSPINTLKADVDLVAI
FT                   ENTLSRYTDDDFWFFV"
FT   gene            377524..378339
FT                   /locus_tag="Mmwyl1_0323"
FT   CDS_pept        377524..378339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69263"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS34"
FT                   /protein_id="ABR69263.1"
FT                   /translation="MKKYACKYVVLRFAPYSETGEFANVGVLLYSKNHNSFVFKLDTTD
FT                   IGARVSKFFHIDDRQVFKFAMTSYQKELAFVQEQVVHHHMTAEEAFDFLVKPRATLLRF
FT                   SEVRTLITDSIDGTLNSVFARMVSHSSASQVKSRLKLAGILRSQLDSLCLEYPFKRHKF
FT                   SKSVFEVTYDFTQLSEQGEPLKLIQPIEINDKLTAKEIFEVVGNNEVRLNRMASLDLLP
FT                   KKVLLPFSLSENRTKEADEAWSIVKSELINIGELVDIHNKSAIEKFAKH"
FT   gene            complement(378419..380344)
FT                   /locus_tag="Mmwyl1_0324"
FT   CDS_pept        complement(378419..380344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0324"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: pin:Ping_0305 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69264"
FT                   /db_xref="GOA:A6VS35"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS35"
FT                   /protein_id="ABR69264.1"
FT                   /translation="MVMNFAFEAQKTQQRLLAELDFSQLTSQQKAIFVKRLENGFAPLF
FT                   EQLFPLYGQCFDLHYHLKVLLQSFIDFHKKKRPAQIKDKSEFWFESNQNVGIAVYVDLL
FT                   ADDLSSLIDKIPYFESLGINYVHLMPLYLAPEGNSDGGYAISDYRTVSPNLGTNKDLKD
FT                   LASALHKKGIRMVLDFVFNHTSDEHRWAEAAKSGDQEFQGYYYFMGEQDAMEYNQTVRE
FT                   IFPQIRRGSFTYLPELDRHVWTTFNSFQWDLNYSNPAVFVAVVEEMLHLILNGCDVLRL
FT                   DALAFVWKEKGTVCENLPKAHNLIKAFKACLDIAAPQVAFKSEAIVHPDEVNKYIGADE
FT                   CTLSYNPLMMALLWESLATRQTNLLYQSLERSFAIPEHTTWINYIRCHDDIGWLWDDAI
FT                   SDRLGIDGIGHRRFLNQFYTGQFEGSFAAGVPFQENPVNGDCRVCGTLASLAGVENAIA
FT                   ANDPLLLDHAIRRIRVLNGINFAMPGIPLLYQGDDLGVLNNDDYLNDPTKVDDSRWVHR
FT                   KKLTQQDFALADDTSAPQGKIAQMIREMIQIRKANPLFAAQEFELVSLGNEHVFAFKRQ
FT                   MNDKTLLVIANMSEHLVLLEHLPLGKSLSELIGQDTAMNLLNKEFIDLPSLSLIQPLDI
FT                   LWLVNN"
FT   gene            complement(380566..381114)
FT                   /locus_tag="Mmwyl1_0325"
FT   CDS_pept        complement(380566..381114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_2735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69265"
FT                   /db_xref="InterPro:IPR022224"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS36"
FT                   /protein_id="ABR69265.1"
FT                   /translation="MVKYLGPFFITLFLSACSSNDSWRTASREPAGIAPSPEEEKNAVI
FT                   EFYAADAFSWRGWFAVHTWVATKEKNASDYTVHEVVGWRVDRGLPALSEYKTTTPDRYW
FT                   FGAKPEKILSIIGPKAEALIPKINEAVKRYPWANEYTVFPGPNSNTFPTWIGLQVPELN
FT                   LDMPFNAIGSGYADNEPND"
FT   gene            complement(381296..381934)
FT                   /locus_tag="Mmwyl1_0326"
FT   CDS_pept        complement(381296..381934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0326"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: atc:AGR_L_768
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69266"
FT                   /db_xref="GOA:A6VS37"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS37"
FT                   /protein_id="ABR69266.1"
FT                   /translation="MSNLLDKLNWRYATKKMDSSKAVEQEKVDRILEAIRLTATSSGLQ
FT                   PYEVIVVKNKALREAIVPHAWNQAQITDGSHLLVFAAWDNYTEERINKMFDLVNDERGF
FT                   KNEGWENYRQMILGAYPPRDAEVNYQHAARQAYIGLGTALIAAAEEGVDSTPMEGFDPA
FT                   KVDEILGLTERGLRSVILLPLGYRADEGDWLKGLKKVRRSAEDFITEMN"
FT   gene            382143..383375
FT                   /locus_tag="Mmwyl1_0327"
FT   CDS_pept        382143..383375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0327"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   vpa:VPA1630 sodium/dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69267"
FT                   /db_xref="GOA:A6VS38"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS38"
FT                   /protein_id="ABR69267.1"
FT                   /translation="MDPFIMTLDHKPSLLQRYLRGSLVLQIAIGIICGVVLAYISPNTA
FT                   LSASLLGDFFVKALKAIAPILVFLLVMASIANHKQAQQSHIRPVLVLYFFGTFVAALTA
FT                   VVFSFVFPTQLNLVSPDLSQSAPQGVGEVLHTLVFKMVDNPVNALVQGNYVGILTWAIG
FT                   FGLGLRHASEATKALLQHLATSVTSIVSVIIRLAPFGIFGLVASTIAATGFDALFGYSH
FT                   LLAVLIGAMLFIAFVTNPLLVFWKIRRNPYPLVFKCLKESGVTAFFTRSSAANIPVNLD
FT                   LCKRLDLDEDTYSVSIPLGATINMAGAAITITVLTLAAVHTLGISLDFGTALLLSVIAA
FT                   VSACGASGVAGGSLLLIPLACSLFNIPNEIAMQVVAVGFIIGVLQDSAETALNSSTDVL
FT                   FTAAASLSDSK"
FT   gene            complement(383479..387207)
FT                   /locus_tag="Mmwyl1_0328"
FT   CDS_pept        complement(383479..387207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_0740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69268"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS39"
FT                   /protein_id="ABR69268.1"
FT                   /translation="MRFFADGPNIPDELLEQCDNGEVVFFCGAGVSKNEGLPDFAELTQ
FT                   QVLDHFSPQDTAESKITFNVFYKEQKQPVLDQVFRCLHEEFGVDQVNRVVADKLVSTED
FT                   YVSKSHQLLLTLSQNLNSVPQIVTTNFDLLFEQASDYSLPIYQAPFFPRLEHGMSIEGI
FT                   TYIHGKLSPADAEKHDYILSSADFGKAYLSQGWATDFVRSLLETKTVVLVGYQAEDPPI
FT                   KYLLQGLNQSSTISNSIYALNTGSDDDVFSRWANKGVKGIACSSRNDLWKVLSHWSERK
FT                   KDPRLWRGNVLRKAESSPSKLASWERGQVAHIVKTIAGAKAFANHKPLIHPEWICVLDE
FT                   KCRLGNISKDFFGDKSIYDPINDFALDDDPKRLGDEKIDLSLGQYARLLSALKFEEMQN
FT                   NSLTIVDYNSSIPPRLFHLSRWILKSVNNPVILWWLLWQTKVHPSLLRGLIESIDYDEM
FT                   GAVAYKYWRLTLEHFGRAEFISTYLDPMYDFCERATKEGWTYRALREFETLLTPFTEIE
FT                   PSLGHSRVKPPEKGWDDLSLHDLVQFKVKTLTLSAEQLSVPDGKLSQVLRILEGLLIRS
FT                   ETLMSEVSEYPRYRLTCYGEREVTGRSYSKYTLFDLYLALFKRYLLVAPSAAKHIVFAW
FT                   PSDFSIFGMLRLFAFNYKNLFSAEEVIKELLSIREEVLFDSSIKREFIFLIEDRRHEFE
FT                   KRDLESLVDKLLVYADSKDEKFDPDETQNNLELVCRYARRLQLGGVSFTKQQSDQLSHL
FT                   ITLFRTQNPNWSDAWAEWATKLCLPETSSSRPPEDDSPKILLKLPISDVIKKSVELGRR
FT                   DFDEDVRYRPFSGLVKDYPRRAILALCYELRQGNFEKEFWGKMMEHILSCSSTRYKTFL
FT                   FQKLIRLKEPFFQKISRSLSSWMKTNREAFEAFDKELYWQLFESITTKITSDAVKEMSQ
FT                   ATFHRESYQSTEANLVNILFDCMDEQELDSTKEIPPQIKSYFERLIRSETGGNDRVKYA
FT                   LANELPWLSRIDPAWVKQKLVPWFDNGSHESYVAWEGYLRCHNPWLSEEFADLIYPKIG
FT                   QLFPAVYDLKDADNMARSASTILVELSSTQKTGLWTLSPEIARNAIRHMQEKNRKDIIS
FT                   RLSAIGQNDEKNWQERVVPFIENCWPKDLNIQSPELTRSWLSLLSETGDSFSKIFQVVR
FT                   DKLRPIGGFRTPLSDLNRKKLTTTFPKEMLDLLLVVVNKDYAPMDAMSVVNSIVEAEPR
FT                   LKGEPKYHKLMKIIEDS"
FT   gene            387299..387424
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0329"
FT   gene            complement(387521..387646)
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0330"
FT   gene            387832..389070
FT                   /locus_tag="Mmwyl1_0331"
FT   CDS_pept        387832..389070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0331"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: rme:Rmet_5002 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69269"
FT                   /db_xref="GOA:A6VS40"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS40"
FT                   /protein_id="ABR69269.1"
FT                   /translation="MSSTFRSLSNPNYRLWFGGAAISNIGAWLQRTAQDWIVIAELSDK
FT                   NASAVGLVVFLQFAPQILLLPLTGWTADRMDRRKLLFITQSLMALLALVLGVLVLSGQV
FT                   VLWQVCVCAFALGCVAAFDAPARHAFVSDIVSEKELSNAVGLNSVAFNSARLVGPAIAG
FT                   ILIALIGSGWVFMINVLSFIPLLIALHKFKTRLPAVVADNSKATPDMAKFFDGFRYIWQ
FT                   HREMAVILVMSFLICSLGMNFSVYLSAMTVHVFQGHADQYGFLISMMAIGSISGAMVTA
FT                   SRRSSPSFRFMIYVAAMFAVSCFLVAMSTSFWAFSALLIFLGLSLQLFTTSTASYMQVT
FT                   TEKRYRGRVMAVVLATALGSTALGAPLVGWIADVFGARWAIGMGSISGIIAASLAFWFL
FT                   RRQAQTELKNKML"
FT   gene            389198..389716
FT                   /locus_tag="Mmwyl1_0332"
FT   CDS_pept        389198..389716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0332"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   psa:PST_3897 glycine cleavage system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69270"
FT                   /db_xref="GOA:A6VS41"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS41"
FT                   /protein_id="ABR69270.1"
FT                   /translation="MSQHLVLSFIGDDRPGLVERLSDTIARHHGNWLESRMAHLADKFA
FT                   GILTVTVPLEHQEALVNALRNFEQLGLHVTVEMAKQSMMEGSTLSLSVVGNDRPGIVKE
FT                   VSQVLHSLMVNVKELTTTCEPAPMSSDMLFKTDMVLAVPKDLPLSELEAALEKISSDLM
FT                   VELSVNQFA"
FT   gene            complement(389746..390645)
FT                   /locus_tag="Mmwyl1_0333"
FT   CDS_pept        complement(389746..390645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0333"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ilo:IL2190 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69271"
FT                   /db_xref="GOA:A6VS42"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS42"
FT                   /protein_id="ABR69271.1"
FT                   /translation="MKFNYSLDDMRCFCAVAQYGSFKQASTALEIPLSTLSRRVAKLEE
FT                   DLAIRLLNRDAHRVQLTHTGQRYYERSLPLFEELNDVAVCLLQDKTQAKGTIRISAPVN
FT                   FGVQVLAQHFNAFLIEYPDIHLDLRLSNQNIDIEEEAIDIAFRVGDHNADHWIGRHLTN
FT                   IRFVICGSVRLDMSSLKTPCDLEGFPTVLCSPMSTWKLQHTISGEMQTHKPNHNIRLKV
FT                   DDISLLTRAIQDGLGIGFMPDYHAQPLIDSGELQQVLPEWSNQPRGCQMLYRDRDNMPF
FT                   RLRLLIDFMIKRFNEKPL"
FT   gene            390744..391685
FT                   /locus_tag="Mmwyl1_0334"
FT   CDS_pept        390744..391685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0334"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ilo:IL2191 predicted permease, DMT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69272"
FT                   /db_xref="GOA:A6VS43"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS43"
FT                   /protein_id="ABR69272.1"
FT                   /translation="MNRSASTNAVLLLLLCTFFWGACFPVGKHALGEVHALTLVIWRFA
FT                   IAAVCLFIYAKWKNMPMPSLTAKQWAWAISVSIIGVGGLNLGLFTGLAQTDASNGALIM
FT                   ALSPLATSLIGSLLQRKLPARGAVFSLVVCLSGVLLVLTNGELKRLLGFEFNHGDQMIF
FT                   LGMLCWSLYTYLTQGVSRWMPMIPYTLVGMLSGLGVISLVTAFSAEVHPLQESLAISGY
FT                   VLGDLLFIGVFGTVGGYLLWISGVKQLGAANASLFFNFVPVFAALTAFAYGQTVTSLQL
FT                   LGVAIVIAGLLLPRIVKWQQQRFNRQEAASTN"
FT   sig_peptide     390744..390830
FT                   /locus_tag="Mmwyl1_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.751 at
FT                   residue 29"
FT   gene            complement(391715..393283)
FT                   /locus_tag="Mmwyl1_0335"
FT   CDS_pept        complement(391715..393283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0335"
FT                   /product="deoxyribodipyrimidine photolyase-related protein"
FT                   /note="PFAM: deoxyribodipyrimidine photolyase-related
FT                   protein; KEGG: sbl:Sbal_3872 deoxyribodipyrimidine
FT                   photolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69273"
FT                   /db_xref="GOA:A6VS44"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS44"
FT                   /protein_id="ABR69273.1"
FT                   /translation="MMKKSQLQYHTLRIILGDQLNAAHSWFKAQDQGVLYLIAELHPEA
FT                   TYVTHHIQKLCAFFLAMEHFASALKENGHDVCYLTLDDTHNQSLEEVILSLTKLHNIDH
FT                   VELQRPDEYRILQQYHQLIVSDSKPKFSMVDSEHFLLPFNEIPNFFQAKSTVRMEHFYR
FT                   KMRQRFNILMADEREPEGGQWNYDLANRNKLKAQDLADIPTPLCFQHDVTHLLERIQRH
FT                   NIPSLGKAESSLLWPVTSRDALNLLTFFCEHLLPNFGRFQDAMTNQTPHSWSLYHSRLS
FT                   FALNAKLISPKHVIKAAVSAYQENDNIDIAQIEGFVRQILGWREYVRGMYWINMPDYQQ
FT                   QNDLNAERALPSYFWNGQTKMKCLASAIGQSLDYAYAHHIQRLMVTGNFCLLTEIQPQQ
FT                   VDKWYLGIYVDALEWVELPNTRGMSQFADGGWIASKPYAASGSYMQKMSDYCGDCHYKV
FT                   KEKTSAESCPLNSLYWHFMVKHRERLAKNHRIGMIYGNWDKQDDVQKRAVLERAEWCLE
FT                   NIEAL"
FT   gene            complement(393283..394608)
FT                   /locus_tag="Mmwyl1_0336"
FT   CDS_pept        complement(393283..394608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0336"
FT                   /product="Cryptochrome DASH"
FT                   /EC_number="4.1.99.3"
FT                   /note="TIGRFAM: Cryptochrome DASH; PFAM: DNA photolyase
FT                   FAD-binding; KEGG: vco:VC0395_A1410 RNA-binding
FT                   cryptochrome Cry1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69274"
FT                   /db_xref="GOA:A6VS45"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS45"
FT                   /protein_id="ABR69274.1"
FT                   /translation="MKLGLVWFGDDLRCADQNMLWRAVQEVDYLICLYCDEPHNNHPSR
FT                   YATQGMSANRRRLLNQGLQDLALQLQALGQTLFVSSMDAATSLNLLLNEIPISHLYRNH
FT                   HGGWDEQQTLNRIESRYSDVRIHLDHGLSLFTPSQLPFDIAQLPDSFSKFRRLVENLDV
FT                   FTPLPALQKLPPAPTFDIQCIRPWQLKQIEDNSMFTGGERAAVDQLSDYFSTNLPSHYK
FT                   ETRNELDGWENSTKFSPWLAQGSLSARQIKASIDVYERDHGANESTYWIYFELLWREYF
FT                   HWYATCYGKQLFLPGGLSGKQTQGSYYAERFRKWSQGNTPYPLVNACMKQLNETGFMSN
FT                   RGRQIVASCLIYELGIDWRYGAAYFEEQLIDYSVGSNWGNWQYIAGVGADPRGGRHFNL
FT                   QKQTEQYDPNLHFIHKWQGQIFDTQLDSVDAADWPIFPTSSN"
FT   gene            complement(394677..395579)
FT                   /locus_tag="Mmwyl1_0337"
FT   CDS_pept        complement(394677..395579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0337"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: vpa:VPA0794 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69275"
FT                   /db_xref="GOA:A6VS46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS46"
FT                   /protein_id="ABR69275.1"
FT                   /translation="MIEKIELSWLLSFHTVFEERSFKLASEKLGQPSSTVSRHIIQLEE
FT                   TLNVRLLERTTRRMSPTEAGQTLYEQSLPLLRSLDDQLEAISDQSDKVSGHLRILMPDL
FT                   PFIAQQIASFCALYPKLKLSCETGLVPHQGLLDGFDLVMQFGRGELMDSDWVAKELIRW
FT                   PSVIVASPEFVERHHSHLSFQNLPSLPCITTLSALQGSPWIFKDSRHSTKVHVTSQYRA
FT                   NSANMAKEAAIAGLGMAILAEPSCQKEIHQGTLVAIELEKTPEDLVLYAYSGKLKYSPQ
FT                   KVTALLDHFNFSDLFNELD"
FT   gene            395682..396800
FT                   /locus_tag="Mmwyl1_0338"
FT   CDS_pept        395682..396800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0338"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   bch:Bcen2424_4900 monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69276"
FT                   /db_xref="GOA:A6VS47"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS47"
FT                   /protein_id="ABR69276.1"
FT                   /translation="MSKRIAIVGAGVAGLAFATLAAKQGNQVDIFERRSQAGSDLGAGV
FT                   TLWPNAIFVLTQMGLLKAIQKASGEPMTMTRYDLTTGVQGDLSLRGLNQSAGFNTLTIL
FT                   RRDLMAILFAGADQAGVQIHFGEAINLDKLSELENQYDWVIGADGRMNSTLRRKISPVS
FT                   QPVYQGFVNVIGISHSSPTRPFNNQSIQDYLGDGERFGIVPIDASTCFWAAGWAEVEKQ
FT                   PNRMFTLSELGERFREWPSEVLTVLQQAEQSSLHTVYVHDLDPMTSWSRGKCMVIGDAA
FT                   HAALPTSGQGACQALEDAWWLAKLMQEEATTDRLFARFQQQRLEKTVAIQMTGRHIAQA
FT                   IFHTPANQRPAQGSVTEASLDAMAAFWMTGLV"
FT   sig_peptide     395682..395747
FT                   /locus_tag="Mmwyl1_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.724 at
FT                   residue 22"
FT   gene            complement(396802..397194)
FT                   /locus_tag="Mmwyl1_0339"
FT   CDS_pept        complement(396802..397194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0339"
FT                   /product="membrane-associated protein in eicosanoid and
FT                   glutathione metabolism (MAPEG)"
FT                   /note="PFAM: membrane-associated protein in eicosanoid and
FT                   glutathione metabolism (MAPEG); KEGG: pha:PSHAa1562
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69277"
FT                   /db_xref="GOA:A6VS48"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS48"
FT                   /protein_id="ABR69277.1"
FT                   /translation="MITPIYAALLVFLYIFLSFRVIKLRMKYKVGIGDGDQSMLTRAIR
FT                   VHGNFAENVPYALLLVWMYESTGGSTLLVNIMGILLCLGRLSHAYGVSQPKEPLIYRQS
FT                   GMVMTFLVMLIAALLILTHLALGYRF"
FT   gene            397358..397699
FT                   /locus_tag="Mmwyl1_0340"
FT   CDS_pept        397358..397699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0340"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein; KEGG: sdn:Sden_1233
FT                   alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69278"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS49"
FT                   /protein_id="ABR69278.1"
FT                   /translation="MSLPNCPKCDSAYVYEDQAMLICPECAHEWNPNEVVVDEDALIIK
FT                   DMGGNLLQEGDKVTLAKDLKVKGSSQVLKIGTKATIKRLVDGDHDIDCKLDGGGEMMLK
FT                   SQFVKKSNI"
FT   gene            397914..399548
FT                   /locus_tag="Mmwyl1_0341"
FT   CDS_pept        397914..399548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0341"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pmy:Pmen_1353
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69279"
FT                   /db_xref="GOA:A6VS50"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS50"
FT                   /protein_id="ABR69279.1"
FT                   /translation="MFSQLKISQRLGLGFAFIFALLLLISVVGMQRVNVIDNTLTSVRD
FT                   GATLKQRYAINFRGSVHDRAIAVRDVVLASDPVRLNQELASIKNLDVFYQQSAKSMSQL
FT                   MLSDASTAERTLLKAIQDIEITTQKSTAALLDLAQQGNTSIATQLLMQEVSPGYTEWLK
FT                   RINAFIDHQEEVINKDIGIVMKVASTFVNLMLVVTLIAAVFSVFVAITLIRSIQARIGG
FT                   EPEDVAALVQRIADGNLNVTIETHYPNSMIGSVRAMVSRLQQIILDVRSAADELSIASS
FT                   ELNSTASENNRRLRQQSADTTLMAAAINEMSASVSEVAGHAGHAAEATQKVDREVESGN
FT                   TKVNATAEAIVHLSETLELASKTVEKVSVDSGNIEKITDVISAIAEQTNLLALNAAIEA
FT                   ARAGEHGRGFAVVADEVRSLATRTQQSTSEISNMIVRLQEGSSKAAEIMNTSRERAQKT
FT                   VEQTQEARAALASIRTEVMAINDMNTQIAQTSAEQERVAEDMNLNITRVHEATMESAAG
FT                   SEQVAQSSERLAQLSKKLTTKVSFFKM"
FT   sig_peptide     397914..398021
FT                   /locus_tag="Mmwyl1_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.400 at
FT                   residue 36"
FT   gene            complement(399640..400779)
FT                   /locus_tag="Mmwyl1_0342"
FT   CDS_pept        complement(399640..400779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0342"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein; KEGG:
FT                   aci:ACIAD2762 hypothetical protein; putative
FT                   siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69280"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS51"
FT                   /protein_id="ABR69280.1"
FT                   /translation="MSLYTPLQDLDHKIDIIDHVNQDHPEELFAIAQHHCQQGEEIYSA
FT                   KILDIFKEGIQVNVAFSDNTDAKDMFIPFAIEGDLEENILYLAYAAVIKQGRDFSGTGK
FT                   RFFEVISKQKITPNIIRLTVKCTTPLPEYYPGYAHAFVLKSLTKRPNNDIRNINKKHWS
FT                   KNLFDRIFIWLLKNLSSKNRQKLFSNSNKDIRLYTLRKSWKGDNSTWIDHGYVDIFTHG
FT                   DTAGSQWANKLEVGNIILSRSESKDKHPHLTSGHALLVADETAYPALAGILEYWQNPLP
FT                   PHIILISAAEDEQAYFSDEMIPHGCQLDRVVCSAEQQADKVLSILRQIEKVDVVWAALE
FT                   SESAKKIRHYLRNERQVIGKNNHTKAYWNLKNKHGTTQN"
FT   gene            complement(400863..402923)
FT                   /locus_tag="Mmwyl1_0343"
FT   CDS_pept        complement(400863..402923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0343"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: hch:HCH_03822 outer membrane receptor
FT                   protein, mostly Fe transport"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69281"
FT                   /db_xref="GOA:A6VS52"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030150"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS52"
FT                   /protein_id="ABR69281.1"
FT                   /translation="MMNLSNAARIPAHLSVVALSIITINSMLVSSLANAEEVALDAIVV
FT                   TGEKINKNIKDTTTAITVITEDQLESGETKQVKDIATQAPNVVADSFGHIAIRGVSGGG
FT                   AATGGVALMTGAHARVTTVVDGSTQDWSGYNFAPTDLWDAKQVEVLRGPQSTTQGSSAI
FT                   GGAIVVNTNDPTFDSEAAVRVGLERYKNGNLKYNLAAMSSGALIYDELAYRIAVDENKG
FT                   EGWLNYDTSRYSKDHPNLSESENLNLRGKLLWQPKSNPKLSAKLTLNHLKNDGEHANFA
FT                   SNTDAGIATQTMTVADSGGAISRVQDSEENSIAADINYQLSPDITNILHISYINSDIYA
FT                   DGYGSANGGTTHTYDIQQTTTSLENRLVFNRKNSTLNGVIGFFTANKDSVIDATQGIIN
FT                   IDTDYSISTTALYGEGTYSLSPKTKATLGLRIEQEDVDKIGSFFSATKVDQNTNDTYYL
FT                   PKLSLTNEVSDTTTLGASIRKGYSSSGTYINTAGEAFSFESEEVSTFELSSKSNFGNGT
FT                   MLNAALFYNDYTDYQALSGFTIVNVDAAHTMGAEIEVTTWATDNLELRGSVGLLRSKID
FT                   KNNTNKGNKLSSAPETNLGFGFTQYIGDAWSFGADITYVGEYYSDLANSDTTTVGDYLI
FT                   TDARAQYTVGDLTISGYIKNLTDEDAVYFRADSLASVAQTRTIGISALYRM"
FT   sig_peptide     complement(402816..402923)
FT                   /locus_tag="Mmwyl1_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.985 at
FT                   residue 36"
FT   gene            complement(403070..404317)
FT                   /locus_tag="Mmwyl1_0344"
FT   CDS_pept        complement(403070..404317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0344"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aci:ACIAD2763 putative transport protein (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69282"
FT                   /db_xref="GOA:A6VS53"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS53"
FT                   /protein_id="ABR69282.1"
FT                   /translation="MQYNKYPWLMLASTYITQYIGVAFILSAAVAILRQQGVALDKLAL
FT                   LNLALLPLAGKVFYAPVIDKYRLWLQGTYRSWLILSQASMTLLLVIAGAMDFAHHFTLI
FT                   LIVLAFYVFFMSIQDVSVDGLSCKLFDPESRKLASSIQFSGNLLGNIIGGGLILMFYPW
FT                   LEWHGSLWLLAGLTSISFVQMVLFTEPESAANNAQQESRQHLLRNIKAFIKQHKHWFVI
FT                   MALYPIGSTCGFAILNPLLVDNGWPLDDIGFAMKIYGSAIGLISALLATPLITKIGRVN
FT                   ALVCVILIQALALVLMVPLTLGFTDKPMVYTAITIHFISFPALLVVSATIIMDKAALTQ
FT                   HKATFFSLQFSFASLLGFIYSAASMAIAKHIGYSTVVTTGAALTFGIALLTWFVLRPQE
FT                   STSSNNTSDASSHISI"
FT   gene            complement(404486..405403)
FT                   /locus_tag="Mmwyl1_0345"
FT   CDS_pept        complement(404486..405403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0345"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: chu:CHU_3754 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69283"
FT                   /db_xref="GOA:A6VS54"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS54"
FT                   /protein_id="ABR69283.1"
FT                   /translation="MCYAASMGEIIVSYHSVEDITTFEHFNLDFDAQSWVRSVNHRFLE
FT                   DTLVENVSKPGLYISMFGKCQGQTLNNGMDQQRDYSHQYMVALVDQSCSGHMRFPNNSV
FT                   WQTLSIMLPLNTLHENSLLPQLHSNFPHAVPQIRLAELGPVPRDILRCCEAIWDCTFKG
FT                   FERELFIKAKAQEVLALFLHKRRQHHRAPETSRMIKLGNVLSHIKTNLAQDWPLSTVAN
FT                   LSGSNRTYVKQDMKELIGLSFRDWLKQVRLEEACEQLTGNISITEIAHNVGFKSQAHFA
FT                   TLFKSELGVTPSEYRQSLFMKRNT"
FT   gene            complement(405573..406091)
FT                   /locus_tag="Mmwyl1_0346"
FT   CDS_pept        complement(405573..406091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0346"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   asa:ASA_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69284"
FT                   /db_xref="GOA:A6VS55"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS55"
FT                   /protein_id="ABR69284.1"
FT                   /translation="MMVILFISFNTIILLRTMMKVSLLADQKHFIPTIAQWYFNEWGRL
FT                   TPNRSLEDIAIKVTVMAESRAAPPISFVLHDHDELLAVAELKFHEHPDFPNYKHWLGGV
FT                   FVPADKRGQGYSCLILQHTLNHAKNLGIPDLYLQCEQHNIDLYLEHDFEVIHRMNDKGV
FT                   EKAVMVKAF"
FT   gene            complement(406239..406427)
FT                   /locus_tag="Mmwyl1_0347"
FT   CDS_pept        complement(406239..406427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abo:ABO_1656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69285"
FT                   /db_xref="GOA:A6VS56"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS56"
FT                   /protein_id="ABR69285.1"
FT                   /translation="MIYNVGTTDRVVRITMGAVVIAIGVYFNSWWGVIGIVLLATGVFS
FT                   ICPAYLPFGFSTCKTKK"
FT   gene            complement(406680..407003)
FT                   /locus_tag="Mmwyl1_0348"
FT   CDS_pept        complement(406680..407003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0348"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   reh:H16_B1992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69286"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS57"
FT                   /protein_id="ABR69286.1"
FT                   /translation="MTKKWTPASAADGVEQVLKILEGKWKLVILFHLFGGQVKRFSELE
FT                   KAIPAITQKMLIQQLRQLEADGIVTRTIYHQVPPKVEYSLTDWGQELCPALDALLKWAE
FT                   NKK"
FT   gene            407161..407490
FT                   /locus_tag="Mmwyl1_0349"
FT   CDS_pept        407161..407490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69287"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS58"
FT                   /protein_id="ABR69287.1"
FT                   /translation="MMTIDLPRPIANYFKADKGDSEAIVACFSDETVVKDEGQTHTGLD
FT                   AIKQWKANASTKYTYTVEPQLLSESAEQTIVTGLVTGNFPGSPVNLQYAFTLDGDKITA
FT                   LEISL"
FT   gene            407487..408269
FT                   /locus_tag="Mmwyl1_0350"
FT   CDS_pept        407487..408269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0350"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: rpb:RPB_4387
FT                   short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69288"
FT                   /db_xref="GOA:A6VS59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS59"
FT                   /protein_id="ABR69288.1"
FT                   /translation="MSFDLELNGRIALVTGGTKGLGAAVVESLHGAGVHVIAVARSVPK
FT                   DALEGISYIEGDLLTAAGCSALVSTVLEKFGGVDIVVNVLGGSSAPSGGFAALDEQEWE
FT                   NALSQNLLSAVRIDRGLLPSMITKGSGVIVHVTSIQNKLPLPESTTAYAAAKAALSTYS
FT                   KSLSKELAPKGIRVVRVSPGWIETEASVRLAERLADHAGTDYEGGKKIIMDSLGGIPLG
FT                   RPAQPSEVADLITFLVSARASSITGTEYIIDGGTVPTA"
FT   gene            complement(408433..408687)
FT                   /locus_tag="Mmwyl1_0351"
FT   CDS_pept        complement(408433..408687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0351"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: plu:plu2280
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69289"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS60"
FT                   /protein_id="ABR69289.1"
FT                   /translation="MDTLSYSAFKANLASTFDKVNDDHKPVLITRQGRKPAVLISLEDF
FT                   QTYKETAYLMASPKNASRLNAAIAEMEAGRTQTREQIEE"
FT   gene            complement(408801..409082)
FT                   /locus_tag="Mmwyl1_0352"
FT   CDS_pept        complement(408801..409082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69290"
FT                   /db_xref="GOA:A6VS61"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS61"
FT                   /protein_id="ABR69290.1"
FT                   /translation="MTNKHIGSSFDDFLEEEGILAETNAVAIKRVVAWQIQQKIEHEHL
FT                   SKTKMAQLMKTSRSGLDRLLDPNNTSVTLHTLDNAAKALGKKLKLELV"
FT   gene            complement(409075..409431)
FT                   /locus_tag="Mmwyl1_0353"
FT   CDS_pept        complement(409075..409431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0353"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   rbe:RBE_0720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69291"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS62"
FT                   /protein_id="ABR69291.1"
FT                   /translation="MKNIKHKKVSVHFFRTASRGEPVREWLLSLTKEDRSAIGQDIKTA
FT                   AYGWPVGMPICRSMGDGLWEVRTNLEGGRIARVLFFFKSNELILLNGFMKKAQKTPKSE
FT                   LDLAKKRKREAEND"
FT   gene            complement(409624..411171)
FT                   /locus_tag="Mmwyl1_0354"
FT   CDS_pept        complement(409624..411171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0354"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; KEGG:
FT                   asa:ASA_2628 alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69292"
FT                   /db_xref="GOA:A6VS63"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS63"
FT                   /protein_id="ABR69292.1"
FT                   /translation="MLEANLKQQLGTYLQNIVNPIEITVSTNSSAKSNELLELAREITE
FT                   LKSDKITLTVNENSTGRAPLMAIAPKGETPRVSFAGIPMGHEFTSLVLALLQAGGHPSK
FT                   AAQETLEQIKSLDTKLNFEVYISLSCHNCPDVVQAVNLMAVLNPNITATMIDGSMFQDE
FT                   VNERNIMAVPSVYLNGELFGQGRMTLAEIVNKVDTGAADKQAAALAEKAPYDMLVVGGG
FT                   PAGAAAAIYAARKGIRTGVVAERFGGQVSDTMAIENFISVKATDGPKLVAGLEQHVLDY
FT                   DVDLMKLQKAVRLEKKEFIEVELENGAILQSKSVVLATGARWREMNVPGEQEYRNKGVA
FT                   YCPHCDGPLFKGKKTAVIGGGNSGIEAAIDLAGITEHVTVLEFSDTLRADDVLVKKAQS
FT                   LPNVTIIKNAMTTEVMGDGQRVIGLKYTDRLTDESHLVDVAGIFVQIGLVPNSEFLKET
FT                   LELSNRGEIIVNAHGETSIPGVFAAGDVTTAPYKQIVISMGSGATAALGAFDYLIRN"
FT   gene            complement(411264..411821)
FT                   /locus_tag="Mmwyl1_0355"
FT   CDS_pept        complement(411264..411821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0355"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   vpa:VPA1683 alkyl hydroperoxide reductase c22 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69293"
FT                   /db_xref="GOA:A6VS64"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS64"
FT                   /protein_id="ABR69293.1"
FT                   /translation="MINTQIKPFNATAFKNGEFVEISEKDVLGKWAVFFFYPADFTFVC
FT                   PTELGDVADNYAELQSRGVEVFSVSTDTHFTHKAWHASSETIGKIQYYMVGDQTGNITN
FT                   NFGVMREGQGLADRATFLIDPQGTIQAMEITAEGIGRDAQDLLRKVKAAQYVAAHPGEV
FT                   CPAKWKEGEATLTPSLDLVGKI"
FT   gene            complement(411929..413011)
FT                   /locus_tag="Mmwyl1_0356"
FT   CDS_pept        complement(411929..413011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0356"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KEGG: mgm:Mmc1_3408 response
FT                   regulator receiver modulated metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69294"
FT                   /db_xref="GOA:A6VS65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS65"
FT                   /protein_id="ABR69294.1"
FT                   /translation="MIETTFEQSKTKQPLDKLTVLIVDDTPENIDVLVASLSDEYTIKV
FT                   ALNGMKALSIASLSPRPDLILLDVMMPEMDGYDVCERLKSNPVTANIPIIFVTAKHDIK
FT                   DEEKGLSLGAVDYIIKPISPPIVRARVRTHLALYDQNRQLQKKVDERTKALQASQLRII
FT                   HHLGRAVEFKDNETGAHVIRMSHYARMIAQEYGGNDEWVNLVFQAAPMHDVGKIGISDA
FT                   ILLKPGKLTPEEWEKMKLHTVYGGEIFSEDNDPMLQIAKTIALTHHEKWDGSGYPYGLK
FT                   EEEIPLEGRIVAIADVLDALMSKRPYKEAWTLEDSLAYIEESAGTHFDPNLVPLLKNLP
FT                   PQIMDIREQYPDKDCSIPFR"
FT   gene            complement(413017..416949)
FT                   /locus_tag="Mmwyl1_0357"
FT   CDS_pept        complement(413017..416949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0357"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; Hpt domain
FT                   protein; KEGG: son:SO0859 sensory box histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69295"
FT                   /db_xref="GOA:A6VS66"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS66"
FT                   /protein_id="ABR69295.1"
FT                   /translation="MMTLDRHHLSISPLVWLLAFVALISSIIGATILTITVQELTKQRL
FT                   GLKTQQTELLNASAELREIVPAYRSQLRQALFEGSDPTANNKYNIDLYYQAIATLESES
FT                   DDIQTQIISSQLANRGQTILDTTKLITDWYKRRSHHYSEEEQLNYKDKALNHLNQLKSL
FT                   TYAITGKNRLQENFLIYQYNTSSYEKRDALAREYLKLRLSRLESALNTAMEDISTLEVA
FT                   LNVMIASNSLSVITDLKDNQIKSSLDRLDYVIAESAKIHPETAKKLQQERNALGNTLFG
FT                   EGYFFDSTKQVIKLGKSGLFEERIEHISLEEEKIDLINLLEITFLPLPRLMDQIGEFVQ
FT                   LNSKNLEQKIENQLTAVKTRILWISGISITILLLLAWAISRKVTRQLSGFIESEERFRS
FT                   MFEITPDPVWILMNQKIVECNNAAINTLHYPAKEALLGLEMCDISPEKQTTGMLSSSSL
FT                   NSHFEQVTLSGNTRTEWVFQRYDGEPIYADMTILSIAFNNHPATIISWRDVTERVMSQQ
FT                   SLAQYKEKLEHDIALQTTELQTAKEAAENANQAKSEFLANMSHEIRTPMNSIIGMSSLA
FT                   LQTPLNDKQRGYIEKVSHSAESLLNIINDILDFSKIEARKMDIENVPFMLPSLIHKVAH
FT                   VLELKIEEKGLELIIDIDAEVPQQVVGDPTRLRQILLNLGNNAVKFTQQGEIIIRAAHS
FT                   KNNQDDNIIHFSVQDTGIGISKDKQNNLFQSFSQADTSTTRRFGGTGLGLAISKRLIQL
FT                   MGGDIWVESEENKGSTFHFTINLQSTGNVPSPYALNNHTNLSQVMVVDDNNSAREVLKA
FT                   SVEALGLSCHTCSSGHEAIQYIASLKASSQPYPLMLIDWKMPELDGIDTCKAILAETRD
FT                   DTPLTIIMVTAHRQDDARKAGYGLPISAYLTKPVTTSSLFDQIIQLCGPESVSLIDHRS
FT                   NGNDISFSYELAGAKVLLVEDNEINRELAEELLSRSGILFTSATNGQEAISLLGSDDFD
FT                   CILMDCQMPIMDGYTATKKIRTMTQYKDIPIIAMTANVMPEDIKYAKASGMNDHIAKPI
FT                   HFETMFNTLRTWVKTSVNNSTSTLTTAMQDNSNTTLTTAMQDNSNTTLTTALQDNTNRI
FT                   ELPDSIHIDTELGLLRTLTKPLYSRLLKRFLETQTTFIDECNTAIKTNNFVLANRLAHT
FT                   LKGTAATLGMIELAASAARLEKAFEEKNINIAPILISVEHDLNIILNDLRAWHAVNNVN
FT                   SAKDVLTTSPMELNEFRNNIEILATYIDKNVVEALSLAQKLLPNITDKNANKSMVKVIS
FT                   ALKLYDFEQAAKHFKSLSINLENFEQ"
FT   sig_peptide     complement(416857..416949)
FT                   /locus_tag="Mmwyl1_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.438 at
FT                   residue 31"
FT   gene            complement(416986..418146)
FT                   /locus_tag="Mmwyl1_0358"
FT   CDS_pept        complement(416986..418146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0358"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rba:RB7306 probable leucine/isoleucine/valine-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69296"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS67"
FT                   /protein_id="ABR69296.1"
FT                   /translation="MILRVLICLTLSLFLLGEKAYSSELRFGFTGPLTGPNAFTGTQVV
FT                   RGIELGFKRINDSKKLNYQLLLVPLDDGYEPSRTPSQVSTLINDYGIKAILGSVGTPTN
FT                   LASLSILSKHKIPLISPFTGAQSIRAERSSPFIFNTRASYTEEAHFLINILVNDLGIKP
FT                   NEIAIFAQKDSYGDAGLASTIEALTGAGLKNPASILQIRHQRNSSEISHSVADVLGVFP
FT                   IPKVIIMISTYDTSTNFIKQLEVFDISPLFAAFSFTGLEALQAQISDTKAKMLITQTTP
FT                   SLNNSKSPIIKQLKEDMARFGDLAPPTTMQLEGYINALIVGQALLPLKDVPTSKEIEDS
FT                   LKKLAKDNYDSQEQNELYVLNIKKRHIWVQLIINGALQEFSYADMQ"
FT   sig_peptide     complement(418078..418146)
FT                   /locus_tag="Mmwyl1_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.922 at
FT                   residue 23"
FT   gene            complement(418282..419205)
FT                   /locus_tag="Mmwyl1_0359"
FT   CDS_pept        complement(418282..419205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0359"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: vfi:VF1374 regulator
FT                   of kinase autophosphorylation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69297"
FT                   /db_xref="GOA:A6VS68"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS68"
FT                   /protein_id="ABR69297.1"
FT                   /translation="MAFKVIKPGLLALIQDLGRHGHQSIGLTTGGPMDEVAFRWANALL
FT                   DNHSNSAQIEITFGMFTLEAQANTSIAITGADLAATLNDKSITPWQTYAIKKGDVLAFH
FT                   QPVWGLRAYLAVKGGFICEPTLGSVATVVREKIGGLTGKGDKLQKGDLLAYQATSFHEK
FT                   RSVPRLAIPNYGNREIPVILGYQYQSFSTLERANFFSSDYKVSSNSDRMGYRLEGKEVH
FT                   SNLKGIISEGIAYGAIQVPKDGQPIVLLQDRQTIGGYPKMGCVTHVGGGILAQQKPGDI
FT                   IQFTPITVDQAEQERHLQMARLAQWR"
FT   gene            complement(419195..419899)
FT                   /locus_tag="Mmwyl1_0360"
FT   CDS_pept        complement(419195..419899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0360"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   vfi:VF1375 kinase autophosphorylation inhibitor KipI"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69298"
FT                   /db_xref="GOA:A6VS69"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS69"
FT                   /protein_id="ABR69298.1"
FT                   /translation="MSREEFPNIEMVSNQACLLTFSQVISEATSNYIAQVTQHLVKLTG
FT                   IVDLVPSYTTLLVVFDDDHYDRFAIFKTIRQTIEAIDPNDFSVKDQREVVIPVYYGKEV
FT                   GPDIEDVARHCKLSIDEVIQRHSETTYRAYAIGFTPGFAFLGNTPDELHVPRKTTPRLK
FT                   VPIGSVALAENQTAVYPSVTPGGWQIIGRTPVNLIDWGSKNLALIAMGDSVRFEPISRD
FT                   EFLVQGGQLDGF"
FT   gene            complement(419903..420673)
FT                   /locus_tag="Mmwyl1_0361"
FT   CDS_pept        complement(419903..420673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0361"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: vfi:VF1376
FT                   lactam utilization protein LamB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69299"
FT                   /db_xref="GOA:A6VS70"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS70"
FT                   /protein_id="ABR69299.1"
FT                   /translation="MMKLNCDMGEAFGAWKMGLDDQIMPFVDQANIACGFHASDPLTMA
FT                   KTVALAKQHNVTIGAHPAYPDLVGFGRRNMDIAPAELKALIQYQIGALKGICESQNTQV
FT                   DYVKPHGALYNTMMADFSVLETVMQAVSELDATMPLMVMAVPEAPEIQKMAKKYGIRVW
FT                   FEAFSDRLYTDEGRLTPRKEPNAVHASFDLIEKQVEQLCETGTLTTTSGQQLAIHADTI
FT                   CVHGDGAHAVDAVTRIRTLVDRLNLNPPSKKSAK"
FT   gene            420869..422140
FT                   /locus_tag="Mmwyl1_0362"
FT   CDS_pept        420869..422140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0362"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bvi:Bcep1808_4333 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69300"
FT                   /db_xref="GOA:A6VS71"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS71"
FT                   /protein_id="ABR69300.1"
FT                   /translation="MTQSTTSTFAWQNRELITHWKSALDIIETKGQAVFTELFDYVEPQ
FT                   QGPLNGAIISIKDLFQVQGYKTQAGSVFLDGSLAQEDAEAVVALRKAGASLLGHTNMTE
FT                   LAYSGLGLNPHYGTPDNPINAGRITGGSTSGGAASVALGVADAALGTDTGGSLRIPAGF
FT                   CGLTGFKPSQQTVSRKGCLPLSNSLDSVGPIAKTVEECELLWQILSGTTTSSETAKSSD
FT                   ADELRIVVPTNFGMNDLDPLVEEGFVAKLAQLEAASITIEHRFIEALESYKNLPVWQFS
FT                   AFECHTFYGKNYDLDNAEIDPRVASRIARAKTINEEVFQQTQAARQAFIQQMANEEANT
FT                   LILLPTVAVVAPKFSDLEQDADYDRLNLLCLRNTSLANVLNGCSISLPFSFKQEPMGLM
FT                   LTAANGQDQALLSLAKKWQAILSR"
FT   gene            422397..422978
FT                   /locus_tag="Mmwyl1_0363"
FT   CDS_pept        422397..422978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0363"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   pat:Patl_3463 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69301"
FT                   /db_xref="GOA:A6VS72"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS72"
FT                   /protein_id="ABR69301.1"
FT                   /translation="MNKLITLLLKGLVAVLPIGLTVYLIYWLLATGEAIAQPLLLLLIP
FT                   DVLYFPGLGLIASLAMLVLTGFLVNLYGFRYLVKLSHNIFERIPLVKSIYGAIKDMMMV
FT                   FNLAEKKEMKSVVSIEWNGAQVIGFITGEQTGQQLFGEQDLVGVYVPLSYQIGGMTLYI
FT                   SRDRLTELDIGVEEAMRLALTAGVQSRPKS"
FT   gene            423082..424317
FT                   /locus_tag="Mmwyl1_0364"
FT   CDS_pept        423082..424317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0364"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: cvi:CV2851
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69302"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS73"
FT                   /protein_id="ABR69302.1"
FT                   /translation="MQEAAQTQKTVIVVGAGPAGLMAAEGICALGHQVHVYDAKPSACR
FT                   KFLLAGVGGMNITHSEAYPEFIQRYYDKAEWLNTSISQFDADALCEWIHNLGIETFVGT
FT                   SGRVFPKDMKAAPLLRNWLKRLREAGVQFHMRHKMVGLSANEVVFDHVGESVMAQADAI
FT                   VLAMGGASWPKLGSDGAWLPILAEKGIDVAPLQSANCGFYSEWSEHLKTKFAGTPLKDV
FT                   AFSFTLKDGQVVTKKGECIVTQDGMEGSLIYAFSKYLRDGINASGQSSLLMDFLPLQSE
FT                   AQVIKKLRNTKPKESFSKYLKRTLSITGVKAVLLHESFPKEAFQTPESLARCLKAVPVS
FT                   FYKTKPIEEVISSAGGVCESSVDDKLMLKAMSGVFCAGEMLDWEAPTGGYLLTACFATG
FT                   HLVAQGVGEYLA"
FT   gene            complement(424489..425034)
FT                   /locus_tag="Mmwyl1_0365"
FT   CDS_pept        complement(424489..425034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0365"
FT                   /product="OmpA domain protein transmembrane
FT                   region-containing protein"
FT                   /note="PFAM: OmpA domain protein transmembrane
FT                   region-containing protein; KEGG: pca:Pcar_0547 conserved
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69303"
FT                   /db_xref="GOA:A6VS74"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS74"
FT                   /protein_id="ABR69303.1"
FT                   /translation="MSTSFKKRTLFSGVLIASSLATMAYAETPKQGLTVTPSIGYYNTD
FT                   SDRQAGNDTSYSIGVGYQTNSPLALEAVYLHSNASKHGRNNDLDQYRVDGLYSLPEFTT
FT                   VNLTPYVAAGVGVTDVDGDSNNLLVNAGGGVKYAINSDVDLRADFRLVKDIEDSHLDNV
FT                   TSVGVQYNFGMPNQQASN"
FT   sig_peptide     complement(424954..425034)
FT                   /locus_tag="Mmwyl1_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 27"
FT   gene            complement(425491..426570)
FT                   /locus_tag="Mmwyl1_0366"
FT   CDS_pept        complement(425491..426570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0366"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA domain protein transmembrane
FT                   region-containing protein; OmpA/MotB domain protein; OmpF
FT                   family protein; KEGG: gsu:GSU0810 OmpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69304"
FT                   /db_xref="GOA:A6VS75"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS75"
FT                   /protein_id="ABR69304.1"
FT                   /translation="MSFNIAKRTLLSSIIAASSVSTLALAQQQEGFTITPSIGYYNMDS
FT                   DRDIKDDKAYSLGLGYQFNNPWAVEFVYLNADSKQAGNNVDVDQYRLDGLYHLPTISNV
FT                   NLTPYLAAGVGTTDFSNASGHDNVQVNAGGGLKYALNDTVSLRADFRLVNDVEDHHLDN
FT                   VTSLGVQMTFGGSSRNSTSNDDDYTPVEQTSYTQVEPAAQPQQATQPEVISSEPAEQVQ
FT                   EEPITASPMAEETTQQPEIVAEPPGKINIQFGLNKTNVEQKFYPEIEKIAIFLKENPGS
FT                   TVMIEGHTDNSGAASYNQKLSEKRAKAIAEVLTNTFEISATRVEAIGYGEERPFVENDT
FT                   EAHREANRRVVAIISTSEV"
FT   sig_peptide     complement(426490..426570)
FT                   /locus_tag="Mmwyl1_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            complement(426881..427777)
FT                   /locus_tag="Mmwyl1_0367"
FT   CDS_pept        complement(426881..427777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0367"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bam:Bamb_5305 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69305"
FT                   /db_xref="GOA:A6VS76"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS76"
FT                   /protein_id="ABR69305.1"
FT                   /translation="MQLDVIVIGGSFAGLSAAMQLARGQRKVTVIDAGEPRNRFSDESH
FT                   GFFGLDGVSPFAIQQEAYRQLLKYPTADIIKGKAVAVEKKPSAFHVTLEDNTSLHSKKL
FT                   ILATGLRDELPAIPGLKERWGATVIHCPYCHGYEVRNQPLGVIATSPLSTHQAGMIPDW
FT                   GPTTYFTQGLYKPDEEQRAFLLKRGVTIESTPVVEVLGRAPEISSVYLADGRTIRLAAL
FT                   FVGPKTHMASPFAEQLGCEFEEGPLGLVIKTDPFKQTSVEGVFAAGDASNPMQNATLAS
FT                   ASGVMAGVGAHQSLMHD"
FT   gene            427913..428371
FT                   /locus_tag="Mmwyl1_0368"
FT   CDS_pept        427913..428371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0368"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix type 11 domain protein; KEGG:
FT                   shn:Shewana3_2538 transcriptional regulator, BadM/Rrf2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69306"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS77"
FT                   /protein_id="ABR69306.1"
FT                   /translation="MRFLMRKDSRLSRMLHVLIHMNQLDAPATSEKIASMLNTNPVVVR
FT                   RTMAGLRDKGYVSSVKGHGGGWSLAISLSDITLLDIHNAIGESSVFTIGLSDEHTSCPI
FT                   EIAVNQAISDVLIEAEALLLERFRDVTLEMLAVGFADYPLNQQASSGE"
FT   gene            428376..429065
FT                   /locus_tag="Mmwyl1_0369"
FT   CDS_pept        428376..429065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0369"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   mlo:mll3208 transcriptional regulator, (DeoR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69307"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS78"
FT                   /protein_id="ABR69307.1"
FT                   /translation="MVRSQRLLTLIGLLRSHRYPVSGKTLAEKLNVSLRTLYRDIASLQ
FT                   EQGANIEGEAGVGYVLKPGFLLPPLMFTEEEIEALVLGARWVTQRTDNQLSNGAQNALN
FT                   KIASVLPAELKDILDDTSLLIGPGKESATDTVDMAEVRQAIRDEKILSIEYRDLKGKQS
FT                   QRRIWPFALGYFDEVRVLVAWCELRQEIRNFRTDRILSCELINTRYATPRHVLLKQWRE
FT                   TLGNKPS"
FT   gene            429187..429576
FT                   /locus_tag="Mmwyl1_0370"
FT   CDS_pept        429187..429576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0370"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: asa:ASA_0006 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69308"
FT                   /db_xref="GOA:A6VS79"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS79"
FT                   /protein_id="ABR69308.1"
FT                   /translation="MDLSNFTILYVDNVQRSMNFYRPLFEREPVEATESFALFVSETGA
FT                   KFGLWAREDVLPTATDVPAGSMEVALSLDNLITLQIHYIKWRELGVDIIQEPTAMDFGT
FT                   TFTALDPDGHRLRVYTYEKAEQEKV"
FT   gene            429804..430595
FT                   /locus_tag="Mmwyl1_0371"
FT   CDS_pept        429804..430595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0371"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: sit:TM1040_3169 extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69309"
FT                   /db_xref="GOA:A6VS80"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS80"
FT                   /protein_id="ABR69309.1"
FT                   /translation="MLPTYFISHGGGPWPYIPDMRAMFSNLEASLVRMTQELPEKPKAI
FT                   LMISGHWERKTFGVQSNSAPGMEYDYYGFPAHTYEVKYQAPGAPDVAARVAELIKGAGF
FT                   PVDLDDKKGFDHGAFAPMAVMYPEEDMPLIQLSLKSNLDPEEHLALGRALAPLREEGVL
FT                   IVGSGLSFHNLGLRGPQAIKPSNAFDAWLQETLLETAPAERSANLVEWDKAPYARICHP
FT                   REDHLIPLMVALGAAEDGKATCVYHDEGLFGGWTASSFRFD"
FT   gene            complement(430592..430927)
FT                   /locus_tag="Mmwyl1_0372"
FT   CDS_pept        complement(430592..430927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69310"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS81"
FT                   /protein_id="ABR69310.1"
FT                   /translation="MATFTQTDPLEQPTESLEQNRKAFAVSLSTFEQDHTEVVSHMQAI
FT                   VDILLKQKQFAEALKEIEQLKGLAASNKKVKIAMLEMKGRIKQVGARSGFRSRATKKYA
FT                   TKKPKSV"
FT   gene            complement(431048..431929)
FT                   /locus_tag="Mmwyl1_0373"
FT   CDS_pept        complement(431048..431929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69311"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS82"
FT                   /protein_id="ABR69311.1"
FT                   /translation="MTLSKREDFRNKGVLKLSNVIDIEKIVEVQSHLWQEVKHKFSIDI
FT                   DEPSTWFANPSNPIGDTRAKRLNGMGSIMRDLKASGKLDVIEGEIQSAIDLVFGAQSWQ
FT                   PLDLWYSLLSFPGSESAWNVPHKSWHNDEPTVVGDAEPWSLFVFVFLDEVRTEMGATSV
FT                   VSGSHRRIASLANTLGTCHNEALIDAFKSVNSGLFESPKDVKLLPMDQVLEPLIQQDTW
FT                   FQALLKEDSADKRIQRFMKEGSTLDDIEQKVVTLTGVAGDIIVFDPRCLHTFSANVSGL
FT                   PRQVLRIDFRRQ"
FT   gene            complement(432045..432698)
FT                   /locus_tag="Mmwyl1_0374"
FT   CDS_pept        complement(432045..432698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0374"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ppr:PBPRB1103 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69312"
FT                   /db_xref="GOA:A6VS83"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS83"
FT                   /protein_id="ABR69312.1"
FT                   /translation="MKLIIGNKNYSSWSLRGWLALKAFNIPFEEIKLSLFSEEFHSELA
FT                   KYSPVGKVPVLVDGDLSVWDSLAICEYINENYLDGKGWPEDKNSRAVARSIVADMHSGL
FT                   FGIRNEMPMNCRAKRRVELSNNAQKEVANLDALWSDLRSKHIKDGDYLFGTFSLADVFF
FT                   APVVFRFSTYGITLSDAASTYCKTMLAHPDMQAWFKDSVAEVEIVSQAETGKAV"
FT   gene            complement(433562..435286)
FT                   /locus_tag="Mmwyl1_0375"
FT   CDS_pept        complement(433562..435286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0375"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hch:HCH_06973 ABC-type sugar transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69313"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS84"
FT                   /protein_id="ABR69313.1"
FT                   /translation="MHYNKKKIALAALPFAVMMHSATLWADAYSDAAEKWVDTEFTVST
FT                   LSKQQQLDELHWFTEAAKKFRGMEINVASETLTTHKYESQVLAKAFTEITGIKVNHDLI
FT                   QEGDVVEKLQTQMQSGRNIYDAYVNDSDLIGTHFRYGKVVPISDMMQGDGKDFTSPTLD
FT                   LADFIGLDFTTGPDGKLYQLPTQQFANLYWFRADWFARPDLKAKFKSIYGYDLGVPVNW
FT                   SAYEDIAEFFTDKVKNIDGERVYGHMDYGKKDPSLGWRFTDAWFSMAGAGDKGIPNGLP
FT                   VDEWGIRIKDACSPVGSSVSRGGATNGPAAVYATTKYVDWLRKYAPPEAQGMTFSESGP
FT                   VPAQGAVAQQIFWYTAFTADMTAKGLPVVNEDGTPKWRMAPSPVGPYWEEGMKKGYQDV
FT                   GAWTFMNSTPEDRRLAAWLYAQFTTAKTVSLKKTLVGLTPIRESDINSPEMAAAAPKLG
FT                   GLVEFYKGPARKEWSPTGINVPDYPKLAQLWWQYISQAASGEATPQEALNGLAAAQDKV
FT                   MERLERANVQPICGPKMNKPRDEAYWLAQPGAPKPKLANEKPQGVTVSYDDLLRSWE"
FT   sig_peptide     complement(435206..435286)
FT                   /locus_tag="Mmwyl1_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            complement(435391..435663)
FT                   /locus_tag="Mmwyl1_0376"
FT   CDS_pept        complement(435391..435663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_3631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69314"
FT                   /db_xref="GOA:A6VS85"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS85"
FT                   /protein_id="ABR69314.1"
FT                   /translation="MAWMSWTLPTALFFIGIAVILVGMTTWQLISPCVERRGFLPLATT
FT                   RGDRLFIGLLSSAFIHLAFVALTDVNIAVATVLCAFWMIILMRWG"
FT   gene            complement(435675..436568)
FT                   /locus_tag="Mmwyl1_0377"
FT   CDS_pept        complement(435675..436568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0377"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hch:HCH_06970 ABC-type
FT                   sugar transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69315"
FT                   /db_xref="GOA:A6VS86"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS86"
FT                   /protein_id="ABR69315.1"
FT                   /translation="MTQSNTTMTRHNTAKKEQAPVYSKAERKTRNAHLRGRFGLVLYVV
FT                   LLLLPIYWLVNMSFKTNTEILSGLSFYPENFTLANYAKIFGDPTWYMGYVNSILYVSMN
FT                   MVISLVVALPAAYAFSRYKFIGDKHMFFWLLSNRMAPPAVFLLPFFQLYSSVGLFDTHI
FT                   AVALAHCLFNVPLAVWILEGFMSGVPREIDETAYIDGYSFPKFFMRIFIPLIRSGIGVT
FT                   AFFCFMFSWVELLLARTLTSVDAKPIAAIMTRTVSASGMDWGLLAAAGVLTILPGMLVI
FT                   YFVRNHVAKGFALGRV"
FT   gene            complement(436578..437447)
FT                   /locus_tag="Mmwyl1_0378"
FT   CDS_pept        complement(436578..437447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0378"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hch:HCH_06969 ABC-type
FT                   sugar transport system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69316"
FT                   /db_xref="GOA:A6VS87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS87"
FT                   /protein_id="ABR69316.1"
FT                   /translation="MQTKVENNKAWFLVLPVFLIVAFSAIIPLMTVVNYSVQDIFDPYT
FT                   RYFVGTEWFKQVMLDSRLHEALLRQFIYSFTILIIEVPLGICVALMMPTKGRGASLALI
FT                   LVAIPLLIPWNVVGTIWQIFGRADIGLFGAFMSSIGVDYNYASDPTDAWLTVVLMDVWH
FT                   WTPLVALLCYSGLRAIPEVYYQAARIDQASRWAVFRYIQLPKLTNVLIIGVLLRFMDSF
FT                   MIYTEPFVLTGGGPGSSTTFLSQSLVQQAIGQFDLGPAAAFSLVYFLIILLVCWVFYTT
FT                   IMNMQKDK"
FT   gene            complement(437437..438591)
FT                   /locus_tag="Mmwyl1_0379"
FT   CDS_pept        complement(437437..438591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0379"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hch:HCH_06968 ABC-type sugar transport system, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69317"
FT                   /db_xref="GOA:A6VS88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS88"
FT                   /protein_id="ABR69317.1"
FT                   /translation="MASITLNALAHTYTDNPTKPEDYAIREMSHVWEQGGAFALLGPSG
FT                   CGKSTLLNIISGLLEPSHGEVLFDGKRVNELKPEERNIAQVFQFPVVYDTMTVFDNLAF
FT                   PLRNIGVPEYKVKSKVYEVAEILELSDQLKRKAKGLSADQKQKVSMGRGLVRDDVSAIL
FT                   FDEPLTVIDPQLKWKLRRKLKQIHEQFNITMVYVTHDQLEASTFADKIAVMYNGQIVQF
FT                   GTPRELFENPAHTFVGYFIGSPGMNFFEAELKSQGEKEALMFGDHEITVSDAMLTRLKA
FT                   MGANKVTLGIRPEFVHVWDGKNNDAFSVEVDYVEDLGTYKILSFLFQGQVMKARLSEDQ
FT                   KVPSGQIYVSFPEQWTKVYVDEYLVEVIDQAHSEDSKKETDHAN"
FT   gene            complement(438594..439682)
FT                   /locus_tag="Mmwyl1_0380"
FT   CDS_pept        complement(438594..439682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0380"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hch:HCH_06967 ABC-type sugar transport system, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69318"
FT                   /db_xref="GOA:A6VS89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS89"
FT                   /protein_id="ABR69318.1"
FT                   /translation="MSLTLQNVSRVVEGETWIDNVNLSLEPGSFNVLLGRTLSGKTTLM
FT                   RLMAGLDRPTKGKILMNGVDVTGVPVRERNISMVYQQFINYPNLTVYENIASPLRLAKM
FT                   DEKEVDRRVRETAEMLRIDPFLDRLPLQLSGGQQQRTAMARALVKDSQIILFDEPLVNL
FT                   DYKLREELRQELRALFKARNCIAIYATTEPNEALALGGNTAVLNEGRLLQMGPTAEVYH
FT                   QPKDIITAEMFSEPPINVVPGRVSEEEVTFDDTVHFRLNSDLRRLTPGEYQFGVRASHI
FT                   GLVPHSDDDLELPVRVDLAEISGSETFLHVHNPHFDLVLHLSGVHAYQVDQEIKVYFPT
FT                   HKLYAFDAQGKMVHSPARMRDQ"
FT   gene            439998..441989
FT                   /locus_tag="Mmwyl1_0381"
FT   CDS_pept        439998..441989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0381"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; GAF domain protein; SMART: AAA ATPase; KEGG:
FT                   hch:HCH_06966 transcriptional activator of acetoin/glycerol
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69319"
FT                   /db_xref="GOA:A6VS90"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS90"
FT                   /protein_id="ABR69319.1"
FT                   /translation="MQDEEKQKQQKNEAAAESGLTQTHKERIQASWYRCEQFGLDHSSR
FT                   PDFATLPKGTLNDLIDQHRSLLETTENEVLPYYENILSNSACMIVLADRQGHVLNTWGQ
FT                   PRFGSASQHGLVGGNQWTEMGVGTNAIGTALITGEAIQVGRDEHFLRANRFMVGSASPI
FT                   YNTKNDLVGVLDISSDAYLPQDHTFGMVKLMSLSVENRLIFSAFQQEHFILSFNTNVVS
FT                   LDSHWSGILVLDENGTIVSANRRAEVVLAQDLALLNINQIFDIEMREIKHHPYSLPMKL
FT                   IAMGRYQFYVKVIPPVQQIMRIPDFRQRADYVAPPQAEAIVMNEKSPSVEKVKRQENVP
FT                   ISTIPDNVIPLAELQHGDERVARLVRQAHKIMEKDIPILIHGETGAGKEIFVRSLHYHS
FT                   SRSKEMLVAVNCAAIPAELVESELFGYEKGAFTGAQNRGSIGLIRRAHHGTLFLDEIGE
FT                   MPMAVQSRLLRVLQERVVTPLGSTEAFPVDIKLISATNRTLKDEVKEGRFRQDLYYRIS
FT                   GLNIELPALRERTDKAELIKYLHERLRKEEPGPALSQAMLDLLVTHPWPGNMRQLAHVL
FT                   KVGMAMADEEELEEWHLPDDFFDDLDVMTQADDSVEGSSQREQEEPLEQLIPRLLNEFK
FT                   GNVSQTAKTAGVSRNTVYKYSRPKENDV"
FT   gene            complement(442044..442445)
FT                   /locus_tag="Mmwyl1_0382"
FT   CDS_pept        complement(442044..442445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0382"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: hch:HCH_02009
FT                   putative translation initiation inhibitor, YjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69320"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS91"
FT                   /protein_id="ABR69320.1"
FT                   /translation="MSIKRINPPSLYDGTATGMSQATVDTDTGLVFISGQVDWDTDFQT
FT                   NNHDMKTQTANAAKHLITVLKAANSSVENILQLRVYVRGEVADHMEAIVPIIASTLGTS
FT                   RPALTGIGVASLASPETLIEIEAVAKVAR"
FT   gene            complement(442545..443432)
FT                   /locus_tag="Mmwyl1_0383"
FT   CDS_pept        complement(442545..443432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0383"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: hch:HCH_02007 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69321"
FT                   /db_xref="GOA:A6VS92"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS92"
FT                   /protein_id="ABR69321.1"
FT                   /translation="MIDKLEINHLRTLNALYQFSNISVAAEHLSVSQQAISLQLKKLRI
FT                   ILGDQLFVRTGHGMIPTPYAKEIESHIQQILIQINSIPPAKTLSPQQIERTLVICATDY
FT                   TQEVIVTDLIRELRQYAPKIKVIITNIEHANLTKKIHLGTIDLVFTTSAYVPEGLISTP
FT                   LFTEKYLCVTANTAIKRTHDLSLEQLTKHDFVIVSPGIGSFTGSADTWFEQQGFPRQVT
FT                   VSAPSFHMAKEILKYPDMVGFIPSRLLPYEGLFELPLEKYPPGYQVVAAHHPNAKNDLL
FT                   ISWLLDSIQKKFTN"
FT   gene            443544..444071
FT                   /locus_tag="Mmwyl1_0384"
FT   CDS_pept        443544..444071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_03037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69322"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS93"
FT                   /protein_id="ABR69322.1"
FT                   /translation="MLRQCLLGIVCVLLLASCSSYSVKNKQVSQNTISLPLLHGWHEGK
FT                   EVLYITTDVSDQAVAKAKNANYAPRLRDSVPHYPKPPQVKTVLERVYAFPNQEQAWSVF
FT                   ASVPEPLGYESQNTHYSPLWLMYVVVWKDPSKATELRSEEAILTAEDQGSVTIERTDIV
FT                   LNCPVIPFVKKK"
FT   sig_peptide     443544..443612
FT                   /locus_tag="Mmwyl1_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.720 at
FT                   residue 23"
FT   gene            complement(444238..444651)
FT                   /locus_tag="Mmwyl1_0385"
FT   CDS_pept        complement(444238..444651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69323"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS94"
FT                   /protein_id="ABR69323.1"
FT                   /translation="MGLKEKKAARDFQENNLEALKKKVFDAAKFEFEIEIDWDSISVDN
FT                   YSHLYNQTWTQIYFEPMIIAFSKMCADSFSQEAIQDDLKKVVIQNVGDISNANKYSSYS
FT                   NGVLTLNHSPIANAENQIEDRAKALQDTVEDAL"
FT   gene            complement(444703..445350)
FT                   /locus_tag="Mmwyl1_0386"
FT   CDS_pept        complement(444703..445350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69324"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS95"
FT                   /protein_id="ABR69324.1"
FT                   /translation="MKNYINDIVLSSPKQLLERFQQSKSDYGTEFHITIADRYNNRYSG
FT                   FFVKFDSELKIVLLTDKEHEISFIDTDSIVNIAIYDFAKHERFLLGQEPIKQVSAFKAD
FT                   TVEDCLALLKSTLQKTHSLDFNFTVDEVKPANLDKIKAILEALGDTLMEVASDDFSKEY
FT                   LSQITDFYIKNEARDGIRFRKTNTTILVRFNFEEELPADLQTKIENGINDAF"
FT   gene            445970..446944
FT                   /locus_tag="Mmwyl1_0387"
FT   CDS_pept        445970..446944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0387"
FT                   /product="Domain of unknown function DUF1852"
FT                   /note="PFAM: Domain of unknown function DUF1852; KEGG:
FT                   vpa:VP1992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69325"
FT                   /db_xref="InterPro:IPR015004"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS96"
FT                   /protein_id="ABR69325.1"
FT                   /translation="MNNSFTFTIKSICFDESYRPSDNTRITTNFANLARGERRQENLRD
FT                   ALRMINNRFNALAHWDNAKGDRYSVELEIVSVDVDIEGNGQTFPTIEILKTNILDHHTD
FT                   QRIEGIVGNNFSSYVRDYDFSVVLPNHNKGQKEFSIPDNFGDLHGKLFKSFVKSDSFKE
FT                   KFTKPPVICLSVSDNKTYQRTGNQHPVLGVEYQPNSTSLTEQYFHKMGLQVRYFMPANS
FT                   AAPLAFYFVGDLLNDYSNLELIGTISTMETFQKIYRPEIYNANAVAGKSYQPNLNNSDH
FT                   SLTQIVYDREERSQLASEQGKFAEQHFIKPYQRVLEQWSANYA"
FT   gene            447002..448069
FT                   /locus_tag="Mmwyl1_0388"
FT   CDS_pept        447002..448069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0388"
FT                   /product="Methionine synthase vitamin-B12 independent"
FT                   /note="PFAM: Methionine synthase vitamin-B12 independent;
FT                   Cobalamin-independent synthase MetE domain protein; KEGG:
FT                   pen:PSEEN2747
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69326"
FT                   /db_xref="GOA:A6VS97"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR016456"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS97"
FT                   /protein_id="ABR69326.1"
FT                   /translation="MKTVIEKTGTNNTLLPTSTAGSLPKPTWLAEPETLWSPWKLEGDQ
FT                   LIDGKQDALRISLQEQQQAGIDIVSDGEQTRQHFVTTFIEHLSGVDFENRKTVRIRDRY
FT                   DASVPTVVGPVSRIKPVFVEDAKFLRQQTKQPIKWALPGPMTMIDTLYDDHYKSREKLA
FT                   WEFAKILNQEAKELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHI
FT                   CYGYGIKANTDWKKTLGSEWRQYEEAFPKLQKSNIDIISLECHNSHVPMELLELIRGKK
FT                   VMVGAIDVANHAIETPEDVANTLRKALQFVDADKLYPCTNCGMAPLPRAVARGKLHALT
FT                   AGADIIRKELALSLN"
FT   gene            complement(448186..449112)
FT                   /locus_tag="Mmwyl1_0389"
FT   CDS_pept        complement(448186..449112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0389"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_B0402 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69327"
FT                   /db_xref="GOA:A6VS98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS98"
FT                   /protein_id="ABR69327.1"
FT                   /translation="MIDPLSSIVTLLQPKAAFSKVVHAAGKWRIRREEIGNPFYCVVLE
FT                   GSCEFTLKGDEPIYLTAGDFVLVPEAHAFTVASSHPPALTDADTVPIKTAASTYFAGEA
FT                   EQELNAHLLIGHCQFEAPDSKILISLLPKLVHLREAKRLATLVELVIEESLAQRPGRDS
FT                   VLARLLEILLIEAFRTKMDTPEVPGLLVGLADERLAMAIRKIHQDVSKAWTIDQLAKEA
FT                   SLSRSSFFQRFSKAVGYTPMEYVIAWRMAIAKDLLRRQTFTMATIAERIGYQSASAFSS
FT                   AFSKYTGQAPSKFLLEDALVDRESREV"
FT   gene            449208..450164
FT                   /locus_tag="Mmwyl1_0390"
FT   CDS_pept        449208..450164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_pAT_397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69328"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VS99"
FT                   /protein_id="ABR69328.1"
FT                   /translation="MNNLVTESKNIPESNRQLTLSISPITLTVEGRETPLELRITLPVS
FT                   GDDIPIILFSHGHGPSSYLSSKEGYAPLVNYYAEQGFAVIQPTHASSRVAGLGNNHPEA
FT                   PLFLNQRVHEMKTILDSLAQIECDTPYLAGRLDKKRIAIVGHSLGSMTASMLMGMTLLT
FT                   PESKSVLDKRIKAGVLLATVGKGGDDLIESVRERWPAFNPDYSTMVTRNLVVCGDEDLS
FT                   PHFTTRGADWHTDSYHMSPASDFLLTLIGGKHGLGGIAGYDAKETDDEDPDRLAITQKM
FT                   TLAYLKSALYEKDNAWEQACEALQAFASKHASVESKH"
FT   gene            complement(450300..451349)
FT                   /locus_tag="Mmwyl1_0391"
FT   CDS_pept        complement(450300..451349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0391"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   sde:Sde_2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69329"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA0"
FT                   /protein_id="ABR69329.1"
FT                   /translation="MPSDDFIDLLKLLIRAPSVVGAEHSFFRVLQRELEERGAKVTWYE
FT                   GLLVAQGSDPFSTMFSAHIDRHGLVCTGPNEFQYAAFVSANRTDLLNNSVSEELMTKVT
FT                   ERFNHEEIYAYEPWSGVYRGKGTIKSSYVCEFRNNLIFETEGLEGVVAGTPIAFKDQLH
FT                   VVDNRLEGQLDNVISAAALVHLFDHGFKGTAFFTAQEEAGKSWRYLLEWFRRFGGSTNR
FT                   LFVVDTSPFPNLDAANEQLLVLREKDANATFNKDSTKLLEELCEKNNISYLYKNRYVEN
FT                   ENAKRAEQGLPPSSLGSTELGRIIAASNGLVDGTTIQIPTIGYHTMHESAAVESVDAFL
FT                   NMLKVVSNI"
FT   gene            complement(451432..452382)
FT                   /locus_tag="Mmwyl1_0392"
FT   CDS_pept        complement(451432..452382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0392"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: aav:Aave_0658 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69330"
FT                   /db_xref="GOA:A6VSA1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA1"
FT                   /protein_id="ABR69330.1"
FT                   /translation="MAFLVNKNALTAVTNLQSGWQRQAISSQLGECYIDRFVIEPGLSI
FT                   AYSRYTPTQDLIEESTIEKDSSTLSLTYGLEGYSRYQPKQNNTEDFIFEPNYTTITTFG
FT                   NSSGKRVYTANKTTSQLRILVDGSVFNRYQIPFEFQADKIPLPRQHQHIKTSKNTQHYI
FT                   NRLIHLALSAHTERPLEKNILVLNLLSEQLERLQTNTMIEPQSLGISLEDEHKIAQARL
FT                   FMIQHMSQPLSIAFICQKIGISESKLKQGFNAIYNTSPYKLLLEARMHKAWELLTSGYQ
FT                   VAQTAYAVGYEHPSNFSAAFNRFYGCPPKSITSSK"
FT   gene            452529..454541
FT                   /locus_tag="Mmwyl1_0393"
FT   CDS_pept        452529..454541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0393"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: aav:Aave_0657 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69331"
FT                   /db_xref="GOA:A6VSA2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA2"
FT                   /protein_id="ABR69331.1"
FT                   /translation="MKQKTLSKIELMIGALVLLPVSVLAQEDTGQKSTTLLPELMVTAD
FT                   KKQQTLSKATSHATVYDTEVLQQDGVDSLAKLEGRVAGLSFQPFGQSGINSPVIRGLTA
FT                   NFNALSSSTLLMVDGVPTLTAQGFENNLVDIDRVEVLRGPQSTVYGRNAEVGVISIFSN
FT                   DLVGEDRTILGVEAGSRDKQRVQLSTSQTLVEDEVYISLSGEFLKQDGFIDNATKGSKA
FT                   DDKERRNLNAGLRWLISDKTDVVVRYRRQAYDDGAMLWGVPRGKRATVASATDSWNHSV
FT                   GQTFSINANHELPSGVRLNSVTAYNDYRDKVQQDTDFQPAERTYIGRDHHLRTLSQEFR
FT                   LEGNLGEADWLFGAYLERQDHDLRTLSKTFFGLSDLQAQQTGNSYALFTNWTMPISSDL
FT                   SVIAGIRASRDEVKLNPSIGQEKSESWTDLTPQLTLKYDINSDHMLYASYAEGIRSGGF
FT                   NTVSPAVNYSSYDPEKNQSFELGLKGDLSDKPLRYTLSAYHMDIKNMQVSQMPTVGLIY
FT                   LTNAADATSDGLEASLEYYFNESWSTEIGVAWSKTRFDRFIDGNNDYSGNRNPFAPEMN
FT                   GHLSLRYEDVGGWSVAASLVGSSAVYLDAANKYQQKGYELVHVSASYPLTDKASLSAYV
FT                   NNLQDRQYDAVGYQNGYVTVYSPPRECGVKFTLEL"
FT   sig_peptide     452529..452606
FT                   /locus_tag="Mmwyl1_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            454555..455598
FT                   /locus_tag="Mmwyl1_0394"
FT   CDS_pept        454555..455598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0394"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: O-methyltransferase family 2;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   aav:Aave_0656 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69332"
FT                   /db_xref="GOA:A6VSA3"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA3"
FT                   /protein_id="ABR69332.1"
FT                   /translation="MTKLDCHELDCHELQKFWDLAGSQVKIKALEVALSRSLFDLLLEP
FT                   CSIEEIAHKLAMPSTNIKGWIDLLWSMGCVDTAIDNKYITSALAKRYMTSVSVMDCSQA
FT                   LQFRFQTLRHFTEQFEALLYVPKNRNALSSAMAPLWAKAAKAQIFQEQRAVTVPALDRI
FT                   LDRVLNVTIAEETPLHFLDLGGGPGLVALSLARRFPNSTGVLFDFPETVKVAYKNIMAE
FT                   GLEHRIEVQAGDLNKQSPNSQFDLIWCSSVLHFLDDATEAIKRISALLKPNGILLILHA
FT                   EQTAEKKQCEGVLPFYLPMVMKGNYLPKQGEIAALLDQNGLDVLQSEEITDFPMAPVKL
FT                   YCGRKVE"
FT   gene            455595..456830
FT                   /locus_tag="Mmwyl1_0395"
FT   CDS_pept        455595..456830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0395"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aav:Aave_0655 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69333"
FT                   /db_xref="GOA:A6VSA4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA4"
FT                   /protein_id="ABR69333.1"
FT                   /translation="MITLPYFYLHWVIGWCNFTLTASSIYLYLGVPLMMREYGWSGTEI
FT                   GLFQVSGLPVMLKFLMASPIDIFRFRQSNYLKWSVLLGGGFIGCLTMLSLADIEITTFK
FT                   TLFVIAVCTTLITSWLDVPINAFAIQRFPENERPKTGAIRSAVTALASVVGGGAMLLVY
FT                   SRFGWAWPFYIFGLMALLCGVLLYIAHVRYPLIESESFNSENPSTVTSRGSLFIMWKGY
FT                   FQRLDMVMWNIILVLYFPFIGAAWLYLKPVMLDLGLSIDSIAWIASCSGVFAAISGFCY
FT                   SLCIARISPYRALFAFSVVNVIALLGMCLAVAMEWSDWRLICAVFVVAIALGLSSGVLF
FT                   GLIMIHSRPQLSASDYGLQTSLFSLSRILVPISAGIILDRMGYVGMFAWLVVGALLACG
FT                   LSFYWMFKKEKS"
FT   gene            456827..457102
FT                   /locus_tag="Mmwyl1_0396"
FT   CDS_pept        456827..457102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69334"
FT                   /db_xref="GOA:A6VSA5"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA5"
FT                   /protein_id="ABR69334.1"
FT                   /translation="MINDKTNQLDLGPNEPTRQELMKVAPKKWKMMLLVWLSIYPLLNI
FT                   FFPLLTPYIGGFPLPIRLLVMTIIIVPIMSFILGSLQKRFFFWLRK"
FT   gene            457262..458575
FT                   /locus_tag="Mmwyl1_0397"
FT   CDS_pept        457262..458575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0397"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: chemotaxis
FT                   sensory transducer; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; KEGG: sbl:Sbal_3371 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69335"
FT                   /db_xref="GOA:A6VSA6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA6"
FT                   /protein_id="ABR69335.1"
FT                   /translation="MLFGNNKLLTRITELERELHSFQETQADLRQEMLYFSMTPDGKIV
FT                   DANTLFIKSCGFEKTELTGKSIKDLVLKKSLDKDHCKKMLSAISGKKHWHGALQVEDRN
FT                   GKEVWYRATIQPKKIAGSSAVLEVYATELTRTIAHSKEVEDMLKALNRSSAVIEFSLDG
FT                   IILNANDNFLNSMSYSKSQIVGKHHKIFCDAKDVESQEYKDFWQRLRSGEFVSDRFKRI
FT                   DSRGNEVWLEASYNPIHDENGDLYKVAKFATVITEQMNREFAISETSEVAYEISKKSDQ
FT                   DAINGKKVIESTIQTMDELAEQMGDASKGIIELNTQSLKVAALVESIRGIADQTNLLAL
FT                   NAAIEAARAGEQGRGFAVVADEVRQLASRTSTATEEIIKVVSENKNLTEKAVSLIEQSM
FT                   DKAHKALDLSTEAGNVMNGIQIGARQVVDAVGQFNNKL"
FT   gene            complement(458664..459782)
FT                   /locus_tag="Mmwyl1_0398"
FT   CDS_pept        complement(458664..459782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0398"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pen:PSEEN0052 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69336"
FT                   /db_xref="GOA:A6VSA7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA7"
FT                   /protein_id="ABR69336.1"
FT                   /translation="MSASFTNNSDQNGEPSPFNHPIKGRGTANNMAGRFAITLVEVDEN
FT                   DEAIALLETSSPKTEVRYERAKSIISRNSSPDIPFRLSVNPYKGCEHGCVYCFARPTHA
FT                   YLDLSPGLDFETKLVAKTNAPFLFEEELAHPNYRCEPIALGINTDAYQPIEKQLKITRQ
FT                   LLEIALAHNQPISLITKSTLILRDIDLLSQMAAKKLIHVAISVTTLNNDLKRILEPRTA
FT                   SGKTRLQVIKTLREAGIPVSVLVAPVIPFINDNELEEIVAACAEVGAQSVNYIMLRLPH
FT                   EVAPLFADWLHQHYPDRAEHVLQRIMDMRGGKLYNSQFGKRMTGEGIFADLINQRFHIA
FT                   RRKHGLDNHRLSYLDCRHFSVPPKEGDQMALF"
FT   gene            459948..460709
FT                   /locus_tag="Mmwyl1_0399"
FT   CDS_pept        459948..460709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0399"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: ent:Ent638_3166 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69337"
FT                   /db_xref="GOA:A6VSA8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSA8"
FT                   /protein_id="ABR69337.1"
FT                   /translation="MLFQNNHLPNSVVAYAQDYEHGKFEPYHAHNCAQLIHTLSGVIRV
FT                   ETRFGSWVIPPNRGMWIPAGVEHSLSMIGLVKVRTLFIDPLARADLPHDCSVIDVSMLL
FT                   KALIIEALELPDDIVSGGRDERIVELILDELRRLSNVSFYVPSPSSDALVSLCEHISQR
FT                   IAHDWTNADGAHILGISERSVTRKFQQEMSLTFAEWLRRKRLLLALEYLASGKSVLDTA
FT                   ILIGYDSPSAFSAMFKSRVGVSPTDYLLQSQ"
FT   gene            complement(460733..462409)
FT                   /locus_tag="Mmwyl1_0400"
FT   CDS_pept        complement(460733..462409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0400"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: ent:Ent638_3165 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69338"
FT                   /db_xref="GOA:A6VSA9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VSA9"
FT                   /protein_id="ABR69338.1"
FT                   /translation="MLTQPSIKYRPAQIIDFPARTWPSKQLKTPPRWCSTDLRDGNQAL
FT                   ANPMDHVKKMAFFKHLIECGFKEIEVAFPAASQTDFDFVRLLIEGKHIPDDVTIQVMTQ
FT                   SRVDLIERTIQSLVGAKKAIVHIYNATAPVFREIVFCQDKPATLELAVQGVKHIRQLCE
FT                   QYPDTQWTLQYSPETFCFTEPDFALEVCEAAAKTWQPSLERPMILNLPTTVEVNTPNVF
FT                   ADQIEHFITSFSSLENITISVHPHNDRGTGVATAEMAILAGAQRVEGCLFGNGERTGNV
FT                   DLVTLAMNLYSQGVYPNLDFSDMRRTVELVEECNELPVHPRHPYAGALAFTAFSGSHQD
FT                   AIKKGFASQKSTSSMIWQIPYLPLDPKDIGCTYEEVIRVNSQSGKSGAAWLLQENHGLF
FT                   LPRKLQIDFSKKVKNHTDQTGHEMPLADVWRLFRESYRLNPDDKGQMKLMDYRSHSSNG
FT                   LQEIRATLRYQEKTWQLVGEGKGLLSAMLDALRKRFNWQINISDFHEHTLGQQTKSKAV
FT                   SYVQIESDQATPSFGVAIDEDSTKASLQALINACHPLYKEA"
FT   gene            complement(462751..463641)
FT                   /locus_tag="Mmwyl1_0401"
FT   CDS_pept        complement(462751..463641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0401"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ilo:IL2065 signaling protein with
FT                   a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69339"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB0"
FT                   /protein_id="ABR69339.1"
FT                   /translation="MASFTNQQLQLIIAQLDQAIFNHDQWYKHILRILILRIPPEKADI
FT                   APEAHRHCHFGQWYESSQAFFIRENPAFISLGDAHKKMHISAQNLLQKISDGLLILSID
FT                   WDSFDKDIDKMRLAFQSLRHEFTVIAKNRDPLTEAQTRDGMLAEISDQNALVQRGQQNC
FT                   ALVMFDLDHFKQVNDTYGHIAGDLVLVSTVQRIKTLLRPYDRIYRYGGEEFIICMPRTT
FT                   LAQAHMVAERMREAIAEQNIQFDNSRESLRVTASFGVTILTQLRSVEESIDYVDKAMYE
FT                   AKRAGRNRVVDDVNL"
FT   gene            complement(463851..464909)
FT                   /locus_tag="Mmwyl1_0402"
FT   CDS_pept        complement(463851..464909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0402"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   rde:RD1_3479 putative hemin ABC transport protein, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69340"
FT                   /db_xref="GOA:A6VSB1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB1"
FT                   /protein_id="ABR69340.1"
FT                   /translation="MKPAHKKLTIMGRVPLPALLIMLSISLLLLMGVAIGVGSVSIGQS
FT                   TVWSVIGHKLSITNTTPSWSMGRENIIWAVRLPRTLLAAMVGAALAIVGAALQSVTRNP
FT                   LADPHLLGVSSGAALGAIIALLHTGMILGVVTVPVFAFLGALLAMVLVLAVANFSSAHS
FT                   AGRLILAGVAVAFVLTALGNLFIFTGDHRSSHTVIFWMLGGLGLAQWGQLWFPLVALVL
FT                   GSGYLIYNARYLNAMTLGDESASTLGVPVERFRLIVIVVCALLTGAAVAFSGVIGFVGL
FT                   MVPHIVRLLVGGDYRKVLPLSALVGALFLVAADIASRIIMPPEDMPIGILTGLVGGIAF
FT                   VFLMRQKRNASL"
FT   sig_peptide     complement(464799..464909)
FT                   /locus_tag="Mmwyl1_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.775 at
FT                   residue 37"
FT   gene            complement(464906..465889)
FT                   /locus_tag="Mmwyl1_0403"
FT   CDS_pept        complement(464906..465889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0403"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   rde:RD1_3480 putative iron ABC transporter, periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69341"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB2"
FT                   /protein_id="ABR69341.1"
FT                   /translation="MTANVKTTIKRTSLLISGALFGILHTGLASASGYPVTVQSCDRQV
FT                   TFDHAPKAAVSNDVNLTEMMLALGLQDHMAGFTGVSGWKTLDPTLRNGIGELKELSPKY
FT                   PSKEVLLGADADFYFAGWNYGMRVGGGVTPDTLAPLDIKVYELTESCIHIMDKAKVSMD
FT                   DLYVDLLNLGRIFGKEEQSQRLVKGYQEDLANFQANLAPLKTAPKVFVYDSGEEQPFTS
FT                   GRFGMPTALIEAAGGKNIVDDVQKSWTQIGWEAVIDRAPEVIIIVNYGDVTAEQKINFL
FT                   RSNPAFENIPAVKNNHFVVLEYVEATPGPRNIKAIKRLAEAFRTTL"
FT   sig_peptide     complement(465794..465889)
FT                   /locus_tag="Mmwyl1_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 32"
FT   gene            complement(465914..466765)
FT                   /locus_tag="Mmwyl1_0404"
FT   CDS_pept        complement(465914..466765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0404"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO0998 Fe uptake system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69342"
FT                   /db_xref="GOA:A6VSB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB3"
FT                   /protein_id="ABR69342.1"
FT                   /translation="MISATPSTSPNDKQKDDASYAFFSGCLPAGMQLKDVAWSPYRDKA
FT                   LLKPITVNIQPGEFLAIVGPNGSGKTSLLRCLYRTNKPSNGTVLLDGKDLWSLSPRQCA
FT                   QRIATVLQDTGGEFGLSVFEMVEIGLTPKSLVWGRSEEDTHIIESTLALLDVAHLAERS
FT                   FDSLSGGERQRVMIARALAQRPDILILDEPTNHLDIRHQLDVLALLSKLPCTLIVSLHD
FT                   LALASAYADRVLVMLEGEMQACAPPSHVFTKQRIKQVFDVETIIDEHPITQRPRFSFFI
FT                   ND"
FT   gene            complement(467000..468016)
FT                   /locus_tag="Mmwyl1_0405"
FT   CDS_pept        complement(467000..468016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0405"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: Transcriptional activator PspF; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   SMART: AAA ATPase; KEGG: hch:HCH_05441 psp operon
FT                   transcription activator PspF (sigma 54-dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69343"
FT                   /db_xref="GOA:A6VSB4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014317"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB4"
FT                   /protein_id="ABR69343.1"
FT                   /translation="MNNNQRVIGSSQALADTLDHASILAEINRPILICGERGSGKELIA
FT                   ERLHYLSPRWDQPFISINCAAISDSLMESELFGHEAGAFTGATKTYQGRFERADGGTLF
FT                   LDELGTMSLRVQEKLLRLIEYGEFERLGSAKTQRVNVRIVAATNANLPSLSKQGEFRAD
FT                   LLDRLTFDVIQVPPLRDRKEDIEELANFFAMKLSTELGWEYFQGFSPKALTSLKNYDWP
FT                   GNIRELKNVVERSVYRWGFQADPVEKIVINPFTHANEEASDSLINKQAAQAQANTIDSK
FT                   PSGFSLNSSLSLKEQTFQLQQHLIQQALNENKHNQRLAAQSLGLTYDQFRGLLKKLK"
FT   gene            468233..468904
FT                   /locus_tag="Mmwyl1_0406"
FT   CDS_pept        468233..468904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0406"
FT                   /product="phage shock protein A, PspA"
FT                   /note="TIGRFAM: Phage shock protein A; PFAM: PspA/IM30
FT                   family protein; KEGG: hch:HCH_05443 phage shock protein A
FT                   (IM30), suppresses sigma54-dependent transcription"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69344"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="InterPro:IPR014319"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB5"
FT                   /protein_id="ABR69344.1"
FT                   /translation="MGIFSRMTDIINSNLTSLLDKAEDPKKMIRMMIQEMEETLVEVRS
FT                   SSARVIADRKTTGRRLERMRSEAAEWESKAMLAINKGREDLARAALAEKQQIEKEIVAI
FT                   DKELSALDEHLEHLNEEVGQLQIKLNDAKAKQKAMLLRQSSVESRMRVKRQNHKEALDD
FT                   AFEKFERFERRVDSLEGQLESMDIGMQPKADLKSQIDALAEDDDINDELARLKDKMTKA
FT                   N"
FT   gene            468948..469196
FT                   /locus_tag="Mmwyl1_0407"
FT   CDS_pept        468948..469196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0407"
FT                   /product="phage shock B family protein"
FT                   /note="PFAM: phage shock B family protein; KEGG:
FT                   aha:AHA_1879 phage shock protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69345"
FT                   /db_xref="GOA:A6VSB6"
FT                   /db_xref="InterPro:IPR009554"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB6"
FT                   /protein_id="ABR69345.1"
FT                   /translation="MSMAVFLFVPTIIFMTVVAPIWLILHYRSKNRAVKGLDEGDKREL
FT                   ESLLMQADKLTDRVQALEKILDVESPDWRRRDNDEYR"
FT   gene            469245..469694
FT                   /locus_tag="Mmwyl1_0408"
FT   CDS_pept        469245..469694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0408"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: asa:ASA_2423 phage
FT                   shock protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69346"
FT                   /db_xref="GOA:A6VSB7"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB7"
FT                   /protein_id="ABR69346.1"
FT                   /translation="MMKDKIKGSIKAKKSHGWDLNLYRNKKKSYLGGVCAGLADHFDVD
FT                   TWVVRLFTFGGFLFLGSFVVIAYIALWWFLDVRPKGEDGYEYEYDERQQSYRPKKMFKY
FT                   ADSANSRLRRAKEKLDDAARRVTEMERHVTSKKFDLDREFSKIRD"
FT   gene            469933..471042
FT                   /locus_tag="Mmwyl1_0409"
FT   CDS_pept        469933..471042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0409"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   ava:Ava_B0145 di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69347"
FT                   /db_xref="GOA:A6VSB8"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR023929"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB8"
FT                   /protein_id="ABR69347.1"
FT                   /translation="MRVKCAYLSSLVGHLALGSILLVCTPYLYAGDYIWALPAWMPAPI
FT                   VPVDNPMSEEKVTLGQRLFYDANLSGPGYMSCSTCHMPEHSFSEPRPVSVGVTGQFHSR
FT                   NAMSIVNVAYMKTLTWANPNEVRLEDQANVPIFGTHPIEMDTKGQEEKVILFLQRDPIY
FT                   PNLFHKAFPDQDNPISFDTITKALASFERTLISYQSPYDDYKYNHNDSAISEDAKLGEA
FT                   LFFSARLGCSSCHTSVHFSDATQTPAFHNTGLYNLDGKGAYPEGNQGLFEHTGKEADKG
FT                   RFRTPTLRNIAQTAPYMHDGSIATLEEVIEHYAAGGRAAQQGKASPLRSDKLHPFVLTD
FT                   DEKRQLMAFLTSLTDSKFIDNPHFTTPFR"
FT   sig_peptide     469933..470025
FT                   /locus_tag="Mmwyl1_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.919 at
FT                   residue 31"
FT   gene            complement(471112..472728)
FT                   /locus_tag="Mmwyl1_0410"
FT   CDS_pept        complement(471112..472728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0410"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: shn:Shewana3_0923
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69348"
FT                   /db_xref="GOA:A6VSB9"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSB9"
FT                   /protein_id="ABR69348.1"
FT                   /translation="MKILKTIRGRYTLIFGGLALVFLMVIISTETLVSYLQNSIGKYAS
FT                   GTSLIQNADRDLYQSRLALATLVFEKNTNNAKALEDAALLNAKQALDRMREFKQLTADI
FT                   DEVSRFLVDFDTLYKNWSDGNQRIMQTVKEKPDSAMIDFIGENQNDFLKLRSLYDRSEE
FT                   LISKYSAEENKSINEFTSIFKMTVGVFAIFALFLSMVLAWFAPRNISKAIKQVTFGVQQ
FT                   ISSGDGDLTRRINSTKTDETGDLSRELDSFVARLGSLIGQVRNGCEHIRQEMFNLGESA
FT                   TQSAELSERQNQSLDFVVTAVEEMGGATREVAQNAADTVAEVEALNRSADDGVRQLDNA
FT                   ISQLDNLAEQIQGAAGVINQLSERSDKIASVLDVILGISEQTNLLALNAAIEAARAGEQ
FT                   GRGFAVVADEVRELASKTQASTEDIQQMINDLQSGVSNAVSSITRSVDMAGTSVSLSRK
FT                   TMESIAVVKTSAGRIYDFTAQTASATEEQSKVTDEINQNLSNLADMSKDVMEISKRISH
FT                   SVHQTLSNSDELAGQVKRFTV"
FT   sig_peptide     complement(472639..472728)
FT                   /locus_tag="Mmwyl1_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.357 at
FT                   residue 30"
FT   gene            472958..473425
FT                   /locus_tag="Mmwyl1_0411"
FT   CDS_pept        472958..473425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0411"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: hch:HCH_01483
FT                   predicted redox protein, regulator of disulfide bond
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69349"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC0"
FT                   /protein_id="ABR69349.1"
FT                   /translation="MSEYYATVEWKRGTQLFSDKKYSRAHEWQFEGGVVVPASSSPHIV
FT                   PLPLSVAENVDPEEAFVASLSSCHMLFFLDFASRKKLIVDQYTDKAIGTLALGANGKQM
FT                   MTEVILRPTVTFVGDRPSSEEIKALHHQSHEACFIANSVLTNVRVDEAFCV"
FT   gene            complement(473473..474084)
FT                   /locus_tag="Mmwyl1_0412"
FT   CDS_pept        complement(473473..474084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0412"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ava:Ava_3893 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69350"
FT                   /db_xref="GOA:A6VSC1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC1"
FT                   /protein_id="ABR69350.1"
FT                   /translation="MILHDFLPSGNGYKIRLLCACLGLKVTLKQYDITKGETHTESFLA
FT                   MNPNGKIPVLELDGGQCLSESNAVLLYLAEQHKSALLPTDAILRAKVYKWLFWEQYSHE
FT                   PNIASPRFWLTHNAMTELKKQMLPDRIEQGCAALKLMDEALAKQAFLAGNTMTLADICL
FT                   FPYTHVAEEGGSYQLSEYPNIQRWIKDIEALDWFIPITQA"
FT   gene            474152..475060
FT                   /locus_tag="Mmwyl1_0413"
FT   CDS_pept        474152..475060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0413"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: she:Shewmr4_0006 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69351"
FT                   /db_xref="GOA:A6VSC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC2"
FT                   /protein_id="ABR69351.1"
FT                   /translation="MTAGLTHFDESLKEKIVLDTELLKTLVAIVDHGSFQRAAMQTFRT
FT                   PSAISMQMKRLEEQVGTDLFCKQGRDQVLTEDGQQLVHYARQILQLQESALQSIKGPQQ
FT                   GVLLNLGCPNDYVANLLVVIMSVMESMLPNIRFRIRTGTSSELRELMDKGEVDLALVTR
FT                   TPDSDEGLTLFQDKGVWVAKKGFDWTTLNPLSLALYESSCKFHSSAVDGLQKKGTDYQL
FT                   YCVTANLTLIESLLMAEKAISAIASISVNDSLEIIASDLLPSLPAVEIAFSRSASAPDW
FT                   LTVAWIEEVIERVVKDTKRPA"
FT   gene            complement(475064..475342)
FT                   /locus_tag="Mmwyl1_0414"
FT   CDS_pept        complement(475064..475342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0414"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   vpa:VP1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69352"
FT                   /db_xref="GOA:A6VSC3"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC3"
FT                   /protein_id="ABR69352.1"
FT                   /translation="MSKITLSGHIEVPKEDLNAVLTELPKHIALTHQEAGCITFTVTQD
FT                   SDNPQRFDVYEEFTDKAAFEKHQARVKASHWGEVTKKVERFYTVTES"
FT   gene            complement(475345..475866)
FT                   /locus_tag="Mmwyl1_0415"
FT   CDS_pept        complement(475345..475866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0415"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rru:Rru_A0143 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69353"
FT                   /db_xref="GOA:A6VSC4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC4"
FT                   /protein_id="ABR69353.1"
FT                   /translation="MRQIKEVFADQSDVIAQLIREANRPVAKQFAINQDNGPKHPSFCQ
FT                   TSWVENDFKRDERYFVLTDNQAPIACVAYEVPAHSTGVRKAYLNRLSVLPDQQSKGIGS
FT                   LLVDHIIEQAKADQLGFISIGVIGEHIRLQDWYEQLGFVKGDTKHFDHLPFSVTYMMYD
FT                   LNNQPKIEKT"
FT   gene            complement(475863..476801)
FT                   /locus_tag="Mmwyl1_0416"
FT   CDS_pept        complement(475863..476801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0416"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bur:Bcep18194_A6312 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69354"
FT                   /db_xref="GOA:A6VSC5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC5"
FT                   /protein_id="ABR69354.1"
FT                   /translation="MNRSSNTIGSIELILAMMLSGTIGYFVISSGQAFWNVVLFRCVIG
FT                   ALVLGSYAYYAGLLRREYFQRNVLLMIILGGITLVGNWIFLFASFNYIPFSIATVAYHM
FT                   QPLFLVLTGALLTKEKLSGSLLFWLALAFVGLFLIVELDLSEISALFTGEASSDGSSAL
FT                   FGLLLALGAALLYTVTTLVTKKVSQVPSTFVALVQVIVGVFMLLPFADFDNLPTQTSQW
FT                   IDLLILGAVLTGFMYIIMYDSFQKLPTSLIALLSFIYPITALFVDHLAFATHISLMQIL
FT                   GVILILLAVSAVKFNWALPRKEPKQAKREKP"
FT   sig_peptide     complement(476700..476801)
FT                   /locus_tag="Mmwyl1_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.680 at
FT                   residue 34"
FT   gene            476959..477420
FT                   /locus_tag="Mmwyl1_0417"
FT   CDS_pept        476959..477420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0417"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bpd:BURPS668_0348 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69355"
FT                   /db_xref="GOA:A6VSC6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC6"
FT                   /protein_id="ABR69355.1"
FT                   /translation="MRNNLKKEEYALDGIDTKLIELLYANARTPVTELARSVGMTAPSV
FT                   NERLKRLEESGVIAGYRVEVNPKVLGYSLMAIVRMRQLPGKLKALEALISSIPEFVECD
FT                   KVTGEDCYVARLYLKDISELDPILDRVSELADTNTSIVKSTPVTRRLLV"
FT   gene            complement(477443..478861)
FT                   /locus_tag="Mmwyl1_0418"
FT   CDS_pept        complement(477443..478861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0418"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: slo:Shew_0098 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69356"
FT                   /db_xref="GOA:A6VSC7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC7"
FT                   /protein_id="ABR69356.1"
FT                   /translation="MTFPRSLKQYAALVIDWLKKRRASFAWRFTLLYTTLLITLMAVAF
FT                   FVLYQLSVGEISRSYQQQIQLITQQQRLFNQQMNEDEYLLQFTSQAKQVNNLVLAYENA
FT                   HGTYGNLSRLPTSLATCPAQTTFFVDSANDLRFYIGCITTLPHGRLLVAFDDENLYFLQ
FT                   TQFLRAGILALLLTLGLGVLSGRYLSTQLLSRIKNINDTAKVIQSGDLGARVTVSHRQD
FT                   EFDLLASYINRMLNQLEDSFHAVSGVIDAIAHDLRTPLGRLRLRLESHLNTLDETPINE
FT                   SQLQEMLEELDHILTTFSAMLELSRLEHKQTDSHFDTVNINQIAEDVIDLIQPLTQDKQ
FT                   QTLSFIASAQPHIKGDKTLIFRAMFNTLENACKYTGSGGAIELITTTSGFIVKDNGPGI
FT                   PDEFKDKALQRLFRLESSRTSPGYGLGFPLIKAIAHFHQGKLELQDNHPGLQVHVTLNT
FT                   RHQDNGLIGTETSD"
FT   gene            complement(478791..479480)
FT                   /locus_tag="Mmwyl1_0419"
FT   CDS_pept        complement(478791..479480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0419"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: saz:Sama_3534 response
FT                   regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69357"
FT                   /db_xref="GOA:A6VSC8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC8"
FT                   /protein_id="ABR69357.1"
FT                   /translation="MRILVVEDDIVTQGFIKKGLTEQGYQVDVASDGQDALFQALEGDY
FT                   QLIILDRMLPKLDGMTVLNTLRSAQKTLPVLILSALDSVDERVKGLREGGDDYLVKPFA
FT                   FAELLARVEILIRRQPMAAVQQSTLLQVSDLKMDLLTRQVWRAGREISLQPKEFQILRY
FT                   LMEHPKQVVTRTLLFEAVWDYDFDPQTNVIDVHVARLRKKVETDDLPPILETIRGVGYR
FT                   LVEKATS"
FT   gene            complement(479603..480211)
FT                   /locus_tag="Mmwyl1_0420"
FT   CDS_pept        complement(479603..480211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpl:lp_1539 lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69358"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSC9"
FT                   /protein_id="ABR69358.1"
FT                   /translation="MTLKTKLSVIFTTFFSISTFVALCTSAILMSSTVHAKDSDDYQED
FT                   QLMLQALKSSKVSLDSLLEKFQADFPSTVMEIELDDEDNILVYEIKGIDLKEGVRYKAK
FT                   YALYSGEEIDRHSKSLRFMGFNKLDDNDQAALEALQQGVSIKNAIALSNPQEGSYIESI
FT                   ELEHKRGLTFYEVELLGPSGSTKILMDAKSGEVIPSLRR"
FT   sig_peptide     complement(480101..480211)
FT                   /locus_tag="Mmwyl1_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 37"
FT   gene            480418..480870
FT                   /locus_tag="Mmwyl1_0421"
FT   CDS_pept        480418..480870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0421"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: sfr:Sfri_0803
FT                   transcriptional regulator, MarR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69359"
FT                   /db_xref="GOA:A6VSD0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD0"
FT                   /protein_id="ABR69359.1"
FT                   /translation="MTSDNPLFPDNPLLLDSQLCFALYSTSLAMTQFYKEPLSAIGLTY
FT                   PQYTVMLILWEQDGVSLKHISDALGQKSGALTPVIKRMEADGLVQRLRGVDDDRSLSIA
FT                   LTEKGKKLREQGLEVNRCVAEACGIDMDEVVALREQLVALRKKLVK"
FT   gene            481008..481430
FT                   /locus_tag="Mmwyl1_0422"
FT   CDS_pept        481008..481430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0422"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: sdn:Sden_0377
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69360"
FT                   /db_xref="GOA:A6VSD1"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD1"
FT                   /protein_id="ABR69360.1"
FT                   /translation="MQAIYSATATSTGGRDGRSVSSDNKLDLALSTPKELGGAGGEGTN
FT                   PEQLFAAGYSACFIGALKLAASQQKVKVPNDVNVTATIGIGANTKGEGFTISADLEVNV
FT                   PGVEKDVVEKLVEAAHKVCPYSNATRGNIDVNFTIK"
FT   gene            481579..481887
FT                   /locus_tag="Mmwyl1_0423"
FT   CDS_pept        481579..481887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0423"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: pin:Ping_0706 transcriptional
FT                   coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69361"
FT                   /db_xref="GOA:A6VSD2"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VSD2"
FT                   /protein_id="ABR69361.1"
FT                   /translation="MTHRKLEQHEIEQALNQLNTEASEGWAIEDEKLSKTFKFKDFQHA
FT                   FGFMTMCALYAEKQDHHPEWFNVYNKVSIQLTSHDVSGISNKDFDLAKKMETFALSV"
FT   gene            complement(481933..482565)
FT                   /locus_tag="Mmwyl1_0424"
FT   CDS_pept        complement(481933..482565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vco:VC0395_A0339 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69362"
FT                   /db_xref="GOA:A6VSD3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD3"
FT                   /protein_id="ABR69362.1"
FT                   /translation="MKMKGQLDSAQPLKKHKAKSKKNEQKKKKQDKLETKKHSKEKKDS
FT                   QPEVIVSTEVVKLSTTDPQTPKKSKTKKAIESTIDDSIKNLAESPIIIEADAPESSSST
FT                   RQRASKSLVPMTKEEQLIAINQIIKSLLLDEMTQGAALRELRVGVLGIRQDAYTKLCGV
FT                   SRKTLSEIENDKGNYTAEIINKVFKPFEIKVGLVPTSSQLLAAILTN"
FT   gene            482799..483815
FT                   /locus_tag="Mmwyl1_0425"
FT   CDS_pept        482799..483815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0425"
FT                   /product="dienelactone hydrolase"
FT                   /note="KEGG: hch:HCH_03006 predicted dienelactone
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69363"
FT                   /db_xref="GOA:A6VSD4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR016986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD4"
FT                   /protein_id="ABR69363.1"
FT                   /translation="MRGFASFILLVACWASNVLAQSVGFDQVLLYADSDRPLKASVWYP
FT                   SQTQIPQERIAENAVFVGTDVVRLGTPSQGEFPVVILSHGYGGNWRNENWLVTRLVQDG
FT                   YIVAALDHPGTTTFDHNPLAASQWWRRATDVSRLLDWLLEQSYLVKHIDDANITAIGHS
FT                   LGGWTVMLLAGAEFDRNQLKQECEIYNNPRTCGLMTELGMDQPQIGEPVNGLKDARIKR
FT                   VVTLDLGLARSFSRQSLQALTTPTLILAAGVDIGDLPQEKESGFLAQFIPKQNRDYIVY
FT                   PDAAHFSFMQLCKPNAIAMLEEEVPGDGIICRDGDWRSREKLHQAMYLDIIHFLQAS"
FT   sig_peptide     482799..482861
FT                   /locus_tag="Mmwyl1_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            complement(483812..484861)
FT                   /locus_tag="Mmwyl1_0426"
FT   CDS_pept        complement(483812..484861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0426"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: asa:ASA_3015 transcriptional regulator,
FT                   AraC/XylS family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69364"
FT                   /db_xref="GOA:A6VSD5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD5"
FT                   /protein_id="ABR69364.1"
FT                   /translation="MIAIPLPFVVALLLSILAILLFIRREEATQSAFVFIALCALTTTV
FT                   VGLRWTFDYPLFRLLQPILASCIPVTAWYCFSSAHQRYKLKIWHFLPPVFVTLASFTYP
FT                   FWRPPLDPVLTLLYIGYGVALIRASFKASDLPEQVRLSDIDNALKAERIAGAMLLMSAM
FT                   IDGALAVDFTFFAGEHALIILAIGHAVLLPVLSIAVIMMSLSIAPSVNESSDQNEKTTP
FT                   VEESKDKPHHPLTDDEVKDIVHKIEVLLSTKEAFLDPDLTLDRLARKACIPARQISAAI
FT                   NQTYGRNISQVVNEYRIERAKTLLLTTDKAITQIYLDSGFQTKSNFHREFSRVMQQTPS
FT                   AFRRANMKS"
FT   gene            485082..485435
FT                   /locus_tag="Mmwyl1_0427"
FT   CDS_pept        485082..485435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0427"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805; KEGG:
FT                   saz:Sama_2633 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69365"
FT                   /db_xref="GOA:A6VSD6"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD6"
FT                   /protein_id="ABR69365.1"
FT                   /translation="MNWYFDAWKRYVQFSGRASLEAFWMFFLVNCLISLVFVVLESFFQ
FT                   AIWKIEALYSVLVFLPMLSLTVRRLHDTNRSAWWLLVVLLPAVGMVVLLVLLALPSEPD
FT                   SDFSNYPQNNAML"
FT   gene            485449..486024
FT                   /locus_tag="Mmwyl1_0428"
FT   CDS_pept        485449..486024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vco:VC0395_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69366"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD7"
FT                   /protein_id="ABR69366.1"
FT                   /translation="MKDVNNLPHLSTMLCSILLLLSVSACSSEAKNTNESNLAFSDNIK
FT                   AVVYIESPKVGTLLQLRGIAGKGVLIAKKDNRQEEQTTCVSSPIRLAAGDFGGDGIGIQ
FT                   SVEPIRLLIYSNKVAEKLIAGDEVVSEHYVITEQSDAQLGDIKIESGLTPSYGFVLNPG
FT                   EWSWSSVFGLDHDEVDCELLNNSLNRPT"
FT   sig_peptide     485449..485541
FT                   /locus_tag="Mmwyl1_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.503 at
FT                   residue 31"
FT   gene            complement(486007..486858)
FT                   /locus_tag="Mmwyl1_0429"
FT   CDS_pept        complement(486007..486858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0429"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ppu:PP_2350 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69367"
FT                   /db_xref="GOA:A6VSD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD8"
FT                   /protein_id="ABR69367.1"
FT                   /translation="MDIEQAKTFLEIIHAGTFARAAERLHITQTTVTARVQALESSLNC
FT                   RLFIRNRAGAKLTKNGEAFVKPAKNMLEAWEQAKQLCGISDYQAQQTLRIGGEISLWNP
FT                   ILIDWQLAMNNDMPHLLINSQVTTTDMLYQSLQKQEIDAIIVHSPRYLPSLVVEQIAEE
FT                   KLIHVAANLQTTPDLFIEWGEEFTLQFDRCVPFNRQAAMQFSLGPMALKYLLAKGGNGY
FT                   FRTRVVDQYLKEGLLHRIKGAAEFTYPIYLVYHKNNTSPDGFEQAKKILLDEMKKVSSW
FT                   TV"
FT   gene            487021..487743
FT                   /locus_tag="Mmwyl1_0430"
FT   CDS_pept        487021..487743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0430"
FT                   /product="HPP family protein"
FT                   /note="PFAM: HPP family protein; KEGG: tcx:Tcr_1929 HPP"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69368"
FT                   /db_xref="GOA:A6VSD9"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSD9"
FT                   /protein_id="ABR69368.1"
FT                   /translation="MFLSLCRNTARFIGIETNKTSHFERFLSGITACVALVSVFYCSSL
FT                   FLSLPDSLLVVSSIGASAVLLFAVPHGALSQPWPFVIGHLISALIGIFFYQEFGASFLT
FT                   GAAAVGTSIVVMHYLRCLHPPGGSTALSCVIGGSSIHAMGYEFLLYPLLINLLAMLALA
FT                   VILNNCFSWRRYPAALNTSLHQEINEQHLLEMDDLYHVLEQEDIFIDVSAEELMHIYNA
FT                   AREHAKERHKRLVSTLPK"
FT   gene            487785..488180
FT                   /locus_tag="Mmwyl1_0431"
FT   CDS_pept        487785..488180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0431"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: azo:azo3708 dioxygenase-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69369"
FT                   /db_xref="GOA:A6VSE0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE0"
FT                   /protein_id="ABR69369.1"
FT                   /translation="MFSHIYYGVSDFERAYAFYSKLMTCLIIKERFYDRDKPWAGWNSP
FT                   SSNGRPLFVIGKPFNGKVHDQGNGQMIAFNAKDRATVTAAYNLAIRNGATCEGQPGLRS
FT                   EYHESYFGAYFRDLDGNKVCVVCHGVE"
FT   gene            488491..488916
FT                   /locus_tag="Mmwyl1_0432"
FT   CDS_pept        488491..488916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0432"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vvu:VV1_2448 probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69370"
FT                   /db_xref="GOA:A6VSE1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE1"
FT                   /protein_id="ABR69370.1"
FT                   /translation="MIRKLCAEDINEVVSIWYSASVKAHDFIAEEFWRSQKEPMRDVYI
FT                   PNSETWVYYLEDRISGFISYYQGFIPALFVSPSDQSKGIGTELLTTLKQHYNQLSLTVY
FT                   AENTQAHSFYIRQGFIELERNLCEHTGHEEILMSWAL"
FT   gene            489051..489584
FT                   /locus_tag="Mmwyl1_0433"
FT   CDS_pept        489051..489584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0433"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: vvu:VV1_2472 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69371"
FT                   /db_xref="GOA:A6VSE2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE2"
FT                   /protein_id="ABR69371.1"
FT                   /translation="MKKVNVIGTTGSGKSTFSQRLATKINAPYIQMDQIFGKKNWQESQ
FT                   DSEFFQRIEEILSESTWVLDGNYSRTNVIKWRDADTIIWIDYSFCRTFFQLFKRTIKRI
FT                   ISGEELWPETGNRESFAKSFLSKKSIFIWFFKNYSHNKKGYSKLMYSSKIKHINVIRLC
FT                   SPKEADLFLKNIEA"
FT   gene            complement(489747..490045)
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0434"
FT   gene            490104..490619
FT                   /locus_tag="Mmwyl1_0435"
FT   CDS_pept        490104..490619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69372"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE3"
FT                   /protein_id="ABR69372.1"
FT                   /translation="MICLLLFGCSHVPLGSMLKLSAFDENSFLSLNPHELRSRIEVDSP
FT                   LKIDVHKTNLSLKLDSSSGDLLFDYPLKLLFVKDLPAEAHWLSPIPARTQYVLALSDEA
FT                   IDNFTALQARMRVEQPKRYHLTIDTGFQNGAEEQSEAVLSVSIKLSAETDYITLLDRVS
FT                   IDVKEEQL"
FT   gene            490616..491047
FT                   /locus_tag="Mmwyl1_0436"
FT   CDS_pept        490616..491047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0436"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ilo:IL1815 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69373"
FT                   /db_xref="GOA:A6VSE4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE4"
FT                   /protein_id="ABR69373.1"
FT                   /translation="MIRELSAEDINDVVSIWYSASVKAHDFIAETFWDSQKESMRDVYI
FT                   PNSETWVYCQDSRILGFISYHQGFVAALFVSPDAQSKGIGTALLNTLKDCHQSLSLTVY
FT                   AENSQAYSFYSQQGFAELERRPCEHTGHEEVLMSWTLNA"
FT   gene            491074..491547
FT                   /locus_tag="Mmwyl1_0437"
FT   CDS_pept        491074..491547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0437"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hch:HCH_05438 histone acetyltransferase HPA2/related
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69374"
FT                   /db_xref="GOA:A6VSE5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE5"
FT                   /protein_id="ABR69374.1"
FT                   /translation="MLIREAKREDSSTILRFVKELAAYEKAEHEVLATKEMIESSIFSE
FT                   HSTTKAIICESEGNPIGFAVYFFNYSTWLGKHGLYLEDLYVSPSERGSGAGKALLKHLA
FT                   GIAVANDCGRFEWSVLDWNKPAIDFYESLGAKPKSEWLGYQLTGESLAALAAS"
FT   gene            complement(491712..492443)
FT                   /locus_tag="Mmwyl1_0438"
FT   CDS_pept        complement(491712..492443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0438"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: aci:ACIAD3485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69375"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE6"
FT                   /protein_id="ABR69375.1"
FT                   /translation="MALSIEETLRIDLAASFRIIAHLGMHEAVANHFSAAVSDDGKQFL
FT                   LNPKWKHFSQIKASDLLLLDADDASNAERPEVDATAWSIHGQLHQRLPHVRVAMHLHPV
FT                   YTTAISTMKAPNIPPIDQNTARYFNRVSVDTMFGGMADTEAEGARLSGLLANNSRLLMG
FT                   NHGVMVTSSDIGIAFDDIWTLERACQILVTAWSTGQALNVLSDEVAEKTARDWEKITDF
FT                   SRRHFEEMKALMIKQNPSVLD"
FT   gene            complement(492497..493339)
FT                   /locus_tag="Mmwyl1_0439"
FT   CDS_pept        complement(492497..493339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0439"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bam:Bamb_3990 extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69376"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE7"
FT                   /protein_id="ABR69376.1"
FT                   /translation="MTMLKKNHGKTLRSFALGAVGALLTVSSMNAMAFKESGKIIAGSD
FT                   VTFYPYEYMKDNKPAGFDIEFLDGLAKVMGRESVTLDTRWANLIPGLRGGRFDITNSAM
FT                   YITEERLKVIDMIPYLKSGVSILSVKGSDYQPKTPEDFCGHTIGSMAGTAWLKPVRKVS
FT                   AEYCEANGLEPIKINEYPTDPQTTQAMLSRAIDAQITDAAVASGIVERLGNRVTLSSDT
FT                   LLYPVLNGFGVKKGNDEVKEALIAGLEKYKKTPEYEALLKKYHFQAPTEEDLKTLMSN"
FT   sig_peptide     complement(493238..493339)
FT                   /locus_tag="Mmwyl1_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 34"
FT   gene            complement(493386..494906)
FT                   /locus_tag="Mmwyl1_0440"
FT   CDS_pept        complement(493386..494906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0440"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; ABC transporter related;
FT                   SMART: AAA ATPase; KEGG: aci:ACIAD3488 putative amino acid
FT                   transport protein (ABC superfamily, ATP_bind and membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69377"
FT                   /db_xref="GOA:A6VSE8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE8"
FT                   /protein_id="ABR69377.1"
FT                   /translation="MMFDWNYLFSLFSFSDFWWASWTVIKLSLASWVLSIIVGFVLALG
FT                   KQSKLVVFNAPSKFYIWLFRSLPLLVLLIFVYNMPQLFPSTGGLLSDPFWAGLIAMVMC
FT                   ESAYVAEIHRGGLLSIPKGQSEAARALGIRFAGAQWLIVIPQALRVALPSLTNEFIAIV
FT                   KLSSLVSVISLTEVLMVGQRLYTQNFLVLETMAAVAIYYVLIVTIFDFLLGQLESYLDV
FT                   TKRKTTKQPSAEFIEQVKNAPAATITPTTSYDGPALKATKLHKAFNNVEVLGSVNLSIN
FT                   SGEVVSVIGPSGSGKTTLIRLLNGLEQLDNGAIDLNGQPFLKLLRSSPDKTRFVENAEL
FT                   RTQIGMVFQSFNLFPHLTVLENLMLAPRYHKMGSRKDLEMQAYQLLYKVGMLDHVWKYP
FT                   HQLSGGQQQRVAIARALMMRPQIMLFDEPTSALDPEKVNEVLQVIEDLAQEGITMVIVT
FT                   HEMSFAFKVSDRVVFMEQGRVVCDDSPQVLREGNNPRIESFLKDVSLT"
FT   gene            495328..496251
FT                   /locus_tag="Mmwyl1_0441"
FT   CDS_pept        495328..496251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pen:PSEEN2103 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69378"
FT                   /db_xref="GOA:A6VSE9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSE9"
FT                   /protein_id="ABR69378.1"
FT                   /translation="MRYFTLKQLNYFTTVVDTESIAEASRKLHIAQPSISIAIKNLEDS
FT                   FGQQLLIRHHAQGVSLTPSGRRFYDKARELLRFSHEFEQNTLANSDTASGKISIGSFES
FT                   VAPLYIPKLIAGFKRQYPDIEIQLMDGEQHEIMVGLHRGHFDMAFLYDLELDNSIRKEP
FT                   LNAPHKPYALLPADHPLAANPTVTLEALSREPMVLLDVIPSRNYFLSIFTEKGLHPEVA
FT                   YTSPSIEMVRCMVGQGQGFSVLVTRPCSKMTYDGQQLAYVEIEDEMESSALIMAHLKTN
FT                   EPTKPARLFMDYCRAFDLDNSMAVSG"
FT   gene            496415..497674
FT                   /locus_tag="Mmwyl1_0442"
FT   CDS_pept        496415..497674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0442"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="KEGG: bur:Bcep18194_C6991 flavin-containing
FT                   monooxygenase FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69379"
FT                   /db_xref="GOA:A6VSF0"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF0"
FT                   /protein_id="ABR69379.1"
FT                   /translation="MTAKIQHIDTLIVGAGQAGIAMSEHLTRQNVPHIVLEKSRIAEAW
FT                   RTRRWDSLVANGPAWHDRFPGLEFPNVDPDCFVKKDSVADYFEAYAEKFEAPVHTGVEV
FT                   HSVTQEQGVSGFKVVTSEGVYQAQRVVSATGPFQTPVIPAIAPKNPDLYQIHSADYHNP
FT                   EQLPEGAVMVVGAGSSGVQIADELLQSGRKVYLSVGPHDRPPRSYRGRDFVWWLGVLGL
FT                   WDAAANEPGKEHVTIAVSGAFGGKTIDFRKLAKEGMNLVGRTQSFEGDHAIFGDDLAAN
FT                   IREGDQNYLSLLRQADEYIAKNGLDLPEEPEAHQLLEDPDCMTNPILDLNLSEAGVTSI
FT                   IWATGYSTEYNWLEVDAFDEKGQPDHHRGVSKAAGIYFLGLPWLSRRGSTFIWGVWHDA
FT                   KYIADQIVIQRQYQHYPDQA"
FT   gene            497688..498107
FT                   /locus_tag="Mmwyl1_0443"
FT   CDS_pept        497688..498107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0443"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: csa:Csal_2388
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69380"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF1"
FT                   /protein_id="ABR69380.1"
FT                   /translation="MPTHTRIRMFNTKETYPNQTLDNDLCQAVVAGNTVYVRGQVGTDF
FT                   EGNLVGLGDPQAQAEQAMKNVKQLLEEAGSDLSHIVKTTTYITDPRFREPVYREVGKWL
FT                   KGVFPISTGLVVAGLAQPQWLMEIDVIAVIPEADK"
FT   gene            498119..498793
FT                   /locus_tag="Mmwyl1_0444"
FT   CDS_pept        498119..498793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0444"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   pae:PA5391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69381"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF2"
FT                   /protein_id="ABR69381.1"
FT                   /translation="MTISITAYCPDSGQFGIAISSSSIAVGARCPWLMAGVGAVSSQNI
FT                   TLPVLGQKTLDQLSAGSSADQALKAALAQDTFSAYRQVTVIDANGETACFSGIETLGVH
FT                   HMKKGVNCVAAGNMLSDSSVIDAMVAGFESATGELTSRLLEALKAGIQQGGEAGPEHSA
FT                   AVKVVDAYPWPLVDLRVDWADENPVDELMTLWQDYEPQMNAYVTRALDPRKAPSYGVPG
FT                   DE"
FT   gene            498786..499958
FT                   /locus_tag="Mmwyl1_0445"
FT   CDS_pept        498786..499958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0445"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   pen:PSEEN2650 N-acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69382"
FT                   /db_xref="GOA:A6VSF3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF3"
FT                   /protein_id="ABR69382.1"
FT                   /translation="MSKTQETHHASVRSLLSTLLSFDTTSRESNLELIEFIQDYLDKLG
FT                   VESTLIYNDERTKANLYARLGPAGDGGVMLSGHTDVVPVDGQKWTCQPFELTEQDGKYY
FT                   GRGSADMKGYLACVLAMVPSFQSKTLRMPVYLAFSYDEEVGCLGVRSLIDHLKTSLEKP
FT                   ALCIIGEPTSMKPVYGHKGKVAMRCKVHGKACHSAYAPEGVNAIEYAAQMISQLSTLAE
FT                   PLKQQEDDRFDPPYSTLQTGVIKGGVALNIVPEFCQFDVEMRYLPGVNAQETFDSLADY
FT                   AKQTLEPKMKAISEDSAIELEALSAYPPLLTDKQSEFAQWMAQWTESEAFQTVAFGTEG
FT                   GLFDEAGVATMVCGPGSMDQGHKPNEFVSIEQIQQCSKMLQNLCDWLTTE"
FT   gene            complement(500034..500762)
FT                   /locus_tag="Mmwyl1_0446"
FT   CDS_pept        complement(500034..500762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0446"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA3492 putative amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69383"
FT                   /db_xref="GOA:A6VSF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF4"
FT                   /protein_id="ABR69383.1"
FT                   /translation="MSLVNLHQVHKYYGEHHVLKGIDLDIKAGEVVSIIGKSGSGKSTL
FT                   LRCINGLEQYQEGGITVDGKEVTTEDIQVRRLALSVGMIFQNFNLFPHMTVGENVMLAP
FT                   TIVLKKSKAEAETTARAMLEKVGLAEKFDSFPEKLSGGQQQRVAIARALAMSPKVLLCD
FT                   EITSALDPELVGEVLKVLEQLAKEGITLVLVTHEMNFARDVGSRVVFMHQGKVWEQGDP
FT                   KTILSNPQTDELKQFMGAVL"
FT   gene            complement(500749..501399)
FT                   /locus_tag="Mmwyl1_0447"
FT   CDS_pept        complement(500749..501399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0447"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pin:Ping_2430 ABC
FT                   polar amino acid transporter inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69384"
FT                   /db_xref="GOA:A6VSF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF5"
FT                   /protein_id="ABR69384.1"
FT                   /translation="MIEFSNYDILRNLMFATQWTILLSLAAFIGGTTVALALTAMRLTR
FT                   NPIMQRIVKIYVELFQGTPLLMQMFLCFFGLSMLGYEISAWSAAILSLTFFTSAFLVEI
FT                   WRGCIDTLPKGQWEASRCLGLSFLQTLRFIILPQAIRVATAPTVGFSVQVIKGTALASV
FT                   IGFVELTKVGTMLNNATFEPFKIFTLVALIYFVLCYPLSLYSKHLEKKFNVSR"
FT   sig_peptide     complement(501286..501399)
FT                   /locus_tag="Mmwyl1_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.898 at
FT                   residue 38"
FT   gene            complement(501432..502094)
FT                   /locus_tag="Mmwyl1_0448"
FT   CDS_pept        complement(501432..502094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0448"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pin:Ping_2431 ABC
FT                   polar amino acid transporter inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69385"
FT                   /db_xref="GOA:A6VSF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF6"
FT                   /protein_id="ABR69385.1"
FT                   /translation="MLYFSDLLQYSDVFLSGLKTTVELTVLTTILGVVLGTVCATVRQY
FT                   GNRASQRVVSVYVELIRNTPFIVQLFFIFFGLPAIGMMLSPWEASMIALTINLGAYSTE
FT                   IIRAGLASISNGQIEAAKVLGLNFRQTLTRVIFIPAFEKIYPALTSQCIIVMLGSAVIS
FT                   QISVQDLTYAANLVQSRNFRAFESYLVTALLYLGLSILLRFAFNALGKRLFAYRTSN"
FT   gene            complement(502105..502896)
FT                   /locus_tag="Mmwyl1_0449"
FT   CDS_pept        complement(502105..502896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0449"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: eca:ECA3495 putative amino acid ABC transporter,
FT                   substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69386"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF7"
FT                   /protein_id="ABR69386.1"
FT                   /translation="MKRLTKLLGKTLIIAAGFSALSASADVLQDIKDRNLIRIAVPQDF
FT                   PPFGSVGTDLKPQGIDVDMANYIAKEMGVKIEIIPVTSANRIPYLQTQKVDLVISSLGK
FT                   NPEREKAIDFSTPYAPFFLGVFGSKDVAVTKIGELADKTVGVTRGSVEDLELEKNAPKS
FT                   VNVRRFEDNNTTLTAYLSGQVNLIATGNLVAAEIAKRQPQRAPENKFMLKDSPCYIGMA
FT                   KGEVALQAKVNELIKSALASGELNEISMKWLKAPLPKGFGA"
FT   sig_peptide     complement(502819..502896)
FT                   /locus_tag="Mmwyl1_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            503256..504074
FT                   /locus_tag="Mmwyl1_0450"
FT   CDS_pept        503256..504074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0450"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: pat:Patl_2057 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69387"
FT                   /db_xref="GOA:A6VSF8"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF8"
FT                   /protein_id="ABR69387.1"
FT                   /translation="MATKQDVLSLIEQTYPTLSPSARSIANYLQQNPLAIVSQTSAEIA
FT                   ENTNTSKATVSRFFRQLGYDSQQGAKQAQLALRESGVPIFIQGSSLDQTAQELKNLSLT
FT                   FEGLRPENLNDISERLAKASRVTLIGFRNAYPLALHFRQQLQQVRHSVRLLPQPGQTLG
FT                   EDLHDILDDEVIVLLGFRRRTRQFKKIVEALEGRTTVLITDPTGQVYNQQVSHVLVCHL
FT                   GNESPFDSYAAPMSLISMLCNRVFGFLGDAASRQTQAISALYEDLDELEP"
FT   gene            504223..505458
FT                   /locus_tag="Mmwyl1_0451"
FT   CDS_pept        504223..505458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0451"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: pat:Patl_2055 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69388"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSF9"
FT                   /protein_id="ABR69388.1"
FT                   /translation="MKHFMVQNPFISLKAFNQSETSWQQNSSADSALPLSGLRLAVKDL
FT                   FHMAGLPTSAGNPTWLATHPIPTKTASSVSALLSEGAIFCGKTITDELAYSLNGQNIHY
FT                   GTPSNPVTPDRLPGGSSSGSAVAVSSGLADIGLGTDTGGSIRVPASYNGLFGLRPTHGV
FT                   IPSDNMVALAPSFDTVGWLTKDLTTLEKTARVLLKSKFSKEFGNVLIANNLIDQVAHVK
FT                   ELRTQLKTWREQGHFAKESSIVIDTKAWKTSETFRTLQGAEIWHEHGKWINSLNSSDSL
FT                   SEAEKQSVFAPDIWLRFHWCKTISAADVATAQQQRQRFVDWLEHEIEGSVLIIPTTPGL
FT                   APLFDAAEDELAAYRNQLMDITAIAGLAGLPQLHLPVCILDGAPCGLSLVGSKGSDLAL
FT                   IEFAKHLMESAS"
FT   gene            505455..507107
FT                   /locus_tag="Mmwyl1_0452"
FT   CDS_pept        505455..507107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0452"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   pat:Patl_2054 gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69389"
FT                   /db_xref="GOA:A6VSG0"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG0"
FT                   /protein_id="ABR69389.1"
FT                   /translation="MSTLNPNNDSHTNNIKNNDIAFTAPHFKATEAGQKILAQGGTAIE
FT                   AMVAAAATIAVVYPHMNGLGGDGFWLISEPGKAPIGIDASGKSAALATLDFYCGHDSIP
FT                   ARGGKAALTMAGAVAGWQEALAVSQTWQAVSNAQNMPLKDLLKDAIELAKNGSEVTKTY
FT                   LDASNKTFADLVSVQGFASTFLKQGSLYEQGDNLILPVLAQTLEQLAEKGLNDFYQGDI
FT                   ATRLAKDLATAGSPIRLTDFHSYQAKRVEPLQVKTSVGSLYNLPAPTQGIASLLILALY
FT                   DKLYTQGKSATDMAHLLIECTKQAFIARNQFVTDESRLAMDLSSLLDDEQLEKMCHEIA
FT                   LERAQAWPHQAKHGDTIWMGACDSEGRMVSYIQSLYWEFGSGVVSPSTGIVWNNRGSSF
FT                   SLEKGSLQELGPNLKPFHTLNPAFAELNDGRRMSYGTMGGEGQPQTQAALFSRYVYHQM
FT                   PLAQAISEGRWLLGRTWGDVSHNLKIERDFADMVAEELVNRGHDLVVVDSCNELMGHAG
FT                   AVVLHNEGHTEAATDPRSDGLAIDSHFIRNNLI"
FT   gene            507122..507940
FT                   /locus_tag="Mmwyl1_0453"
FT   CDS_pept        507122..507940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0453"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pha:PSHAa1469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69390"
FT                   /db_xref="GOA:A6VSG1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG1"
FT                   /protein_id="ABR69390.1"
FT                   /translation="MSFIMENYSMILAMMATGVVGGILAGLLGVGGGIVIVPVLYFLYQ
FT                   GMGVSADSAMLVATATSLATIIPTSISSIRSHKAKGNVDFDLLKRWGFFIFAGVMVGSF
FT                   VVTRVDGQWLSLLFGVIATLSALNMLLGKKDSVFKSLPGNAGQSVMATCIGFFSSMVGI
FT                   GGGTLTVPTLTFCNYPAHRAVGTAAAVGLIISLPAALTMLIFGQSPVDAPYGTVGLVNL
FT                   IGVICIIPLTVLFAPVGAGLAHRLDASKLKKVFAVVLIFTGIKMLYQVLG"
FT   gene            507950..509170
FT                   /locus_tag="Mmwyl1_0454"
FT   CDS_pept        507950..509170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0454"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: pat:Patl_2052
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69391"
FT                   /db_xref="GOA:A6VSG2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG2"
FT                   /protein_id="ABR69391.1"
FT                   /translation="MQPLSLPPRLLMGPGPINCYPRVLSAMSTQLVGQYDPSMTSYMNE
FT                   VMELYRRVFNTQNQQTFLIDGTSRAGIEAALVSCLEPGDKVLIPIFGRFGHLLAEIAER
FT                   ADAEVHTIEVPWGDVFDPQQIEDAIKKVQPKLLAIVQGDTSTTMFQPLEELGDICRAHD
FT                   VLFYTDATASIGGNPLEVDAWKIDAVSVGLQKCLGGPSGSAPITLSDRFVSCVRKRAHV
FT                   EAGIRDAHHQGSAGLRIRSNYFDLPMIMDYWGEERLNHHTEAATMLFGSRECAIQLLTE
FT                   GQDAVIKRHQLAGNAMLQGVIAMGLQPFGNLKHKMSNVVGVNIPEQVNGEQVRHDLLNI
FT                   FNIEIGTSFGPLKGKVWRIGTMGYNARQDAVLHTLQSLETVLRRAGFALPAGAAVDAAM
FT                   AVYNGDK"
FT   gene            509170..510396
FT                   /locus_tag="Mmwyl1_0455"
FT   CDS_pept        509170..510396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0455"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   PFAM: peptidase M20; KEGG: pat:Patl_2051 amidase,
FT                   hydantoinase/carbamoylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69392"
FT                   /db_xref="GOA:A6VSG3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG3"
FT                   /protein_id="ABR69392.1"
FT                   /translation="MIDCNNLAQLVMDRCDELGKISQSDDCLDRRYLTKEHKQANGLVG
FT                   GWMQEAGMHTWQDAAGNLWGRWEAADPQAPRFIMGSHLDTVPNGGQYDGMLGVITPVTL
FT                   IGAMQKAGIRLPFHLDVVGFGDEEGTRFSSTLLGSRALTGQWPESWADLTDSDGISLSQ
FT                   ALKDFGSDFANIPNATISTDNLLGYLELHIEQGPVLESLDLPVGVVSAIAGAKRFEFNV
FT                   TGMAGHAGTVPMKLRQDALCASSEMILAIEKVAQQHGIVATVGRIQNRPNGVNVISGNT
FT                   GFSLDIRSEFDDKRDVALDEILQQLEAIAARRNVRIERKATHAANAVHCDEKLQSKLRN
FT                   AIEAQSMAVHTLFSGAGHDAMAIADICPVAMLFMRCDKGISHHPAEAIDTPDVAVTLAV
FT                   LNHTLQNLA"
FT   gene            510934..511299
FT                   /locus_tag="Mmwyl1_0456"
FT   CDS_pept        510934..511299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0456"
FT                   /product="protein of unknown function DUF861 cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861 cupin_3;
FT                   KEGG: fjo:Fjoh_4182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69393"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG4"
FT                   /protein_id="ABR69393.1"
FT                   /translation="MKFTRIFNDDQGKSHFGELNLDVRDGGAIGFLSERFPVGEMIFRE
FT                   TPSDYDFKWHPAPQRQFLFIIKGRCEFKVSSGETRQFGAGDVVLLEDTQGEGHCSKALF
FT                   NEVRHSIFVTVPDDVVF"
FT   gene            complement(511338..512408)
FT                   /locus_tag="Mmwyl1_0457"
FT   CDS_pept        complement(511338..512408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0457"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   shn:Shewana3_0970 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69394"
FT                   /db_xref="GOA:A6VSG5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG5"
FT                   /protein_id="ABR69394.1"
FT                   /translation="MWLNKKRFQALENELTQVTAEKQALETDMSELTATIESLRNISEA
FT                   PATQLDNRFFLPQRNINQESFAAINQVLELLFEPMSAAEGSNVEIEKNKADINQLSTSL
FT                   NEIAGQTQLSLEDVNGLKDIANEIKGFTNTIQSISEQTNLLALNAAIEAARAGEHGRGF
FT                   AVVADEVRTLATKAKDSSEQISALVNRIDNRTIKVSQQIEKLHENTLRVSQTCENLNHS
FT                   FNKTAESTQSLMEASYKSMAYSHVSASLLELNNWQTSCLINVIKGKNTMINVRETAAAD
FT                   WYFNGTDNEFDFRHTSSFINMAGEFEQLDALAQTMMQTSPSDIEKLAQLQIEMEKHING
FT                   IHQRLKESQTYLFSHL"
FT   gene            complement(512522..513916)
FT                   /locus_tag="Mmwyl1_0458"
FT   CDS_pept        complement(512522..513916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0458"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   cps:CPS_2040 amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69395"
FT                   /db_xref="GOA:A6VSG6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG6"
FT                   /protein_id="ABR69395.1"
FT                   /translation="MSDITNVGTIMTADKSATKIQKLGLPTMMAICIGLVIVQGSMISA
FT                   LQGIGIGGMGFIFAMITALILAQFNAMSFAELSLMFPEKGTLATYTQKAIGHFPAIVSV
FT                   FAGYVVVAVLAIPVEMFLVDAMLSQLLPGLLPEKVGPLLILLLFTATNLIGTDVFARIQ
FT                   NVLAFILVSALILTGVVAISGTSEPHPVLAGATVDWGFAGVLDGSFIGLVGLALWTMVG
FT                   VEFICPMIKEVKNPHQNIPRSMHLSLFMIFFIFTAFVYGASLYLNVDELVGSPLPFLDY
FT                   ANAVFGKSGLIIATAMGLAATCCTMNTVLAAVPRMLQGMAEQGQAFPQLKAKNRFDAPW
FT                   VGILMITGLTTIPYFSLGIDSLITLVIAATTSWLLAYIVAHINVIVLRKRMPDHPRPYR
FT                   TPFYPLPQILGIAAMLYVALNNSPSPEMTEMVYSITGGILLVLCVIGAIWVKFFMKRGL
FT                   FEPDSK"
FT   gene            complement(513972..515264)
FT                   /locus_tag="Mmwyl1_0459"
FT   CDS_pept        complement(513972..515264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0459"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG: vvy:VV1566
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69396"
FT                   /db_xref="GOA:A6VSG7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG7"
FT                   /protein_id="ABR69396.1"
FT                   /translation="MTKTLDAVHTTDQLPESTTVVIIGGGVIGVTAALTLAERNIPVVL
FT                   IEKGHIAGEQSSRNLGWIRKTSRHFEDVPLALAADKLWAEMPERIGQSVGYKQSGIMFL
FT                   AKTEEQMAMHEGWLKSVDSLSLDSKMLSSQEIDQHVPGGQGKWQGGIYTPSDGRAEPSI
FT                   AVPAMAKAAIEKGAILVQNCAVRTLSTTAGKISGVVTEKGEIRCSQVLLAGGAWSRRFL
FT                   GNHGISLPTLPLVCSVLRTKPMDGPTDISVGGPDFSFRKHKDGGFIITQRGALDAHITL
FT                   DHLLIGWRYLSQLRAQRSFLRTSFGREFFKDLGLARRWTANSRSPFEKIRTMDPAANPD
FT                   LNHEALTNLRNAWPIFNQAQIEEAWAGVIDVTPDSNPVIDHIEDIPGLTIATGFSGHGF
FT                   GTGPAAGQLAADLVSGVEPLIDPKPYRFTRL"
FT   gene            complement(515297..515719)
FT                   /locus_tag="Mmwyl1_0460"
FT   CDS_pept        complement(515297..515719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0460"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: vvy:VV1565
FT                   putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69397"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG8"
FT                   /protein_id="ABR69397.1"
FT                   /translation="MTKIVKVKTGSKLEEISSYSRLVSVDNWIFVSNTAGRNPETKEIP
FT                   DDVLEQTHQVFSNVEAALKAVGSSLADVVMSRVFIQNPADTEAVMTLIGEKFRGIDPAT
FT                   TVTCPPLGSTIYKMELEVTAFRGASNAEVEIINTAK"
FT   gene            complement(515765..516913)
FT                   /locus_tag="Mmwyl1_0461"
FT   CDS_pept        complement(515765..516913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0461"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   vvy:VV1563 predicted ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69398"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSG9"
FT                   /protein_id="ABR69398.1"
FT                   /translation="MSTTSENTNIDFIYLSEQDMIKAGVMDMPQCVDTMDEMFTLLYKG
FT                   DYRMAGPNSDSHGAMITFPDESPFPTMPKPTADRRLMAMPAYLGGDFQTSGVKWYGSNI
FT                   ANREKGLPRSILMFILSDTDTGAPLAYMSANLLSAYRTGAVPGVGARYLARKNSKVIGL
FT                   LGPGVMGKTAVAAFMAVCPDIDTIKMKGRGQKSLDVFIEWVNETFPQITNVQIVDTLEE
FT                   VVRGSDIVTYCNSGVTGDPSTYPIVKREWVKPGTFLVMPAYCSLDDGMEQDDVRKVLDN
FT                   TGLYQAWYEEVPKPAHNYIPLPGVRFMDMIAEGKITLDDLEDIGKITAGEAPGRKNDDE
FT                   IIIMSVGGMPVEDVAWATKVYRNAIAQNIGVKLNLWETPVLR"
FT   gene            517149..517982
FT                   /locus_tag="Mmwyl1_0462"
FT   CDS_pept        517149..517982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0462"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: vvy:VV1562 AraC-type DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69399"
FT                   /db_xref="GOA:A6VSH0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH0"
FT                   /protein_id="ABR69399.1"
FT                   /translation="MLKDSVYDRVSGIHSKQPWFVLGAAQDFLLYHSDIPSISHFYSFE
FT                   TDVLTEQVLAIPDGCVDILFDCDDLRPSAKVCGTTLAASNAEFIPNHRYFGVRFAPGVI
FT                   PDFLDVSANELIEHQLNFLEVAPKFCHFFEIIVRSNVFADQVALFEKFYSNQSTRQPSK
FT                   LTLQAMDEIFTHKGNIQIQDIAETTGYTTRTIQRQFRADMGMSPKAFSRIIRCQSAVYD
FT                   INHSKGVTFSDLACDLGFSDQAHFLREFKKLVSVTPLDYLQRVKQEAYVGRLRYY"
FT   gene            518190..519116
FT                   /locus_tag="Mmwyl1_0463"
FT   CDS_pept        518190..519116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0463"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   hch:HCH_03455 ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69400"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH1"
FT                   /protein_id="ABR69400.1"
FT                   /translation="MQVNQVRKWAFLLIAFLLILAPVNQVMASEKKTIIHAMGSSEVPQ
FT                   KVLRVVTLFQGATDSVVALGVTPVGVVDSWAQQPTYEYLRDALKGVAHVGLETQPNLEA
FT                   IVALKPDLIIGTKSRHEKIYRQLSQIAPTVMAEDVYDFKTTLDLTAEALNKQEKGKQVW
FT                   DGFQQRITNFHNVIKKREANWPLTAAILNIRADHLRLYLNQSFPGVVLKEIGFKFPLPN
FT                   ENGWGVKLKTKEALPSVNADVFFVILHSNDAAVRQNYDAWRAHPLWKMLTAPKNKQVYE
FT                   VDNVAWLLSGGILGADKILDQLYQIYQ"
FT   sig_peptide     518190..518276
FT                   /locus_tag="Mmwyl1_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            519142..520152
FT                   /locus_tag="Mmwyl1_0464"
FT   CDS_pept        519142..520152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0464"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   hch:HCH_03456 ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69401"
FT                   /db_xref="GOA:A6VSH2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH2"
FT                   /protein_id="ABR69401.1"
FT                   /translation="MHLHSSHTFKWSFLALSILCLMLSLLGSIAYGQYVISAKSVWTAF
FT                   WAFDPQSIDHVIIRTTRLSRALVACLVGSALAVAGVLMQALTRNPLASPSIFGVNAGAV
FT                   FSIVLFSTFFSVTSLNTFLWLAFLGASVAGALVYGLGSLGKDGLSPVRIVLSGAAISAL
FT                   FMAFTQGILVIGQEGLDSVLFWVAGSVSGRDLSMVMPLVPAFVAGIVLAILAAPQINIL
FT                   LSGDDIAKGLGQNTVLIKVVLSLLIIGLAGGSVALGGSIGFIGLMVPHMVRSVVGYDHK
FT                   WLIPLSALWGAILLLCADVISRFVIMPEEVPIGVTTAILGAPFFIYLARKGGKRE"
FT   sig_peptide     519142..519240
FT                   /locus_tag="Mmwyl1_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.586 at
FT                   residue 33"
FT   gene            520145..521176
FT                   /locus_tag="Mmwyl1_0465"
FT   CDS_pept        520145..521176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0465"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: hch:HCH_03457 ABC-type enterobactin
FT                   transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69402"
FT                   /db_xref="GOA:A6VSH3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH3"
FT                   /protein_id="ABR69402.1"
FT                   /translation="MSKSFSIRHRLFSFSTPVRSLWSILALLVFFLSIILLSLCLGEEF
FT                   IALPQLFQVLLGKGGQAAQFVVETLRMPRVLMAAMVGAALASSGLVLQSMIRNPLASPD
FT                   IIGITGGASAAAVCFLSFFATAMGGIWLPVFAIAGALLAALLIYALAWNSGVTPMRLVL
FT                   VGIGISSAMGAVTTFVIAASPLSTSITAYIWLTGSVYGASWIEVKALLPWLLISWPLAF
FT                   YLARRVNTQELGDQLATGLGIPVQRLRLILLFLSVIMAAPAIAYAGAVGFVGLIAPHIA
FT                   RRLVVRSFALLLPTSALVGACLVMLADLCGRLLFQPLDIPAGVFVSAIGAPFFIYLLYR
FT                   QRF"
FT   sig_peptide     520145..520273
FT                   /locus_tag="Mmwyl1_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.987 at
FT                   residue 43"
FT   gene            521207..522067
FT                   /locus_tag="Mmwyl1_0466"
FT   CDS_pept        521207..522067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0466"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: btl:BALH_0556 iron(III) dicitrate ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69403"
FT                   /db_xref="GOA:A6VSH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH4"
FT                   /protein_id="ABR69403.1"
FT                   /translation="MSLSEHSLVDDNLFAQSPLESVALSLGYEKKTIIKSLDLAIQSNQ
FT                   ITVLVGGNGCGKSTLLKSFARLLKPSTGQILLNGADIHSLSGKDVARKLAILPQGPVAP
FT                   EGLTVELLVRQGRYPHQNWLQSWTEDDERLVRKALHDTNMTEFADRSIDALSGGQRQRA
FT                   WIAMALAQNTDILLLDEPTTYLDLTHQIEILDLLFELNATQNTTILMVLHDLNLAARYA
FT                   HNMIAIKDGAVFCQGAPETILDHDMVKAVFDMECHISADPLFGTPMCIPYGKGRKVDSQ
FT                   AAKHV"
FT   gene            522060..522866
FT                   /locus_tag="Mmwyl1_0467"
FT   CDS_pept        522060..522866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_2594 unknown conserved protein in
FT                   bacilli"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69404"
FT                   /db_xref="GOA:A6VSH5"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH5"
FT                   /protein_id="ABR69404.1"
FT                   /translation="MFKQAPKQALLPEEWDVLAAFGLKPYQQDEPLAIDSSKLLDDELC
FT                   LETLQKIMPELGAPNLKVTASLVIKRIAFIALAPVLYAMSGFDKGLDASIENSVFEYPL
FT                   ENKMWLSKMPLKTTAVSVWKGSDKEGRNAWRHEILSKVFSGHLTLLVEQFYRLTKVSRR
FT                   ILWENVAVRVFSIYEQRILASVIEEKRATAEADYAYLLDKSTTALFGLNENPLTVFYRE
FT                   KQLTAISENPIRVRRTCCFYYQATEPPVYCGSCPLPLKKANSSLKK"
FT   gene            complement(522893..524995)
FT                   /locus_tag="Mmwyl1_0468"
FT   CDS_pept        complement(522893..524995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0468"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: hch:HCH_03460 outer membrane receptor
FT                   protein, mostly Fe transport"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69405"
FT                   /db_xref="GOA:A6VSH6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH6"
FT                   /protein_id="ABR69405.1"
FT                   /translation="MLSKKPYTAIILLPFALSASQITLADTESVSLDELVIQTSRSNTK
FT                   KEDSPQVITVITRQQIEDQLSISSDSSQVLSSLLPAYAPNTQKLNDSSQSFRGRSVLYM
FT                   IDGVPQSNPLRDGSRAAHTIDLAMVERIEVIHGASAIHGLGATGGIINFITKSNRSNEL
FT                   KQHVDVQLTTPTDELKSDSLAYKIGYQVEGAQDNFDYLVGLTNEVQGVYLDADGDYVGS
FT                   DSTRGDTMDSKSYDAFIKLGYWLTDDKRLELEVNKYRLKGRMNFTGVNGDRSNGIPTSS
FT                   IKSTPRGLAPYNDVQTTSLAYTDSDLDGMEFKAQVFHQDFEGRYGVSKSGSFQDPSNGI
FT                   TFDQSQNQSEKIGAKFSLTKDDLLDNDLSVTAGLDLLQDTTSQTLILTNRTYVPETEYT
FT                   NYAPFVQLEYRPTDRLVLQAGARNEHAKLDVDTYQTVAANNNVTVNGGKPSFSDTVYNA
FT                   GAVFKITPAISVFANYSQGFGMPDVGRVLRGVNTPGQDVDSLIDLSPIVTDNYEVGFRV
FT                   NRHPYDFELSYYESNSDLGSRIEAVNGLYVVKREKKEIQGAEASLGFQLNKDHRLQASY
FT                   SFIQGKSDTDGDGKVDTKLTGSDISPNRLVTSWNARWSDKLSSLLQINHAFDKSFDDKK
FT                   LEFDGYTLIDASVGYKLPVGKMSVAVSNVFNEDYFTYYSQSSVKTDDLYFKGRGRTVTL
FT                   AYGLDF"
FT   sig_peptide     complement(524918..524995)
FT                   /locus_tag="Mmwyl1_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            complement(525184..526110)
FT                   /locus_tag="Mmwyl1_0469"
FT   CDS_pept        complement(525184..526110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0469"
FT                   /product="Chitin deacetylase"
FT                   /EC_number="3.5.1.41"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   reu:Reut_A2437 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69406"
FT                   /db_xref="GOA:A6VSH7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH7"
FT                   /protein_id="ABR69406.1"
FT                   /translation="MKHYLERDYAGYGRQGLPNVKWPNNARIAVQFVLNFEEGGENCVL
FT                   HGDEHAETFLSEIFGAQPFKDRHMSMESLYEYGSRTGVWRILNEFERRGLPLTVFAIAT
FT                   ALQRNPEVAKAFVEGKHEIVCHGLKWIHYQEMPIEQEREHMQQALALIEEVTGVKPVGW
FT                   YTGRDSPNTRALVAEQTQLKYDSDNYGDDLPYWVKVDTPDGDSKPHLIVPYTLDCNDMK
FT                   FSSPYGFNHGEEFFQYLKDNFDCLYEEGATAPKMMSIGMHCRTLGKPSRFMALKKFLDY
FT                   VQSHDNVWIARREDIANHWIENHPPQF"
FT   gene            complement(526151..526882)
FT                   /locus_tag="Mmwyl1_0470"
FT   CDS_pept        complement(526151..526882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0470"
FT                   /product="Asp/Glu racemase"
FT                   /note="PFAM: Asp/Glu racemase; KEGG: psb:Psyr_3529 Asp/Glu
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69407"
FT                   /db_xref="GOA:A6VSH8"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH8"
FT                   /protein_id="ABR69407.1"
FT                   /translation="MRIQLINPNTSADMTNAMALSAQSVALDSTQIIACTPEHGPKSIE
FT                   CAFDEVIASAALLDLIEQGKQQGVDAHIIACFGDPALDAARELADAPVIGIAEAGFQMA
FT                   SLIAHRFGVVTTLSRTLPASEHLLQKYGHQHKCSGVRATDIPVLALENIDPAAYQLLKT
FT                   ECLAAIEEDGAEAIVLGCAGMSSLVEKLSAELPVPIIDGVVAAVKLAESLHQLGLQTSK
FT                   KGQYGQRVSKAFTGRYAHWSL"
FT   gene            complement(526890..527555)
FT                   /locus_tag="Mmwyl1_0471"
FT   CDS_pept        complement(526890..527555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0471"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: psp:PSPPH_3471 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69408"
FT                   /db_xref="GOA:A6VSH9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSH9"
FT                   /protein_id="ABR69408.1"
FT                   /translation="MSNDENIYRQMLNAIVEHQLPPGARLPEDRLSEAFGVSRTGIRKV
FT                   LQRLALEHFVIIEKNKGAQVNRPSEAEASEVLDSRILIEPQLIPALLDHWNTEHSERFR
FT                   IMVTEEKRAEEANQLADSIQLTARFHYELAKLSGNQVLANFVQQLCYRSSLILAAYGTR
FT                   GSVGCECGDHSQLLDILDQGRKDEAKTWMSHHLKHIKSSLILESKPEENIDFQRLFGR"
FT   gene            527824..529260
FT                   /locus_tag="Mmwyl1_0472"
FT   CDS_pept        527824..529260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0472"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: aci:ACIAD2247 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69409"
FT                   /db_xref="GOA:A6VSI0"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI0"
FT                   /protein_id="ABR69409.1"
FT                   /translation="MKQEFEQSPKLANRDLLPEKDQKWGWYSIFAFWMSDVHSVGGYVF
FT                   AASLFALGLNGIQVFISLLLGISIVLVFANLMGKPGQKAGVPFPVVARMSFGVFGANIP
FT                   AIIRGLIAVVWYGIQTFLASSSFIILLLYFFPSMASLADQSFIGLSYLGWIGFTAMWVV
FT                   QGIVFMFGMDMIRKVIDWSGPAIYVAMFALCIYMVDRAGWENISFNLSSNNLTGMDVIV
FT                   QMFIAIALVAGYFAGPTLNFSDFSRYCGSYKKLKLGNLLGLPLNFVLFSLFSVVIVSAS
FT                   IPVFGEMITDPVETVKRLDSGFITVLGALTFIFATVGINIVANFVAPAFDFSNVSPQKI
FT                   SFKAGGFIAAFGSVLLTPWNLFNNPEVIHYTVDVLGAMIGPLYGIIIVDYFFIKKGHID
FT                   IPALYTESPKGCYWYENGVNKKSVYALLIAGAVSILATFVFSALANYAIFIGGIVAALS
FT                   YRYMMEPERLALQSMSLAKP"
FT   gene            complement(529328..530062)
FT                   /locus_tag="Mmwyl1_0473"
FT   CDS_pept        complement(529328..530062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0473"
FT                   /product="regulatory protein IclR"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: aav:Aave_3331 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69410"
FT                   /db_xref="GOA:A6VSI1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI1"
FT                   /protein_id="ABR69410.1"
FT                   /translation="MTSLNKMLNVLNIFGPDSLVINVDDIAKKLSLSRATAYRYVRELC
FT                   DAGLLTRFDKNYTLGPKIIELDWMMRQYNPIISQGHEIMAQLSKSTELTVYMSMFCDGH
FT                   IINTHIESDNKEYTLAFGRGRALPIFKGAQSKVLVANQKAFRLKKIYDEHIAQNEDYDM
FT                   TWDQFNTETKRIRRNGFCVTHNELNNLSLTGIAAPIFNLENNEIIGSVAFLGTASEFEP
FT                   TSLVVLVEHLKQATSAIERCAN"
FT   gene            complement(530439..531749)
FT                   /locus_tag="Mmwyl1_0474"
FT   CDS_pept        complement(530439..531749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppu:PP_3464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69411"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI2"
FT                   /protein_id="ABR69411.1"
FT                   /translation="MKILLKRNTLNMCVCAALAGLTSAAQAYSIIDNEDSHVTFTGEAA
FT                   VGAFKSQETYGNSKSSPSWQEGYIKYGLTGDKTLNDGELFGSVSALSSGTWGDGDAGGA
FT                   TTGDERKTKLEELFIGYRTGQFELSVGRQSFRVGDGFIINGDALNLGSGLDSVPGAAGI
FT                   TLNRGGGLWFAPRKAFSNTAILRVGGDEGWRSDVYWLQSDNAGQASTEMAGINIENNNQ
FT                   YGVVGFLYNQGLSVDAKEANFFGLEKRDGQKTMSVRFQGNAGVENLFLSSEYVKQTQGD
FT                   NSKDANAWYAEAGWTFADTTWSPSVNYRFTRYDEGYDPLFYGFSRGYGTWFQGEVAANY
FT                   AGTSGSTIASDIQSISIKATPTEMLSVGAAYFDISKNKTAEGKKNDAQELDIWAEWVVN
FT                   EHLIVSPLVGFYTPKYDSKQGNTNTNTYMQIIAIMPF"
FT   sig_peptide     complement(531666..531749)
FT                   /locus_tag="Mmwyl1_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 28"
FT   gene            complement(532013..533419)
FT                   /locus_tag="Mmwyl1_0475"
FT   CDS_pept        complement(532013..533419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0475"
FT                   /product="ethanolamine transproter"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: pin:Ping_0278
FT                   ethanolamine transproter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69412"
FT                   /db_xref="GOA:A6VSI3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI3"
FT                   /protein_id="ABR69412.1"
FT                   /translation="MSDQINKEYLAKRQLKRGSAGWILLAGLGVSYVISGDFAGWNFGI
FT                   AEAGWGGFAIAAGLMAIMYLTLVLSLAEMSAAIPAAGGGYSFARQAMGPTGGFLTGLAV
FT                   LIEYALAPAAIVIFIGSAVEALLGFNGPWVYAAFYIVFIGIHLAGAGEALKVMMVISGL
FT                   AVIAILATAVALIGDFDTSRLFDVAVTDAAGASEFMPMGWYGVWAALPFGMWLFLAVEG
FT                   VPLAAEEAKDPAKDVPKGIIGAMIFLLFTAVLVVFLLAGAAGADAMGKSAVPLVDALNF
FT                   AGHGSLATTVNVLGLAGLIASFFSIIYGYSRLVFALSRAGYLPQSLSVTDKRKVPSRAL
FT                   IVPGILGFLASLTGEGDLMLAMAVVGATVSYALMALSHILLRIKQPDLHRPYKTPGGIF
FT                   TSSVALVLSLLALTGVYAYDPRAFNYTLVLFVIGAAYYFLYSKNRLVAKTPEEEFDMLA
FT                   AAEADLATSP"
FT   gene            complement(533559..534413)
FT                   /locus_tag="Mmwyl1_0476"
FT   CDS_pept        complement(533559..534413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0476"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   pat:Patl_1428 ethanolamine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69413"
FT                   /db_xref="GOA:A6VSI4"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI4"
FT                   /protein_id="ABR69413.1"
FT                   /translation="MSQEDKSFPTHPHAEPVTENAWSKLNAFTDARVGLGRSGVSVPTK
FT                   HLLAFQLAHAQAIDAVHTQLDTDALSKAMMEQDWAKDWTKHCAPLLLHSRATDRSTYLQ
FT                   RPDYGRRLDDESANKLDEHRVSTSQDYDLAIVVVDGLSSLAVEQNTLPFLQALSSHING
FT                   WNLAPVCFVKQGRVAIGDDVCERLNAKCVLVLIGERPGLSSPDSLGLYLTWGGKVGLTD
FT                   AYRNCISNVRPAGLVYQEAARKAFYLLKEARTLKLSGVKLKDRSDDDLIVDTSKESKNF
FT                   LIS"
FT   gene            complement(534410..535831)
FT                   /locus_tag="Mmwyl1_0477"
FT   CDS_pept        complement(534410..535831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0477"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: pat:Patl_1427 ethanolamine ammonia lyase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69414"
FT                   /db_xref="GOA:A6VSI5"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI5"
FT                   /protein_id="ABR69414.1"
FT                   /translation="MSKPNSTFQFKNIVGERTFGFVDLADLMAKATPARSGDRLAGVAA
FT                   QSAEERAIAQMTLADVPLSLFLEQALVPYEEDEITRLILDDHDKSAFSAISHLTVGGFR
FT                   DWLLSDLASSEILIQIRAGVTPEMAAAVSKIMRNQDLILVAKKCHVKTAFRNTIGLPGH
FT                   LSTRLQPNHPTDDLTGIAASMLDGLLYANGDAVIGINPATDNVQQATRLIKMMDEVIQH
FT                   YEIPTQSCVLTHVTNTIECIEQGAPVDLVFQSIGGTQATNDSFGFNLATLAEAQAAALS
FT                   LNRGTVGNNVMYFETGQGSALSANANHGLDQQTCEARAYAVARKFNPLLVNTVVGFIGP
FT                   EYLYDGKEITRAGLEDHFCGKLLGLPMGCDVCYTNHAEADQNDMDNLLTLLGVAGCTFV
FT                   MGIPGSDDIMLNYQTTSFHDALYARRVLGLKPAPEFDLWLAKMEIFKNNEQFTLNHQLP
FT                   DAFHKSLNRMIGGKS"
FT   gene            536060..537034
FT                   /locus_tag="Mmwyl1_0478"
FT   CDS_pept        536060..537034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0478"
FT                   /product="helix-turn-helix-domain containing protein AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rfr:Rfer_0584 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69415"
FT                   /db_xref="GOA:A6VSI6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI6"
FT                   /protein_id="ABR69415.1"
FT                   /translation="MSLNLKNAPKEGFPPRISKVRLSEAHDADLHASNLTNWQQEYDQI
FT                   SRGSFYGRIVELPFDGLQVFCEHTSQALQQKCVVWPDSVWLGIPLVDQEESRINGLTIN
FT                   PNNIMCRPGDCDFQLSTPQDYDLYGLVVDRSKLIKMAAIHGVDLNWKELTECGRLGVPD
FT                   KTLEEVRFVLARLLSVQNNTTPPRLQQDIVMMALLEVLKVETPQPAKTQSYYHRKKVVD
FT                   CARQFLDYHLDEPVTVTQLCEITNVSRRTLQYSFESILGVSPIQYLRISRLNGVRRSLV
FT                   QAKDGQAVSDIAAQWGFWHLSQFAKDYKLLFGEQPSQTLEWSC"
FT   gene            complement(537065..537751)
FT                   /locus_tag="Mmwyl1_0479"
FT   CDS_pept        complement(537065..537751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0479"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mag:amb0848 response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69416"
FT                   /db_xref="GOA:A6VSI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI7"
FT                   /protein_id="ABR69416.1"
FT                   /translation="MTQIYFVEDNTVLLDNGLLWLKNEGYDAHGASSAKELSSLMENQI
FT                   PDLVILDWNLPGEDGLSIAGKLRNDPETQDIFIIFVTARNSMDDRLSALVEADAYITKP
FT                   FDYRELLATIRALLRRSNNSEQDLNIWKYMPARRIIRSPDEVELEITEKESMLIQIFIQ
FT                   HAGAVISPKMVSKAFNEDLSIFEKNRIEVLVSRLRNKLKTGNNNPIRSFRNKGYQLMIK
FT                   IESIEE"
FT   gene            complement(537748..539718)
FT                   /locus_tag="Mmwyl1_0480"
FT   CDS_pept        complement(537748..539718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0480"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Diverse 7TM receptor
FT                   extracellular region 2; KEGG: har:HEAR0395 hypothetical
FT                   protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69417"
FT                   /db_xref="GOA:A6VSI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI8"
FT                   /protein_id="ABR69417.1"
FT                   /translation="MTTFSRAITILFYIIVLCLFSLQAQSQNIIIENDVSTLNLKKNIE
FT                   YLVDKKGNLTLEDVLHKKDDFVTVTFPFGAGFSKDVHWFRFTLQREQDAEKDWLLAVNP
FT                   TYLDSVKLYRPVGDNEHYSEDEVGDQLPARSRTSNSILTLFSFPITLADTRPHTFYIRL
FT                   QTESSTLLQLTLRTKLAAELAKSSLTLKSGIEIGGWLMLCLYACVMSWLSKNNAYILSC
FT                   LYVIGCMIRRLHISGIAAQYIFPNDPFLVGLLAPLGVCLMISGITVFIMAFFKTNTNFK
FT                   YLHLFLIFELGLVFVAFISIFLGKYNSVAPIMFFSVLILFTILSFIIWKGVTLGIAGSR
FT                   SLFWGFLIFFLLNGSAAIITASNISTPPLLLEMPELSSFIFIILMYQGLYQHKKAEDDR
FT                   NKNLEIKIKLAHKNTEMEKKLRVDQSNFMMLITHELKTPLTVIDSVLQTLDIERINISS
FT                   ALAERHNIIKKSIDELNSLINTTLMTEHSESKNFSPIPEKMDAYQSIHKVITQLSIKEQ
FT                   EYLLKIPRKLSVYADPSLLKLVLSNLLMNAVKYKTPDSVISIDINETIQKNKSGTLIAI
FT                   SNYYDSEIEPNPEIWFHKYYRQLDTPNIQGFGLGLYLTKAIIDAHSGLIKCHTEKEQNL
FT                   WKITFEVWFPSLEKDQDLSRI"
FT   sig_peptide     complement(539638..539718)
FT                   /locus_tag="Mmwyl1_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.705 at
FT                   residue 27"
FT   gene            540160..548394
FT                   /locus_tag="Mmwyl1_0481"
FT   CDS_pept        540160..548394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0481"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: filamentous haemagglutinin domain
FT                   protein; GLUG domain protein; KEGG: mgm:Mmc1_2695
FT                   filamentous haemagglutinin family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69418"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011493"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR041286"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSI9"
FT                   /protein_id="ABR69418.1"
FT                   /translation="MGTQHDEEAAPFGLARRSVAGVLIFTLTLQPVLAAENLPNAASVV
FT                   SGQVSIGTSGNTMTVTQGSDKAIVNWGSFSVGQGASVNFIQPGSTSAILNRVTGSTTST
FT                   IAGAIHANGQVFLINPNGIAITSTGSIKVGGGFVGSTLNISDKDFLNDHFVFKGDGASA
FT                   GVSNAGIITVGRGGYAALIGGTVQNSGLIAVPLGKIGLGSGEQATLNFSGDGFLKVALP
FT                   TKAESEDNGVLIDNQGILSADGGTVLISVASARDAARHVINLSGVVEANSVSGRDGKII
FT                   IGGGQGGDVTVSGTVAATSASGKGGDITVTGKNIALNGATIDASGATGGGSVKIGGDYQ
FT                   GKGNTQRAKTTTVDTSSVIRADANQSGKGGKVIVWSDDLTTFDGLISARGAGAGKGGDA
FT                   EVSGKARLAYNGFTDLSGPGGFGALLLDPYNITISSDADSNSSGFTASGNDSVINVDTL
FT                   VTALGAANVEVTTGSGGSQDGDIVVASDVSWIADTTLTLKAAGSIAVNAAITASGENAG
FT                   LVLTYGSDKDYHVNAPITLSGASATLKINDNDYTLIHSLANFQAISGSASGSYFALAQD
FT                   LDLSGNSFGSALVTAFGGTLTGLGHTISNLTINAPDADNVGLIGTNDGTIRDLGLVGGS
FT                   VTGHKNVGGLVGYNNGTISNAYATGTVTGTDYVGGLVGYNNGTISNAYATGTVTGTDYV
FT                   GGLVGQQYTKGTTINAYATGAVVGSTGSGQYAGGLVGDNSGIISKSYATGGVVINRFAG
FT                   GLVGRNQGTISNTYATGMVSVANYAVGGLVGENQGTISNSYSTGMVKSGRGEIGGNTGG
FT                   LVGYNSGGTITASFFDKGTTKQDKGVSVGSSVGVTGLTTIEARDSSKYTGWDFSTDWYQ
FT                   SGDMRPILRSEAATAVGGVISVSNLHQMALIGANLSGTYHLTRNIDASATNAESETYSA
FT                   SSIWGSGGFVPLGNVSTPFSGTFDGQSHVISNLTINRPTKNDIGLFGYVGTDGIIRNVG
FT                   INGGSVTGHYNIGDLVGHNKGAINNAYATGAVIGKGSTAYVGGLVGVNDGSINNAYASG
FT                   TVTGEASSRIGGLVGYNQGSISYAYATGAVTEGGSVGGLVGYNNKGTITSSFWDTETTG
FT                   QTSSAGGGTGLTTTGMKILSNFSDWNIDNKGGTGTVWRIYDGYTAPLLRSFMTGLTITG
FT                   GSARKTYDGSVTSTSVGTLTYSDANYDPSLVKGTAQYTASSANAGSYSGVNLALNGLYS
FT                   SQQGYDISTKSGALAVSKATLKVAANDASKTYDGKAYTGGNGVTYTGLVNGETNAVLGG
FT                   TLAYGGTAQSATNAGSYDITASGLTSGNYAITYDKGALTVNKATLKVAANDASKTYDGK
FT                   AYTGGNGVTYTGWVNGETSAVLGGSLAYGGTSQGATNAGSYDITASGLTSDNYAITYDK
FT                   GALTVNKAALTVAANDASKTYDGKAYTGGNGVTYTGWVNGETNAVLGGTLAYGGTAQSA
FT                   TNAGSYDITASGLTSDNYAITYDKGALTVNKAALTVAANDASKTYDGKAYTGGNGVTYT
FT                   GLVNGETNAVLGGTLAYGGTAQSATNAGSYDITASGLTSDNYAITYDKGALTVNKAALT
FT                   VAAKDASKTYDGLAYTGGNGVTYTGWVNGETNAVLGGSLVYGGTSQGATNAGSYDITAS
FT                   GLTSDNYAITYDAGQLTVNKAALTVAANDASKTYDGKAYTGGNGVTYTGWVNGETNAVL
FT                   GGSLVYGGTSQGATNAGSYDITASGLTSGNYAITYDKGTLTVSKAALTVTANDASKTYD
FT                   GLAYTGGNGVTYTGLVNGETNAILGGSLAYGGTSQGATNAGSYDITASGLTSDNYAITY
FT                   DKGALTVNKAALTVAANDASKTYDGKAYTGGNGVTYTGWVNGETNAVLGGTLAYGGTAQ
FT                   SATNAGSYDITASGLTSDNYAITYDKGALTVNKAALTVAANDASKTYDGKAYTGGNGVT
FT                   YTGLVNGETNAVLGGTLAYGGTAQSATNAGSYDITASGLTSDNYAITYDKGALTVNKAA
FT                   LTVAAKDASKTYDGLAYTGGNGVTYTGWVNGETNAVLGGSLVYGGTSQGATNAGSYDIT
FT                   ASGLTSDNYAITYDKGALTVNKAALTVAAKDASKTYDGLAYTGGNGVTYTGWVNGETNA
FT                   VLGGSLVYGGTSQGATNAGSYDITASGLTSDNYAITYDAGQLTVNKAALTVAANDASKT
FT                   YDGKAYTGGNGVTYTGWVNGETNAVLGGSLVYGGTSQGATNAGSYDITASGLTSGNYAI
FT                   TYDKGTLTVSKAALTVAANDASKTYDGLAYTGGNGVTYTGLVNGETNAILGGSLAYGGT
FT                   SQGATNAGSYDITASGLTSDNYAITYDKGALTVNKAALTVAANDASKTYDGKAYTGGNG
FT                   VTYTGWVNGETNAVLGGSLVYGGTSQGATNAGSYDITASGLTSGNYAITYDKGTLTVSK
FT                   AALTVTAKDASKTYDGLAYTGGNGVTYTGLVNGETNAILGGSLAYGGTSQGATNAGSYD
FT                   ITASGLTSDNYAITYDKGALTVNKAALTVAANDASKTYDGKAYTGGNGVTYTGWVNGET
FT                   NAVLGGTLAYGGTAQSATNAGSYDITASGLTSDNYAITYDKGALTVNKAALTVAANDAS
FT                   KTYDGKAYTGGNGVTYTGLVNGETNAVLGGTLAYGGTAQNATDAGSYRITASGLTSGNY
FT                   DITYQDGQLSISGAPTSQPDAGRITNNSTFSPVNFVPSVGRQLVSYGSGPINSIANADG
FT                   TAVGADSSVVSSNNGQGDIMSTQDTRLSGAVCFAGSDFAISCNQ"
FT   gene            548435..550174
FT                   /locus_tag="Mmwyl1_0482"
FT   CDS_pept        548435..550174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0482"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; KEGG: pde:Pden_2460
FT                   polypeptide-transport-associated domain protein, ShlB-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69419"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ0"
FT                   /protein_id="ABR69419.1"
FT                   /translation="MMLSNKFTPIATALVVTGLTAFPLSAFAETASQVTQPSYAPAVTS
FT                   PAQGVLDLPATSNLTAPAGADTLFVTPSGLTVEGQLPELQSETAKIETSIKDQRVSGSE
FT                   LFAAAQALEAAYVRAGYLLARVTLPPQTIADGMALKLIVTLGYVEGIDASAFDGTTRRR
FT                   IEAVLQPLVGNRALTNRELERRLLLAGDIPGVLLQSTLKAGEKMGATVIVVDGRANPVL
FT                   FSASFDNSLSDGLGNYNASLGANFNNMFGLGEVGYVQLGGYPGSKNSMFNSDPRNRQMV
FT                   VGFTLPLTINGLWLNVEGVDSRTHPTSNLNFTMLDEYQRFSAKLGYNWLRSRNLNTSSE
FT                   IGFGMSNETQIVEMSKARTDWSKDALRVLRFTQNADMYATWGGFISGNATVSFGLDSFG
FT                   ARQGTTALPMSRSGAEPDFSKLELSGRYSQGLANNQVQWSVAVKGQTSFGNVMASSEQF
FT                   GLGGFDGLSAFEGGALMGDSGAMVRTELTLPLVLPSIASSPSLGAAVAPYVFGAAGFTE
FT                   LEQVTAVENATNHANSFGVGLRFGVSQVESVLGTTLTLEYAHGNQDNGPSDNRFNLRWL
FT                   AQF"
FT   sig_peptide     548435..548521
FT                   /locus_tag="Mmwyl1_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            550248..550877
FT                   /locus_tag="Mmwyl1_0483"
FT   CDS_pept        550248..550877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0483"
FT                   /product="Invasion associated locus B family protein"
FT                   /note="PFAM: Invasion associated locus B family protein;
FT                   KEGG: bja:bll1169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69420"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ1"
FT                   /protein_id="ABR69420.1"
FT                   /translation="MSMDIMTKVKESVTPFNLAMALCAATMAFATPIALAADSVKSATI
FT                   SNEPLETTATYGNWVLHCVQLPSSSNGKDDQEGGTNCEIVQSAQVQGQSRPVMQMAIGC
FT                   LPGQKDFTVTTVLPTNVSIPGRVHVVMNSEANEQEKKTDGFDLTLTRCLPSGCVAVTKL
FT                   DSKMRAQMSAGMTGQLQFISANGQEIGIPLSWMGFTQAMKALDKKG"
FT   sig_peptide     550248..550358
FT                   /locus_tag="Mmwyl1_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 37"
FT   gene            complement(550990..551976)
FT                   /locus_tag="Mmwyl1_0484"
FT   CDS_pept        complement(550990..551976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0484"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B1973
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69421"
FT                   /db_xref="GOA:A6VSJ2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ2"
FT                   /protein_id="ABR69421.1"
FT                   /translation="MYNSYHELKFYFLFIYILAMNNLRRIDLNLLVTLHALLVEKHVSR
FT                   AAQRLHKSQPAISHALANLRAIFNDPLLVRRTGKLELTSRANELLPTLTEALHQLGALI
FT                   EQPTFESTQAKRVFRLAMSDYGSRVVLPGLIQILRSRAPGIDLQVIQGSRTSMLTGVYD
FT                   GEIDMAFGVFNSPLSDELHTHTLFIEHFICAADKNTLPKTGSLEKTQWLSRPHILVAMQ
FT                   TNESNEIENALHREGVSRRIAMTLPHWGVASHMVANTDLILTAARRSFDLFLEDSPLQL
FT                   FTPPYPIDPFKFSMVWHSRRESDAGHNWLRHTIIEMLREDGNKQPDD"
FT   gene            552014..552550
FT                   /locus_tag="Mmwyl1_0485"
FT   CDS_pept        552014..552550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0485"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bur:Bcep18194_B1974 protein of unknown function DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69422"
FT                   /db_xref="GOA:A6VSJ3"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ3"
FT                   /protein_id="ABR69422.1"
FT                   /translation="MNSSFTLVMLAAVAVIAGALVPFQAGSNAELGRALGHPLWATLVS
FT                   LIVSILVVIPIVLAMQAPLPALGVIKHLPAWAWLGGVAGAIYISSALILVPRVGATSFI
FT                   VCVIAGQLITSLLLDYHGWMNLPERETSIGRMAGVTLVLVGMVTVQWFSPAVAPPHQNA
FT                   TQVATKNSGVVKSKG"
FT   sig_peptide     552014..552097
FT                   /locus_tag="Mmwyl1_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.396 at
FT                   residue 28"
FT   gene            552905..553777
FT                   /locus_tag="Mmwyl1_0486"
FT   CDS_pept        552905..553777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_3535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69423"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ4"
FT                   /protein_id="ABR69423.1"
FT                   /translation="MMKKTIIAATTAFAVSACSTGFYGTSDQASPVAGYALANNGTTLI
FT                   TMGSIASPAKMDTFTLSNKLDAVAYRPVTGELLGYTNGAVYAVNTKTGKLTDLGATFTN
FT                   GAMISKDASATAMDFNNAIDAVRMVGSDGTNLVYFPVGFGDQDKRANSVLKFTSTFYVK
FT                   GDSNEGTTPEIFANAYTNAIAGAKASSTFQFALDSKTDSLVSLANNSGELKTVAKITIN
FT                   GKVVDLSSMGGFDIVSAEEGSDAAYAILQLEGESKAGLYSIDLTTGAATLMADLPMGGF
FT                   SGFAVSGGK"
FT   sig_peptide     552905..552994
FT                   /locus_tag="Mmwyl1_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.641 at
FT                   residue 30"
FT   gene            553943..554701
FT                   /locus_tag="Mmwyl1_0487"
FT   CDS_pept        553943..554701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pub:SAR11_0691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69424"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR025975"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ5"
FT                   /protein_id="ABR69424.1"
FT                   /translation="MSRFSMALWLYFLVIPVQAQSVEQDMSHGDFGPFMRSLNNTGYGY
FT                   QVIQDITEGAPTKLIEKFEVRPGDCYWNKGWNDCKQDRERSELSEQKKTTPAGSDAWYG
FT                   WSMYFPDDYPNVFPTKVALGQFHQANSHPIWMFQNGRGGYHLDDHISGTKKNYELIKES
FT                   DLRGRWHKIEVYARWEKDDSGVFQVWVNGEQKVDYQGPTMDADIVYFKYGVYRSFLSRY
FT                   KQAKQLNAVPPQIVYYSNVKRGKNRASLQL"
FT   sig_peptide     553943..554008
FT                   /locus_tag="Mmwyl1_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.621 at
FT                   residue 22"
FT   gene            554724..555227
FT                   /locus_tag="Mmwyl1_0488"
FT   CDS_pept        554724..555227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0488"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sco:SCO3203 phosphinothricin acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69425"
FT                   /db_xref="GOA:A6VSJ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ6"
FT                   /protein_id="ABR69425.1"
FT                   /translation="MSVQIRPAVIEDLPALTDLYNHYIVNTATTFDIEPYTLEGRAVWF
FT                   SQFAPTGRYRLLVAEQDGEILGYACSGQFKPKRAYETSVEVSIYLKPNTKGRGLGTALY
FT                   LELFEQLETEDVHRAYAGITLPNEASRIIHEKFGFESVGVYLEVGRKFGQYWDVEWFEK
FT                   AISI"
FT   gene            complement(555439..556085)
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0489"
FT   gene            556459..557346
FT                   /locus_tag="Mmwyl1_0490"
FT   CDS_pept        556459..557346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0490"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sdn:Sden_0646 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69426"
FT                   /db_xref="GOA:A6VSJ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ7"
FT                   /protein_id="ABR69426.1"
FT                   /translation="MKNKYFLLLLIGLIWGSQFIFQKIALSTLTPQLVGVGRAVVGFIT
FT                   LFTICKILKVTSKGNTVWTIYMLIGVLEASIPFTFVPWGQQYVSSSIASVLIGTIPFFV
FT                   ILFTPLLSVGSKISRSSILSIVVGFLGLLSLFAPDIIEDDRSLSFLGVIAILTAAASFG
FT                   VALLLLSKCGNEHPLIVARNVLGSASLQVLFIYLFTDGQIPNHVNLDTVLSIIYLGVMC
FT                   AGVVYFLYMILISETGAVFTSLTNYLVPTFGVLIGVIFAHEDVGLNTWVALALILLAVA
FT                   LNQGKGIKVNQWVK"
FT   sig_peptide     556459..556527
FT                   /locus_tag="Mmwyl1_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.603 at
FT                   residue 23"
FT   gene            557506..557847
FT                   /locus_tag="Mmwyl1_0491"
FT   CDS_pept        557506..557847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acb:A1S_0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69427"
FT                   /db_xref="InterPro:IPR031409"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ8"
FT                   /protein_id="ABR69427.1"
FT                   /translation="MPRKYTFFVHMNATAAWLSLSREERNRYFTETIGDIFARYPDVSV
FT                   RLFDCEAFTTRCSDIAVYETENLQNYYFLIEALRDSQIFTVPYFEVVDIFPALENGFKE
FT                   YEASLVLKA"
FT   gene            558048..558806
FT                   /locus_tag="Mmwyl1_0492"
FT   CDS_pept        558048..558806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH01067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69428"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR025975"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSJ9"
FT                   /protein_id="ABR69428.1"
FT                   /translation="MSRFLISLGLYFFVIPVQAQSVAQDINHGDFGPFMRSLNNTSYGY
FT                   QVIQDITDSAPTKLIEKFEVRPGDCYWNKGWNDCKQDRERSELSEQKKTTPAGSEAWYG
FT                   WSMYFPDDYPNVFPTKVALGQFHQANSHPIWMFQNGRGGYHLDDHISGTKKNYELIKES
FT                   DLRGRWHKIEVYARWEKDDSGVFQVWVNGEQKVDYQGPTMDADIVYFKYGVYRSFLSRY
FT                   KQAKQLNAVPPQIVYYSNVKRGKNRASLQP"
FT   sig_peptide     558048..558107
FT                   /locus_tag="Mmwyl1_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.793 at
FT                   residue 20"
FT   gene            558829..559341
FT                   /locus_tag="Mmwyl1_0493"
FT   CDS_pept        558829..559341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0493"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sco:SCO3203 phosphinothricin acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69429"
FT                   /db_xref="GOA:A6VSK0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK0"
FT                   /protein_id="ABR69429.1"
FT                   /translation="MSVQIRPAVIEDLPALTDLYNHYIVNTATTFDIEPYTLEGRAVWF
FT                   SQFAPTGRYRLLVAEQDGEILGYACSGQFKPKRAYETSVEVSIYLKPNTKGRGLGTALY
FT                   LELFEQLETEDVHRAYAGITLPNEASHIIHEKFGFESVGVYLEVGRKFGQYWDVEWFEK
FT                   EIHRSCI"
FT   gene            complement(559358..560296)
FT                   /locus_tag="Mmwyl1_0494"
FT   CDS_pept        complement(559358..560296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0494"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: aav:Aave_2084 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69430"
FT                   /db_xref="GOA:A6VSK1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK1"
FT                   /protein_id="ABR69430.1"
FT                   /translation="MIGIDRVLRSNLRLRHLQLLVALDEFRHLGRTAEFLSVTQPAVSK
FT                   MLAEIEKTFDLQLFERSSRGTEPTPYGVTVIKFARSVLADYDRAKIEIAAVTEGSAGRV
FT                   QVGAMVAATPTLLTQAVNNLKKNATKTTVLIEEGDLRRLLPRLRSGELDLIVGRLEPGY
FT                   AAPDLDTEALYNESMCLICSPNHEILKGKIIDWPLLSQQAWIVPPSWAASRTKLNQIFY
FT                   KHNLHPPENIIESASFLNILMSLQTGSAIGFMAHQVAQHFEQQGLMSIIPIELEIDLPP
FT                   IGIITLDGREKTPTTLKLIEQLRMVNGCENT"
FT   gene            560441..561970
FT                   /locus_tag="Mmwyl1_0495"
FT   CDS_pept        560441..561970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0495"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG: pol:Bpro_3576
FT                   altronate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69431"
FT                   /db_xref="GOA:A6VSK2"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK2"
FT                   /protein_id="ABR69431.1"
FT                   /translation="MSSSSSPLIKLHSNDNVCIVRESVSIGQQVPEFNLRIRAQVSGGH
FT                   KIAARLIEAGEPIIKYDTRIGVALRRIEAGDHVHTHNLELVDYERDPSFCQDVVPVDYV
FT                   DVSARATFNGIVRSNGKVATRNYIGILSTVNCSSTVIRQIADHFTPERLSAFPNVDGIV
FT                   AFPHTSGCGMSSPSYHFDVLRRTLSGYARHPNLAGVLIVGLGCERNEMSSLIASQQLEE
FT                   NSHLQTLVMQAVGGTRATIAAGIAAIESMLPEANKVVREPVSVEHLKIGLQCGGSDGFS
FT                   AITANPALGMAMDILVRHGGTAILSETPEIHGVEYMLTRRAISQEVGQKLLDRLSWWDE
FT                   YTRGHNGQFNGVVGQGNQAGGLANIFEKSLGSAMKGGTTPLQAVYEYAEPIEQNGFVFM
FT                   DTPGYDPVSATGQIAGGANLICFTTGRGSMFGSKPAPTIKLASNSNMYNRLQEDMDINC
FT                   GLILDGKMSLEEMGQHIFEHIIKVASGESTSSERLGLGDNEFIPWHIGIVS"
FT   gene            562004..563464
FT                   /locus_tag="Mmwyl1_0496"
FT   CDS_pept        562004..563464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0496"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: reu:Reut_B4277 succinic
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69432"
FT                   /db_xref="GOA:A6VSK3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK3"
FT                   /protein_id="ABR69432.1"
FT                   /translation="MSQHTITNQNYIAGVWTTAQSEQTFEVLNPANQGVIAHVPDSDAS
FT                   DASAAVDAAHQAFLTWRLVPARKRAQYLKAWHALILANLDTLAGLISLEQGKPLAEAKG
FT                   EISYAASYVEWFAEQAPRIEGDLIESPVVGRKMMAIKEPVGVTAVITPWNFPAAMITRK
FT                   IAPALAAGCTVVAKPAEDTPLTSLALVKLAEVAGIPSGVINIVCSSRNNTPAMVNNWLQ
FT                   DSRVRKISFTGSTPVGKHLAQASAATLKKLSLELGGNAPFIVFEDADLDAAVSGLMAAK
FT                   FRNGGQTCVCPNRVYVQAKVYDEFAAKLVEKVRALKVGPASELDSEIGPMINERAVDKI
FT                   LSHIDDAVQKGARVLVGGNRVRISDGPNYIAPTVLGNVSKNAVLCQEETFGPVAPLFCF
FT                   DNEQEVIEQANDTPFGLAAYFYSENVSRIWRLASALETGIVGINEGAIAADSAPFGGVK
FT                   ESGYGREGSKYGLDDYLHIKYLCQGNLS"
FT   gene            563474..564280
FT                   /locus_tag="Mmwyl1_0497"
FT   CDS_pept        563474..564280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0497"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; PFAM: HpcH/HpaI aldolase; KEGG: rso:RSp1613
FT                   probable 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69433"
FT                   /db_xref="GOA:A6VSK4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR012689"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK4"
FT                   /protein_id="ABR69433.1"
FT                   /translation="MKIKKTNEFKQALSRGEQQVGFWLSMGSSYSAEMCASVGFQWLLI
FT                   DGEHAPNNLQSMLLQLQAIAPYSSHPVVRLADDNPTFIKQILDVGAQTLLIPMVQSAEQ
FT                   AEAIVKSTRYPPFGTRGVGAAAARASLWNGITDYVHNANRDICVLVQVESVTALENLES
FT                   ICAVEGVDGVFIGPADLAASMGHVGNPSHPEVKQAIEESIRKIIASGKSAGTLTSDSAQ
FT                   AKRYMELGVGFVAVGLDVSLMMQAIRKRAEEFEFGKSAVQSDQSVY"
FT   gene            564375..565331
FT                   /locus_tag="Mmwyl1_0498"
FT   CDS_pept        564375..565331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0498"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   ecv:APECO1_2627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69434"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK5"
FT                   /protein_id="ABR69434.1"
FT                   /translation="MKKHIKLLSLSLTLAGAVLAQSSYAAYPEKTITMLIPYGAGGGTD
FT                   VLARALQPALEESLGQTVIVKNVPGGGGILGFTQLVHAKPDGYTVTIPNNVIFATEGMG
FT                   NATYKYKDFDYLGNILTEDYIVAVRADGPWNSWNDLLKDMEEHPNKIKFGFSGYGGSTH
FT                   VASQILANVAGYQAKQIPHDGSSKAVVAAMGGHIDALMLNLGDLSSGIKSGKLKPLLSL
FT                   GSKRLSEYPDVPTLQETGIDLNLTNWRGIAAPAGVSDEVKVAWNKALEHAVKDEKFQQL
FT                   IATQGGQVDFQKSGENLDKWMSLLAESFINTAHNLKK"
FT   sig_peptide     564375..564452
FT                   /locus_tag="Mmwyl1_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.912 at
FT                   residue 26"
FT   gene            565392..565859
FT                   /locus_tag="Mmwyl1_0499"
FT   CDS_pept        565392..565859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69435"
FT                   /db_xref="GOA:A6VSK6"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK6"
FT                   /protein_id="ABR69435.1"
FT                   /translation="MFHLKEQHVFYLFLMAGAGFFLKLSWDIPSGIGVENDPGAAFLPI
FT                   VICVLILFLVSYLFVIEFREKSEKLFFSRAEFFALAGTLLLIFVYIFILSLIGFFASTI
FT                   IFLFLFQRLNSYLLNSGGFNYKSYLVSALFSFIATLSIYFVFSVLFKMSLP"
FT   gene            565876..567360
FT                   /locus_tag="Mmwyl1_0500"
FT   CDS_pept        565876..567360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0500"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: rsh:Rsph17029_3054 protein of unknown
FT                   function DUF112, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69436"
FT                   /db_xref="GOA:A6VSK7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK7"
FT                   /protein_id="ABR69436.1"
FT                   /translation="MFMQFVHSFDAFLEPTIFLAIAAGTVLGLIFGSLPGLTATMGIAL
FT                   LLPLTFSMPPISGMGMLFGMYCGAISGGSIPAALLNIPGTPSSVATTLDAYPMSKRGEP
FT                   GRALGLCVVASFIGGIISVLVFALLSPIIAKAALEFSAVEYFSLGIFGLTIIASVSGQS
FT                   IVKGLVAGLIGVLISLIGIDSLSGIVRLTADIPDLIGGVDFMPALIGLFALSQIIGDIV
FT                   SSRNAKGAEIKIKVDNAYPRFKETFGLWRVWSVSSVIGSLVGAVPGAGGSIASFLAYDV
FT                   AKRQSKTPEKFQTGHNEGIVACESANNGMTGGALIPMMTLGIPGDASAAVLMGGLLIHG
FT                   LQPGPLLFQDHADIAYGIIIAFLIANIFMFCFQAVGIKLFVKVLQIPRSFLMPFILVMC
FT                   IVGAYGISGSLTSAWILLFFGIFGYFLNRYGFSSAPVVLGMILGYMVESNFRRSMAMYD
FT                   SDWTIFFSHPISLGFILLSVVSILLPFYYRYKSAKK"
FT   gene            567505..568350
FT                   /locus_tag="Mmwyl1_0501"
FT   CDS_pept        567505..568350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0501"
FT                   /product="N-acetyltransferase"
FT                   /note="PFAM: N-acetyltransferase; KEGG: hch:HCH_05574
FT                   arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69437"
FT                   /db_xref="GOA:A6VSK8"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK8"
FT                   /protein_id="ABR69437.1"
FT                   /translation="MPLSSSLQNYLSDLGLVVPEQPNIKFVQALQAEHVARYSFNSLAV
FT                   VLGEDISLDLDAISQKIVTRSLGGYCFEHNKLTFELLKALGYDVQLKLARVLNNNFERE
FT                   AGRTHRVTLLTLEGVSYLVDTGFGGNGPIAPLRLDINTQQVAGLDRYRMLAKGKGEYDL
FT                   QVVKGDDYFTLYRFDNATYSDADCALGHFYSHKNSNAVFLKNLMVTLKKQDQTIALVNA
FT                   ELTIRDSQGEQKLLIESPESLGNILSSEFDINLEPSVVEHLFIRFVAPVLAENKVGITS
FT                   "
FT   gene            568347..569306
FT                   /locus_tag="Mmwyl1_0502"
FT   CDS_pept        568347..569306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0502"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: hch:HCH_05575 permease of the
FT                   drug/metabolite transporter (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69438"
FT                   /db_xref="GOA:A6VSK9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSK9"
FT                   /protein_id="ABR69438.1"
FT                   /translation="MSSFFTLLLWAWLMASSFIVSGHMVEYASPVATSAFRFLLAMLIM
FT                   LPALLFNWQRARLNKVEQFKALFASRQRLFHYVVISGALVGFFIGLFVALQSTTPLNTS
FT                   VLYTLVPLIGVMIARVWLKEVAPLWRVIGFVLGSIGAMTVLFSTQGFSVQDNDGFQWHS
FT                   GDYIFVGACFLLALHVVSVQKWGRSLGALSGAFMIMLFGTLWLLPIALIWGELDQVQWL
FT                   SQGFWINVLYLTVFTTLFTFVLQQRLVMTVGASRLLAISYTIPVWVALFTALTQSRLLS
FT                   LVDWPFASGIVFLGVALFLIDGNLSKVKLAHGSNSTSK"
FT   sig_peptide     568347..568415
FT                   /locus_tag="Mmwyl1_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.925 at
FT                   residue 23"
FT   gene            569281..569874
FT                   /locus_tag="Mmwyl1_0503"
FT   CDS_pept        569281..569874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0503"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: hch:HCH_05578
FT                   cAMP-binding protein - catabolite gene activator and
FT                   regulatory subunit of cAMP-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69439"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL0"
FT                   /protein_id="ABR69439.1"
FT                   /translation="MDRTQLQNSFEAYFNELGYDIDWQRLTVPMDVHVIRKGDYLFQQG
FT                   DFANRLYFLHSGLVRYVSVSDEGKEFTQTFAKSPRIIGSTKAMVTETRVLFGIQALEDS
FT                   MVSSYTWQAFYAQMRHDIGFLECYAKFLERIFIVKEERENAFVKHSAERRYLDFCAAYP
FT                   ELKDSIPQQQIASYIGITPVALSRIRQKLKLSRG"
FT   gene            570167..570934
FT                   /locus_tag="Mmwyl1_0504"
FT   CDS_pept        570167..570934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0504"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pol:Bpro_0129 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69440"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL1"
FT                   /protein_id="ABR69440.1"
FT                   /translation="MTLVNKTIVVTGVSSGIGADVARLARFHGARVIGVDRNEPSMTLD
FT                   GFVQIDLGNPTAIDAALAALPEKIDALCNIAGVPGTADAELVGRVNYLGLRHLSEALIP
FT                   RFNQGASIVNVASVLGIEWPDRLEKHKALAGTSYFEEGVTWLKKNPVPQETCYQYFKEA
FT                   LIVWSTQQAFTWFRDHGVRMNCVAPGPVFTPILGDFVSMLGEERVQKDAERMLRPAYSD
FT                   EVAEVIAFLCSDASCWVCGVNIPVDGGLASTYL"
FT   gene            complement(571029..572792)
FT                   /locus_tag="Mmwyl1_0505"
FT   CDS_pept        complement(571029..572792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0505"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; 4-vinyl reductase 4VR;
FT                   Activator of aromatic catabolism; SMART: AAA ATPase; KEGG:
FT                   psb:Psyr_2735 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69441"
FT                   /db_xref="GOA:A6VSL2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL2"
FT                   /protein_id="ABR69441.1"
FT                   /translation="MTNSHRISLADLAKSNQKILLKGSSRELDGQHAPTVEELTECLFF
FT                   SPGDGRIWLDDQRMLLIHSSSFGLLRREMIDSLGLDKSRDILTRTGYLSGLRDAELIQK
FT                   RWPDSDPASIFTAGTHLHGLEGVVKVETIHFEFDTEKGLYDGEFLWHHSSEDEEHIAAY
FT                   GIGSSPACWMELGYAIGYVSGLVGSLVIFREIECQSMGHSVCRVIGKSAELWDNIEDDI
FT                   RFLNVTSQNAELVTKPSPKLDLMEPELLDDQPKMIGVSAAFTAANHSLQKVAPTNATVL
FT                   FTGESGVGKELFASMLHKFSRQTGPFVAFNCAAIPENLIETELFGVEKGAYTGATSSRP
FT                   GRFERANGGTLFLDEIGTLSLAGQSKLLRVLQEKEVERVGGISAIKINVRVVAATNVDL
FT                   RKAIEKGEFREDLFFRLNVFPIHLPPLRERKADIPLLINHFYHHFCQLHQKAPSGMTQT
FT                   ARRALLNYGFPGNIRELQNLMERGVIASEEGEPIDLPHLFRNEFIPEEIIYSVNHQGTL
FT                   SHADSKKEATESLLEHITQFVGGKDHLDIEELEQSLLREAVENAQGNLSEAARRVGLSR
FT                   PQLAYRLKKNK"
FT   gene            573114..574574
FT                   /locus_tag="Mmwyl1_0506"
FT   CDS_pept        573114..574574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0506"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: rso:RS05194
FT                   putative benzaldehyde dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69442"
FT                   /db_xref="GOA:A6VSL3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL3"
FT                   /protein_id="ABR69442.1"
FT                   /translation="MTVSVLESKKWSGKFFTGDWVAASNKQDVMEPATGKVLSEVGIAT
FT                   ADEVYLACQRANEAQKEWLKVPPRDKATLFHKAAAFMQENFDELALYIARETGGIIPKG
FT                   QHEVKEAILILQLAANMTLEPNGLTLPSVPEKMSYATRKAIGVVGVISPFNFPMILSIR
FT                   SIAPALATGNAVVTKPDPQTPVTGGFILALALEAAGLPKGVFQVLPGAVEAGEALCAAP
FT                   EIGMVAFTGSTAAGRKVGEACGRNLKKVSLELGGKSSLIILEDADLDVAASNIAWGAYF
FT                   HQGQICMASGRILVQESIAEVLTAKIVEKAKHLPVGDPASGKVALGPLINQRQLEKVHA
FT                   IVQDTIAAGAKLEAGGTHEGPFYAPTVLSNVKPGMRSFDEEIFGPVVNIVTFKHDDEAV
FT                   TMANNTQYGLAGAVISNDLSRAQNIGAQLHVGLLHINDQTVNDECINPFGGCGASGNGS
FT                   AVCGPADWDLYTHWQWVTVKQAATPYPF"
FT   gene            complement(574667..575821)
FT                   /locus_tag="Mmwyl1_0507"
FT   CDS_pept        complement(574667..575821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0507"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: csa:Csal_0338 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69443"
FT                   /db_xref="GOA:A6VSL4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL4"
FT                   /protein_id="ABR69443.1"
FT                   /translation="MKKGTEKEASSSLNLSQSSVSRALSQAEQALQVDIFTRGWSGAEP
FT                   TSAGEVVISSCNSILQAISDTERQLQSNVTTLLKLKTYVEWRHLLIIEAVVKVGSASVA
FT                   AQTLGMTQPAVSKTLKEIENMVQQPLFLRARRGLIPQTAAKQLASLFLRISPVAQSLHH
FT                   SLQSLPNELTGRLSVGMLSFSCQDIVPIAFASIFKQHSGIRLQAMQGPYHMLANALRQG
FT                   EIDCFLGLMRKGPLHPELIELPLLKAQYALIARADHPIHNEAKTLNDLVNERWIVARHG
FT                   TPIRDYFESLFHSIDNKPPIQALEMLTFASSEELVIHSDAIALLFYDDWNINKLNPRLK
FT                   QISIPLPNPECTIGITLHRERQSTIIQTFIEELKLTVIDKLKTQ"
FT   gene            576092..576499
FT                   /locus_tag="Mmwyl1_0508"
FT   CDS_pept        576092..576499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0508"
FT                   /product="protocatechuate 45-dioxygenase alpha subunit"
FT                   /EC_number="1.13.11.8"
FT                   /note="TIGRFAM: protocatechuate 45-dioxygenase alpha
FT                   subunit; PFAM: Extradiol ring-cleavage dioxygenase LigAB
FT                   LigA subunit; KEGG: bra:BRADO2341 protocatechuate
FT                   4,5-dioxygenase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69444"
FT                   /db_xref="GOA:A6VSL5"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR014159"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL5"
FT                   /protein_id="ABR69444.1"
FT                   /translation="MNNNNKPYSDIPGTTVFDGDMARIGFHLNQFCMSLMQESNRTAFK
FT                   QNERAYLDKWPMTEAQKKAVIARDFSQLIALGGNIYYLVKISSSDGLSVAAAVSTMTNL
FT                   SVDEYIDMMRRGGRSPEGNRYVVSNTSEEKQ"
FT   gene            576499..577353
FT                   /locus_tag="Mmwyl1_0509"
FT   CDS_pept        576499..577353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0509"
FT                   /product="Protocatechuate 4,5-dioxygenase"
FT                   /EC_number="1.13.11.8"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: nar:Saro_2812 protocatechuate
FT                   4,5-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69445"
FT                   /db_xref="GOA:A6VSL6"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL6"
FT                   /protein_id="ABR69445.1"
FT                   /translation="MAKITCGLGTSHIPLLGHIIDKGDSGDEKWAPIFDGYQFTKKWIR
FT                   EQKPDVVVLVYNDHATAFDMKVIPTFAIGCGEEYHPADEGYGARPVPTVKGAPKLAWHI
FT                   TESLIKQGFDMTIVNEMDVDHGLTVPLSMVFGEVEEWPCQVIPLAVNTVVYPAPTGDRC
FT                   LALGKAIRAAVEQFPEDLNVQVWGTGGMSHQLLGERAGLINQEWDLAFLDDLKSDYEKL
FT                   GAISQVEYIRESGTEGSEMVMWLIMRGALNHEVNEIHRHYHVPVSNTALGHLIYENVDK
FT                   KGE"
FT   gene            577360..578073
FT                   /locus_tag="Mmwyl1_0510"
FT   CDS_pept        577360..578073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0510"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: xac:XAC0874
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69446"
FT                   /db_xref="GOA:A6VSL7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL7"
FT                   /protein_id="ABR69446.1"
FT                   /translation="MNVRITRPKLVCLAGLLCDQRMWQKVAAQLENDADIEIISFAGFD
FT                   DLTDMARSVLSSIEGDFALAGHSMGGRVALEIYRLAPQRVTRLALLNTGVHPKSDKEIP
FT                   GRMRLIEAAKTSGTSILVTQWLIPMMSPKGLNNANLMADLTKMVESYSVEDFEKQIHAL
FT                   INRPDAEVLLSQISVPTLLLSGSQDTWSPVAQHQAIQQHIIGSELVVIDDAGHMAPAED
FT                   PENVAAALHSWLKKK"
FT   gene            578080..578544
FT                   /locus_tag="Mmwyl1_0511"
FT   CDS_pept        578080..578544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0511"
FT                   /product="aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit; KEGG: nar:Saro_2408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69447"
FT                   /db_xref="GOA:A6VSL8"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL8"
FT                   /protein_id="ABR69447.1"
FT                   /translation="MSNQTIENMLIEWQCQKLVTRSINLLDQGRWQELANCYTEDGELY
FT                   RPSAPTVKIEGRDSILESFTSRPAKETCHALTNIEANIINEGLVVVTSRVVLFAANKKA
FT                   EGIESMVQANADIFIGRFIDEIKSVNGEWLIAKRQGSIELHYKGTSDKTG"
FT   gene            578728..579708
FT                   /locus_tag="Mmwyl1_0512"
FT   CDS_pept        578728..579708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0512"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: csa:Csal_0332 TRAP dicarboxylate transporter-DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69448"
FT                   /db_xref="GOA:A6VSL9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSL9"
FT                   /protein_id="ABR69448.1"
FT                   /translation="MKLNKFIIATSAAIALSTQVFAEELKFASFTPPFHTINASVIEKL
FT                   NADLSAATNGSLTVRGYHGGELGAGPAEQYVRVLQGAADMSWGLPGYTSSQFGKTMIAE
FT                   LPGAIPEDMPGYEALWRAYDKHLSSEFPGTKPLALWTSEPNIFIMRNKVIRTPADLAGL
FT                   KIRVAGATAAKVASALGATPVQMPASQIYNAMQTGLIDGVITGASTLKDFKLDEVADSL
FT                   TLGAPLGRLVFYTVLNRRVYDGLSASEKAAVDAASGAGLSKSAEDAWLKTATEALEVAR
FT                   ADSANTITNLTDDERAAFTKAVSGVVQSYVKSVNGAATLAAMEGK"
FT   sig_peptide     578728..578796
FT                   /locus_tag="Mmwyl1_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            579712..580233
FT                   /locus_tag="Mmwyl1_0513"
FT   CDS_pept        579712..580233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69449"
FT                   /db_xref="GOA:A6VSM0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM0"
FT                   /protein_id="ABR69449.1"
FT                   /translation="MLAIIRKLADGIISLSAALGALGLIFEVIIILADVIGRAMGSPLY
FT                   GSQDIVTMTMVILLFGAMALCDRQGGHIAVDLFERSYPAVLNRLIDIFSALLGTVIFVG
FT                   IAYAVNESAKISTMLNLSTNLLLIPKAWFQNGLSVFALITAAGMALRAVELTLSGRDIR
FT                   KVDTDKGDAA"
FT   gene            580230..581534
FT                   /locus_tag="Mmwyl1_0514"
FT   CDS_pept        580230..581534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0514"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: csa:Csal_0334 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69450"
FT                   /db_xref="GOA:A6VSM1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM1"
FT                   /protein_id="ABR69450.1"
FT                   /translation="MSASMIGFVGILIMFGLLVLRIPVAFAMFSVGFVGITILDSSRSA
FT                   LSLLASETFTLASSPELVVIPLFILMGNVASITGMSQKLYDAAYAIIGQLRGGLASATV
FT                   IGCGGFAALSGSSVASALTMGKVALGQMDRFKYNKRLSTGVVAAGGTLGILIPPSTGFV
FT                   IYAILTEQSIGRLFLAGVLPGIMLLLLFILVITVICWFRPEFGPAGPATSWSHKGKALL
FT                   GAGPIVAVILLTIGGIYGGLFSPVEAAAVGAGVVILVGFVTRSLSLKALWHASRDAVVT
FT                   TATVMLILIAAHLINPFMALSHIPTAVGELLSGLGLGVTGTLILILAIYLVLGCFLEGF
FT                   AMLVLTLPIFFPIIMSLGIDPIWFGVLTVLTLEMGLISPPVGINVFIVKSVAPNVELGD
FT                   IFRGVLPFWLMMILAVALLIIFPQIVLLLPNTMFG"
FT   gene            complement(581687..582352)
FT                   /locus_tag="Mmwyl1_0515"
FT   CDS_pept        complement(581687..582352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0515"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pst:PSPTO_4177
FT                   2-hydroxychromene-2-carboxylate isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69451"
FT                   /db_xref="GOA:A6VSM2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM2"
FT                   /protein_id="ABR69451.1"
FT                   /translation="MKDSLDIQFISDVMCPWCVVGLGNLNKALEQLSDKVDTQLSFQPF
FT                   ELNPKMPAEGQNLNEHITEKYGINKEQSDQNRVMIQARGKEVDFDFNFTPESRMRNSFD
FT                   AHRLLHWAQLEGKQAELKMALFKAHFTHNQDISDYQTLANLAASVNLDPAAAKGILENY
FT                   HFADEVRQQEQIWQQNGITSVPTVIINNAYAISGGQPAEVFKSAIEEVLKKQKAEQLV"
FT   gene            complement(582540..583304)
FT                   /locus_tag="Mmwyl1_0516"
FT   CDS_pept        complement(582540..583304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0516"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mlo:mll7191 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69452"
FT                   /db_xref="GOA:A6VSM3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM3"
FT                   /protein_id="ABR69452.1"
FT                   /translation="MPTLTNQYPSLKDKVVFITGGGSGIGEFLVHHFMKQGARVAYIDI
FT                   DDASSTTLNQKLADEFKVTPWFRKVDVRDIAALQSAIDDAAQELGHLDVLINNAGKDDR
FT                   HKIEDVTPEYWDNCLNINMRPHFFGMQAAAKWMKDGSSIINMGSISWMRGRAGMVGYTT
FT                   SKGAIHTMTRTMARELGPRGIRVNSIVPGAVVTERQKALWLTPELDQEFIDVQSLKFRI
FT                   EPDDIVAMALFLASQDSRACAGQNFIVDAGIV"
FT   gene            complement(583392..584852)
FT                   /locus_tag="Mmwyl1_0517"
FT   CDS_pept        complement(583392..584852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0517"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase; KEGG: bte:BTH_II2120
FT                   succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69453"
FT                   /db_xref="GOA:A6VSM4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM4"
FT                   /protein_id="ABR69453.1"
FT                   /translation="MLELKNKALLQTKCLINGEWVKSSEGSTLDVFNPANGELVATVAT
FT                   VGAAQTEQAIAAAEAAQKTWKKKTAKERAALLRRWHDLLMKNQEDLAQLMTAEQGKPLA
FT                   ESRGEIGYAASFIEWFAEEGKRIYGDMIPTYAPDRRILVMKEPVGVCAAITPWNFPAAM
FT                   ITRKAGPALAAGCTMVIKPASETPLSALAMGVLAIEAGIPAGVINIVVGKASVIAKTLT
FT                   NSPVVRKLTFTGSTPIGKLLMKDCADTMKKVSLELGGNAPFVVFDDANIDDAVAGAMMS
FT                   KYRNAGQTCVCANRIYVQAGVYDAFVEKFAAQVAAMKIGHGTESGVEQGPLINRAAVDK
FT                   VEEHVQDAISKGGKVVTGGKHHELGDNFYQPTVIANATQDMLFAKEETFGPLAPVFKFE
FT                   TEDDVISMANDTEYGLASYFYSRDIGRIFRVAEALESGLVGVNAGVIATEVAPFGGYKE
FT                   SGLGREGSKYGIDDYINTKYVCVAGLDK"
FT   gene            585094..586815
FT                   /locus_tag="Mmwyl1_0518"
FT   CDS_pept        585094..586815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0518"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: bra:BRADO6988 putative dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69454"
FT                   /db_xref="GOA:A6VSM5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM5"
FT                   /protein_id="ABR69454.1"
FT                   /translation="MAKRIEDLRSQRWFAPDNMRAFAHRQRTQQTGYKRSDFMNRPVIG
FT                   IINTWSDISTCHTHLRERAQFVKEGIIRAGGYPLEMPAMSLGEVMVKPTTMMYRNFLAM
FT                   ETEELLRSHPIDGAILMGGCDKTTPGLLMGAISMNIPAIYIPAGASLNGNFKGQKIGTG
FT                   THTRKFWDEKRAGNLSDEDWLELEAKMTRSVGTCNTMGTASSLTSMAEVLGFCLPGSAT
FT                   IPAADSAHQRLCSLAGERITKMVFEDLTPKSLATKEAFENAIVTYVALGGSTNGIIHLI
FT                   AMAGRAGIDLPMSLFDEWARKVPVIANLMPAGEYLMEDLFYAGGLPALLTRLKDFLHLD
FT                   QGNVNGRTLGENLDGVEIYNEDVIRPLNNPVNDRGTIGVITGNLCPDGAVCKPSAASPH
FT                   LLNHRGKALVFENHAQMTAQIDDPDLDVDENTVLVLKNAGPIGGPGMPEWGGLPIPKKL
FT                   LQKGVRDMVRISDARMSGTHYGTCILHVAPESYVGGPLAFVQTGDWIALDVEKRTLNLE
FT                   ISDEEMAARKAAWAPPPPKFARGYGAMFSTHVTQANQGCDFDFLQGDAVIDEPEIF"
FT   gene            586816..587583
FT                   /locus_tag="Mmwyl1_0519"
FT   CDS_pept        586816..587583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0519"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: mpt:Mpe_A0189
FT                   2-dehydro-3-deoxyglucarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69455"
FT                   /db_xref="GOA:A6VSM6"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM6"
FT                   /protein_id="ABR69455.1"
FT                   /translation="MSNTTNPFKQRLLDGQKLVGGWTLSGSPTVAEAMAFLNYDYLVVD
FT                   LEHSPASIHDTTPILRAVEQTPTAAVIRMPSHDPIAIKQVLDQGGMTLYFPFVESVEEA
FT                   KAIVQASMYPPLGKRGFAKMHRAARYTTREDYPTAANEQVCLIPQLETVEALELAVEIG
FT                   KVEGVSAVFIGPGDLSMTMGLPGQVNHPDVRAKIVACVTACNQAGIPVGTVMPTPDDAK
FT                   WALEVGFSFVSIANDLANMLGQCKAHLAQMKNS"
FT   gene            587594..588142
FT                   /locus_tag="Mmwyl1_0520"
FT   CDS_pept        587594..588142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0520"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: pat:Patl_2862 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69456"
FT                   /db_xref="GOA:A6VSM7"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM7"
FT                   /protein_id="ABR69456.1"
FT                   /translation="MLLLTRIITFLGQINSAFVFVFKYLAITAVAVMTASILVQVFCRY
FT                   VLNDSLPWSEELARYLMVWMTFLTLPVVSRAKQHAALDIILGALPRRLSLLLELVLYVL
FT                   IGIVLYYAFNKSLDFALKGTRMLATALPITKAWSYMAMPVGFGVMMLVYIELFLICTVR
FT                   LFNESSDDKFVLSDSESEA"
FT   gene            588146..589432
FT                   /locus_tag="Mmwyl1_0521"
FT   CDS_pept        588146..589432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0521"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: pat:Patl_2863
FT                   TRAP dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69457"
FT                   /db_xref="GOA:A6VSM8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM8"
FT                   /protein_id="ABR69457.1"
FT                   /translation="MGISFFWILLSVMFLGMPVAFALLFAPGLSLFLEGKEMFYLLLTQ
FT                   RLYNGIDSFPLMAIPFFMLAGEVMNRSGITLSLVQVSQAFIGHLRGGLAQINILSSMLF
FT                   AGLSGSAVADCSALGKMLIPAMEKNGYSRRFAAAVTAASSVIGPIIPPSGIMILYAFVM
FT                   NVSVGGLFAAGIVPGVLVGVSLMAMTWFLARRRGYKVASEKASWSERGTAVKQAFWPLL
FT                   TPVILLGGILSGVFTPTEAAAVAAAYALVVSLLSKTMTVSNLPSLFYATAKSSAVILFL
FT                   VGSAVAFSSVISLSGAPQKVAAIMVSLTENPLLLLLIINLLLLFVGMFLDAGPAILILG
FT                   PILGPIVTQFGIDPLHFAIVMCVNLTIGLTTPPMGLVLFVASSVSGERVETISREMLPY
FT                   LAVHIFVILLITYIPALTMTLPRLLGFAS"
FT   sig_peptide     588146..588214
FT                   /locus_tag="Mmwyl1_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.985 at
FT                   residue 23"
FT   gene            589493..590245
FT                   /locus_tag="Mmwyl1_0522"
FT   CDS_pept        589493..590245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0522"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   reu:Reut_B3771 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69458"
FT                   /db_xref="GOA:A6VSM9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSM9"
FT                   /protein_id="ABR69458.1"
FT                   /translation="MLIDSSSLLLLLFFALGSYIQATTGFAFGLIVVSSVSALGLAPIE
FT                   VTAFAVSVLSLINAGIGLYGGHWRKINRRAFWGFILPCLPAIYLGVWLLSYLGENALGW
FT                   LKFSLGLCIVVSSLVMMLQAHRVRKESSAGAFAVSGVIGGVMGGMFATFGPPITFMMYR
FT                   QPDDQAKIRATLLGIFCCTAALRVGSVSLTQGVDIDTWLLCALGFPVVVIATLVARKFP
FT                   VPISARAMRFVAFSLLLLSGVSLMWQGV"
FT   sig_peptide     589493..589561
FT                   /locus_tag="Mmwyl1_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.697 at
FT                   residue 23"
FT   gene            complement(590635..591189)
FT                   /locus_tag="Mmwyl1_0523"
FT   CDS_pept        complement(590635..591189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0523"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sma:SAV669
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69459"
FT                   /db_xref="GOA:A6VSN0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN0"
FT                   /protein_id="ABR69459.1"
FT                   /translation="MRSDAKENYQHILVTAHAVISEQGADASMRDISRKAGVGLATLFR
FT                   HFPTREALLEALLRSKLEELTRKADSFETIDSPNEALISWLREAVIFVRVYSGAVTMMA
FT                   AALSDPTSALHASCENLRSAGTRLLQRAQAKGSAEKYMTGSDLFALIGALGWLGDQDAF
FT                   APRSDYLLELIARGILSSQPE"
FT   gene            591289..592344
FT                   /locus_tag="Mmwyl1_0524"
FT   CDS_pept        591289..592344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0524"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bxe:Bxe_B0085
FT                   putative norsolorinic acid reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69460"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN1"
FT                   /protein_id="ABR69460.1"
FT                   /translation="MRYKVFGKHTGLRVSELVLGTANFGLAWGGHGATPDEARRIFDTY
FT                   ANAGGNFIDSANGYQDGQSEELVGDLLVGRRDQFVLSSKFAVKTDANSGILVTGNSRQA
FT                   MVASVEASLKRLKTDRIDLYWAHVDDGVTPLEEIVRGFDDLVRAGKILYAGLSNFPAWR
FT                   VARAATIAELRGSIPIAGIQVEHSLVQRATEQDLISASQALGLGVVAYSPMGGGVLTGK
FT                   YRNNNGENRRDEAWGGAGFQPENSPQRTAIIDTLIEVANEAEVSPGEIAIAWVAAKGSL
FT                   PIIGPRTLAHLDSNLAAAKVVLSPEQIARLDQVSAIPRGYPYTVLDEPRIKDLITGGMY
FT                   DRIDAPLDPVA"
FT   gene            complement(592533..593270)
FT                   /locus_tag="Mmwyl1_0525"
FT   CDS_pept        complement(592533..593270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0525"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   pat:Patl_2860 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69461"
FT                   /db_xref="GOA:A6VSN2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN2"
FT                   /protein_id="ABR69461.1"
FT                   /translation="MTDTTPQPSPIFKPLYKQVQELITERIIEGIWKPGEVLPSEFQLA
FT                   DLLGVSQGTVRKALNALTEDNVLFRRQGVGTFVSEHTLQKMMFHFFHFKSDSGDVPELP
FT                   YAQLLEMRLITPDDKLRTLFELPAKEKVIEIHRVRSIKNTASIRELIYLPHRYFTDLDK
FT                   EEKLPHSLYHYYQQHFNITVHKATDRLKAVLADEQDQSVLNIAAGQPLLEVTRTARALD
FT                   GRTVEYRISRANSEDLHYLVELN"
FT   gene            593491..594561
FT                   /locus_tag="Mmwyl1_0526"
FT   CDS_pept        593491..594561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0526"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: sit:TM1040_3357 TRAP dicarboxylate transporter-DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69462"
FT                   /db_xref="GOA:A6VSN3"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN3"
FT                   /protein_id="ABR69462.1"
FT                   /translation="MKKTDLLKKTTAAFVPTLMAASLSLAALPVLAADYEFNIVHLSNT
FT                   SDEDYDGAVVLKDYVEAQSNGRIQVNIYSGGQLCGNPTECIEALQANLIQVFNTTTGGL
FT                   ANVFPEIQAIDIPYIFPTDRVAECALNNEMLVGPLRKELLDRTGSMRLMTIGNTGGWRN
FT                   FATTNKQIKTPADVKGLKIRTINSPIQMQLVKAMGGSPTAVPWPEVYTSLATGLVEGTK
FT                   NGITDIMGMKFNEHIKYMTLDGHGYMASMWWMNNDSLKDMPEDLQHIMMDGFDALREVT
FT                   TVMPKRRQIEAYNEFKASGGTVYAPTADEKAQFQEAAKPVRDWFVNEYGAKWVETTENA
FT                   VKSCEASINESYMAQN"
FT   sig_peptide     593491..593589
FT                   /locus_tag="Mmwyl1_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 33"
FT   gene            594777..597659
FT                   /locus_tag="Mmwyl1_0527"
FT   CDS_pept        594777..597659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0527"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG: vpa:VPA1263
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69463"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN4"
FT                   /protein_id="ABR69463.1"
FT                   /translation="MTYRLIKLDSLMAMDFAYVEGRGLAHIDERELQPALPKGWDTATL
FT                   IDKIHSGEYALLADHPAQSLLVQERKKFGKSEWQINPDTKDTLPAGLLGAVTQRLSMMG
FT                   QGAGSSEANNRGNLHSAIEPDYTPEPVIRARDSSHESTEPVAEYNLEIAFSKDKPKHPV
FT                   ELSVTLYDTKNKMAKEDWQATPTRYGTRYTITTTNKKPHHLQIQAVHRAMGISLKNVAL
FT                   VPIGSGKIEDAFIPVMPQVQLGERLAFATAGYVYHFKGTELVQKYQWLDDGTLSPLPDN
FT                   KNSDAFHHASLYLFIYWKIAGQVVTDQHLLYRSESLTDDELNHLSSDWLDEQGVRLDPE
FT                   AILAASEAAELPRDVYQKAAPKSNLIYHTVADNPATQQRETWPDIASQYGLSAKALLEQ
FT                   NPSYNANPSALKVGDVLTITQNEAEAPVEFERFETPPEAPSTYNSAQNSHYVSDKKRFT
FT                   FAYGAPLMPLEQRKVKKGLPLVNVKPERILRIGVFFDGTAQNNRNDAYKEERGDKSRTN
FT                   IARLFEAYPQELGKSAAIYVSGVGTVDGAWQTPKMIDEGKDESRWSSATGLYDDNGAFQ
FT                   KWQTLLDQLQQIIVDLIDKKRYQSITHFSFDVFGFSRGAALAQHFVNALKMGLPDYTKH
FT                   RSGKDTSRITPNLLGTTEGDKYNPNTGYQADTQRSASVRFLGLFDTVGSFYLPGNKDNG
FT                   VFNLHVNSADVGHALQICAHHEYRINFPLTSLKTRGQLAPNFYEEVFPGAHTDVGGGYP
FT                   FVEQYHKADLPPHFGDPVNGTYNRELVKVEPLNYDHYQNHYRGAIADYPELEQRRLQKE
FT                   WEPECQAQYGQKGWVALEDNTFYFYRLQPIDASLAGLAQERMKQQAERFGVEWYEQEYR
FT                   LPHDYEDNSAQKLLWNKLATLPIGKIAPQNWLTDVSDNCIHRSHDSVINPGCSDPIDSL
FT                   VNGIANVTAFKRYQPNARLNTPTREIYDNE"
FT   gene            597646..598233
FT                   /locus_tag="Mmwyl1_0528"
FT   CDS_pept        597646..598233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69464"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN5"
FT                   /protein_id="ABR69464.1"
FT                   /translation="MTMNKLFLILTTLLMLTGCEEKTFYVASIGNAGSLGGQYGIRDMS
FT                   VSDVLGGGAGFGYGAVNGYPGKSADIGRMGVPNHIEGFWAKYEEDATTYFRISADINSE
FT                   LAEKKIRTLRNYYEHFERKKGTMQVLVEKERVRLFYTLYCSPNLNDCTPKPDADPNNWV
FT                   EKAPESVRNVVVLFDGKGEMSLTPFPDSPYEN"
FT   gene            598223..598816
FT                   /locus_tag="Mmwyl1_0529"
FT   CDS_pept        598223..598816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69465"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN6"
FT                   /protein_id="ABR69465.1"
FT                   /translation="MKIKLLLILATLLILTGCEEKPFYVASIGNAGSLDGPYVLGPIGV
FT                   ADVLGGGAGFGYGAVNGYPGASADIGRMGVPKHIEGYWAKQNPNARGYVAFYRISADID
FT                   SELAEKKIRTLRNYYEHFERTKGTMQVLVEKERVRLFYTLYCSPNLNDCTPKPDADPNN
FT                   WVEKAPESVRNVVVLFDGKGEMSLTPFPDSPYEN"
FT   sig_peptide     598223..598285
FT                   /locus_tag="Mmwyl1_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.410 at
FT                   residue 21"
FT   gene            598806..599396
FT                   /locus_tag="Mmwyl1_0530"
FT   CDS_pept        598806..599396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69466"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN7"
FT                   /protein_id="ABR69466.1"
FT                   /translation="MKIKLLLILATLLILTGCEEKPFYVASIGNAGSLDGPYSMGKISV
FT                   ADVLGGGGGFGYGAVNGYPGKSADIGHMGVPKHIEGYWAKKYPEGGFQYYYRISADIDS
FT                   ELAEKKIRALRNYYEHFERKKGTMQVLVEKERVRLFYTLYCSPNLNDCTPKPDADPNNW
FT                   VEKAPESVRNVVVLFDGKGEMSLTPFPDSPYEN"
FT   sig_peptide     598806..598868
FT                   /locus_tag="Mmwyl1_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.410 at
FT                   residue 21"
FT   gene            599386..599979
FT                   /locus_tag="Mmwyl1_0531"
FT   CDS_pept        599386..599979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69467"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN8"
FT                   /protein_id="ABR69467.1"
FT                   /translation="MKIKQLLILATLLMLTGCEEKPFYVARIGNAGSLDGPYIIKEVSV
FT                   ADVLGGGGGFGYGAVNGYPGASADIGRMGVPKHIEGYWAKQNPNARGYVAFYRISADIN
FT                   SELAEKKIRTLQNYYQNFKGSIGRMQVVVQEERIQVIYTQGCYAYRMDCNQKEGSDPNQ
FT                   WVVRSPSDSTDVVVLFDGKGEMSLTPFPDSPYEN"
FT   gene            599969..600553
FT                   /locus_tag="Mmwyl1_0532"
FT   CDS_pept        599969..600553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69468"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSN9"
FT                   /protein_id="ABR69468.1"
FT                   /translation="MKIKLLLILATLFILIGCEEKPFYVASIGNAGSLDGPYYLVSISV
FT                   SDVLGGGGGFGYGAVNGYPGKSADIGRMGVPKHIEGFWVKGWNKEEAYYRISADIDSEL
FT                   AEKKIRTLRNYYEHFERKDGSMQVLVEKERIQVLYSLFCPSNRFDCSAKEGADPNGWVV
FT                   DSPIKGLDVVILFDGKGEMSLTPFPDSPYEN"
FT   gene            600543..601136
FT                   /locus_tag="Mmwyl1_0533"
FT   CDS_pept        600543..601136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69469"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP0"
FT                   /protein_id="ABR69469.1"
FT                   /translation="MKIKLLLILITLLMLTGCEEKPFYVASIGNGGSLDGPYVLGPIGV
FT                   ADVLGGGGGFGYGAVNGYPGASADIGRMGVPKHIEGYWAKQNPNARGYVAFYRISADID
FT                   SELAEKKIRTLRNYYQYFKGKTGSMQVLVERERVRIFYTLYCPSHRADCSGKEGADPNG
FT                   WVIDSPIKGLDVVVLFDGKGEMSLTPFPDSPYEN"
FT   sig_peptide     600543..600605
FT                   /locus_tag="Mmwyl1_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.440 at
FT                   residue 21"
FT   gene            601126..601716
FT                   /locus_tag="Mmwyl1_0534"
FT   CDS_pept        601126..601716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69470"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP1"
FT                   /protein_id="ABR69470.1"
FT                   /translation="MKIKLLLILATLFILTGCEEKPFYVASIGNVGSLDGPYSMGEISV
FT                   ADVLGGGVGFGYGAVNGYPGASADIGRMGVPKNIEGYWAKKYPEGGFQYYYRISADTNS
FT                   ELAEKKIRTLQNYYQNFKGSIGRMQVVVQEERIQVIYTQGCYAYRMDCNQKEGSDPNQW
FT                   VVRSPSDSTDVVVLFDGKGVMSLTPFPDSPYEN"
FT   sig_peptide     601126..601188
FT                   /locus_tag="Mmwyl1_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.327 at
FT                   residue 21"
FT   gene            complement(601799..602689)
FT                   /locus_tag="Mmwyl1_0535"
FT   CDS_pept        complement(601799..602689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0535"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: dvl:Dvul_0075 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69471"
FT                   /db_xref="GOA:A6VSP2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP2"
FT                   /protein_id="ABR69471.1"
FT                   /translation="MRFRKLNYFITVAEELHFGRAAARLHIAQPPLSQQIKAIEDEIGA
FT                   VLFERSSQKVSLTPAGEALLPQARALLQDWEKIQEQVRSIANGTSGNLSLGFVWAAGTP
FT                   HFSKGIAQFKQDNHGVTLNLEEMTTTHALDALRTKKIDLAMIFLNPLMDITDLEHQDYE
FT                   TQKHLLALPENHPLAQKESVPLSDLHQLPFISFVRQAHPSLYDQIMHHLHAAGVEPNIV
FT                   QIARLTQTTRTLVAAGVGVALVPESTQFDRREGLTYRPIDGVLPELDIHFVWRKNGLTP
FT                   LMERLIAHLQEQVPR"
FT   gene            602798..604009
FT                   /locus_tag="Mmwyl1_0536"
FT   CDS_pept        602798..604009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0536"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: eli:ELI_03715 myo-inositol-2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69472"
FT                   /db_xref="GOA:A6VSP3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP3"
FT                   /protein_id="ABR69472.1"
FT                   /translation="MSREKIDGQLFSYTGPAFHYINEEERHFFAKEPAQFRVNLIGCGM
FT                   IGMEHMRVATRVGRSAIHGVFDLNERSVKVAKEEFAKITDEDFKVYDSLEAACNDPEVD
FT                   GILICTPNFTHLDVLKVAIKSGKHIFMEKPMATKLEDAYEITKMAKEYGAVLQIGLQYR
FT                   YKSIYSEAIHEVLERKAVGDVKMINIMEHRIPFLDKVNQWNKFSKYSGGTLVEKCCHYF
FT                   DLMNLFAQSRPVRVYANGSQSTNFRDFEFKGEKSDILDSAFVTVEYENGVRAGFNLCMF
FT                   APMFHEELLVCGDEGRVKAAEIEDFSENARLRTEMEVFCGQNRPSKTSQPSYPKLIEAS
FT                   GHNGATWFEHIAFADQMAGKKTNSATVEEGFWSVVVGCAAEESVKTGKIVEIADLLKSK
FT                   GIDF"
FT   gene            604234..605175
FT                   /locus_tag="Mmwyl1_0537"
FT   CDS_pept        604234..605175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0537"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: maq:Maqu_1182
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69473"
FT                   /db_xref="GOA:A6VSP4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP4"
FT                   /protein_id="ABR69473.1"
FT                   /translation="MLLETQSVIFQVAAPVLLMIAMGALLRRIQLINDDFILVSSRFVF
FT                   KVSMPAMFFFGMLGNSLNGLISVNLAAYFITSIVLTFLLSWLLAVKLDVPERQRGVFVQ
FT                   IAFRGNCGIFSVALVVNMFGQDGVALGGVMSGLSVLLFNILAEVILTRYSHGKLHLVPV
FT                   LKSLLKNPLILGIVLGVVANFIGLKLPAFVVKTGSLIGGLSLPLALICIGGSLVTSGFT
FT                   LPKHFPMAILSKVALSPILFTSLGYVLGFSQKELLFLFIFLAAPTAASAYVTAVAKGDD
FT                   GKSTANAIAATTLVSSVVIVVCIPVIIWVTGS"
FT   gene            complement(605258..606097)
FT                   /locus_tag="Mmwyl1_0538"
FT   CDS_pept        complement(605258..606097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0538"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: ppr:PBPRB0800
FT                   putative oxidoreductase iron/ascorbatefamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69474"
FT                   /db_xref="GOA:A6VSP5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP5"
FT                   /protein_id="ABR69474.1"
FT                   /translation="MQLQAIDYTSPTAAEDFVKSLRETGFGVLKNHPIQKDLVSAIYKE
FT                   WQTFFDSESKYDYRYNVGTQDGFFPPDVSETAKGHTKKDIKEYFHYYPWGQCPEDKKAL
FT                   LEQYYTEANTLASELLAWVEKHSPAEVALHYSQSLSSMVEDSDQTLLRVLHYPPLKGDE
FT                   ELGAIRAGAHEDINLLTILPSANEPGLQVKAKDGSWMDVPCDFGTLIVNIGDMLQEASG
FT                   GYFPSTSHRVINPEGADKTKSRISLPLFLHPKPEVVLSERHTAKTYLHERLVELGVI"
FT   gene            606647..607213
FT                   /locus_tag="Mmwyl1_0539"
FT   CDS_pept        606647..607213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0539"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   maq:Maqu_3764 protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69475"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VSP6"
FT                   /protein_id="ABR69475.1"
FT                   /translation="MNAFFDSFKNHFLISMPHLDDPHFEHTVIYLCEHTKAGAMGIIIN
FT                   RPSNVDFTELADHLGIQIHSPRLSSEPIYTGGPVEAERGFILHTTDKVWSNTLRVTDEV
FT                   SLSASLEALEDIAQGNGPDAFRITLGCAGWDAGQLEAEIANNDWLVCEADLDVLFHTPS
FT                   DMQFTAATRVLGIDMTRLSPDIGHG"
FT   gene            607213..607683
FT                   /locus_tag="Mmwyl1_0540"
FT   CDS_pept        607213..607683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0540"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: aha:AHA_3131
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69476"
FT                   /db_xref="GOA:A6VSP7"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP7"
FT                   /protein_id="ABR69476.1"
FT                   /translation="MTGSISTGTSLDDNQKPNTVRSVLGFDFGTTRIGVAIGQSITGTA
FT                   QPLDPLKAKEGIPNWDEITRIVEEWKPDAFVVGLPLDMDGSENEMCQRARKFAKRLHGR
FT                   FNLPYHMMDERLSSYEAKGQVIARGGNRNFKENSVDGLAAQMILETWFAESY"
FT   gene            607768..608265
FT                   /locus_tag="Mmwyl1_0541"
FT   CDS_pept        607768..608265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0541"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   pau:PA14_05270 transcriptional regulator PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69477"
FT                   /db_xref="GOA:A6VSP8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSP8"
FT                   /protein_id="ABR69477.1"
FT                   /translation="MKLDLEHSLASMKTQLAAYCEKNNIEDAIVVGIHTGGVWVAERLM
FT                   EAVPTTEPLATLDITFYRDDFTKAGLNPKVNQTLLPAIEDRHVILVDDVLMSGRTIRAA
FT                   MNEIFDFGRPASITLAILYDLGQHELPIAADIVGEHLTLNPDQRVKLVGPNPLSVSVID
FT                   TY"
FT   gene            608504..609508
FT                   /locus_tag="Mmwyl1_0542"
FT   CDS_pept        608504..609508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0542"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: pen:PSEEN5061 aspartate
FT                   carbamoyltransferase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69478"
FT                   /db_xref="GOA:A6VSP9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6VSP9"
FT                   /protein_id="ABR69478.1"
FT                   /translation="MMRSEPRALQLNEHGQLKHFLTLDGLDKTILTEILDRADSFLSMG
FT                   EQSVKKVPLLRGKTVVNLFFENSTRTRTTFELAAKRLSADVINLNIETSATSKGESLLD
FT                   TLKNLEAMQSDMFIVRHSDSGAAHFIAEHCTPNVAIINAGDGRHAHPTQAMLDMLTIRR
FT                   HKGSFDGLKIAIVGDILHSRVARSQLQALTTLGVSDVRLVGPKTLVPSFFEEMGATICH
FT                   DLEAGLKDVDVVVMLRLQKERMKGALLPSESEFYRLYGLTEETLAWAKPDAIVMHPGPI
FT                   NRGVEISSEVADGKHSVILNQVTNGIAVRMAVMSMAMSGQLQSDETPAAKDEK"
FT   gene            609510..610787
FT                   /locus_tag="Mmwyl1_0543"
FT   CDS_pept        609510..610787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0543"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; KEGG: psp:PSPPH_0472
FT                   dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69479"
FT                   /db_xref="GOA:A6VSQ0"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ0"
FT                   /protein_id="ABR69479.1"
FT                   /translation="MKLRIQNGRLIDPSQDIDAVTDLFVDNQKIVAIGEAPEGFEDAEV
FT                   VDASGQWILPGLVDLAVSLREPGLTQKGNIATEGRAAVSGGVTTLVCPPDTRPIVDTAA
FT                   VAALIQDKADDAGMANVFPLGALTQGLEGAQLSNMVALTDAGCIALSNHRHPMASTKVL
FT                   SRALEYAATHDLLVVFHPDESSLSEGGCAHEGLMSTMHGLAGIPEEAETIALMRDLLLV
FT                   EKTGVRAHFARLSCAKSVEMIADAKASGLDVTADVAVHNLLLNDQVLSRFNGHFHVLPP
FT                   LRSDEDRLTLIEGIKAGVISAICSDHQPHEKMAKIAPFAATEPGMANVEILLPLAMQLM
FT                   DEGDLDFSTVLTCLTSGPAACFGLEAGSLSVGSFADFILFDSTARWTWSYEGRKTKGHN
FT                   SPYFGGEFVGRVMSTYISGQRVYQAV"
FT   gene            611013..612011
FT                   /locus_tag="Mmwyl1_0544"
FT   CDS_pept        611013..612011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0544"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mfa:Mfla_1183 response regulator
FT                   receiver modulated diguanylate cyclase/phosphodiesterase
FT                   with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69480"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ1"
FT                   /protein_id="ABR69480.1"
FT                   /translation="MPQMLQVISKGSLLSTSLNRFKNKMQSQLPNAYCLFIVCDKECLQ
FT                   WRLQYTDSINDRLLNSNGQLSIVPQALITFAASPSCPKRHDIDIQSASGWQHWLPFLKD
FT                   HAFSDVSMVSVSDCQGSIYLMLVFQREEVRLEGELMALALDSYAAWLSAVFEREQADYL
FT                   LLEDSHRDPTTGLLRRYSFENSFGIVLKDSRRHFQRAALFSLRLLSSSKVNDADLKLLA
FT                   EVMSDTVRDNDLIAHYDERELVMGIRIQHLEDAEIVAAKLLKSLNSPKFSDNRLIREGL
FT                   SIGIAFYPEHSSLESLHQAALFAADSLKNISGYRLEFHGECYGSSADFYSL"
FT   gene            612190..612918
FT                   /locus_tag="Mmwyl1_0545"
FT   CDS_pept        612190..612918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0545"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   eca:ECA3627 putative alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69481"
FT                   /db_xref="GOA:A6VSQ2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ2"
FT                   /protein_id="ABR69481.1"
FT                   /translation="MAIKVESNEALEIKTNLTRVTQQVDQLVQQYQRETGSVRLLAVSK
FT                   TKPLSALEAAYAAGQRAFGENYVQEAVDKFHALAHLVDIEWHFIGPIQSNKSRLIAETM
FT                   HWVHSIDREKIARRLSEQRPKDLPPLNVCIQVNISGEESKAGVALSELNDMVALITELP
FT                   NLRLRGLMAIPAPQKSHEAQCLVYEPLRQAFVELSKSDSMIDTLSIGMSGDLPAAIQSG
FT                   STMVRVGTAIFGERDYSAKA"
FT   gene            613015..613842
FT                   /locus_tag="Mmwyl1_0546"
FT   CDS_pept        613015..613842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0546"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   hha:Hhal_0946 pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69482"
FT                   /db_xref="GOA:A6VSQ3"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ3"
FT                   /protein_id="ABR69482.1"
FT                   /translation="MTPSIAFIGVGNMAKSIFSGMLANGYPAEKIIGTSRTQEKREYYR
FT                   EQYGISMLADNDSAVSQADVVVLCVKPAQMQAVVEGFSSHVRADQLFISVAAGIELDSL
FT                   AHWLGKPVAVVRSMPNTPSQLGAGMTGLIANEHTNSEQKNWVSELFSSIGNSVWVENEV
FT                   HMHTVTSLSGSAPAYFFRFIEAMVKNAKEQGLDEATSRELASNAMFGAARMVMELDEPI
FT                   AQLRKNITSPKGTTEQALLSFEAADIDKIVADAMMACVNRSKEMAADFAAKKD"
FT   gene            613859..614401
FT                   /locus_tag="Mmwyl1_0547"
FT   CDS_pept        613859..614401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0547"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   psa:PST_3968 YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69483"
FT                   /db_xref="GOA:A6VSQ4"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ4"
FT                   /protein_id="ABR69483.1"
FT                   /translation="MYSDPFVMLVKVICNLYLFIVLLRLVLQLTRADFYNPISQGIVKA
FT                   TSPIVLPLRKVIPAIGRLDTASLVLALAVQLLTVFFIVMIKGVAISPISYAIYTFAGTL
FT                   YHLLDLYFWAMLISVILSWVAPGANHPGAMLVGQITAPLYRACQRVIPTLGGLDLSPIF
FT                   IFLAISFLKQVLAPYSI"
FT   gene            614560..615054
FT                   /locus_tag="Mmwyl1_0548"
FT   CDS_pept        614560..615054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0548"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: pau:PA14_04760
FT                   phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69484"
FT                   /db_xref="GOA:A6VSQ5"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ5"
FT                   /protein_id="ABR69484.1"
FT                   /translation="MKAMSTIAVYPGTFDPITNGHTDLVERASKLFEKVIVAVAASPKK
FT                   RPALSHELRISLAKEVLGHLTNVEVVGFDNLLTEFTRSVSGKVVIRGLRAVSDFEYEFQ
FT                   LANMNRAIAPDVESIFLTPSEKHSYISSTLVREIASLNGDFGQFVNPEVKRVLQEHYQT
FT                   I"
FT   gene            615122..615373
FT                   /locus_tag="Mmwyl1_0549"
FT   CDS_pept        615122..615373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0549"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: hch:HCH_01009 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69485"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ6"
FT                   /protein_id="ABR69485.1"
FT                   /translation="MSLIITDECINCDVCEPECPNEAISQGDEIYIIDPSKCTECVGHF
FT                   DEPQCQQVCPVDCIPLDPNRKETEEQLMEKYLTLTGQL"
FT   gene            615504..617129
FT                   /locus_tag="Mmwyl1_0550"
FT   CDS_pept        615504..617129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0550"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: transporter-associated region; sodium/hydrogen
FT                   exchanger; KEGG: psp:PSPPH_0493 sodium/hydrogen exchanger
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69486"
FT                   /db_xref="GOA:A6VSQ7"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ7"
FT                   /protein_id="ABR69486.1"
FT                   /translation="MGMLAGEEGLGRLDFDNPSLAFFVGNLALAVILLDGGMQTKTSTF
FT                   RVALWPSLSLATLGVVITTASVGAFAAWLLDVKLIYGLLLGAIVGSTDAAAVFSLLRNS
FT                   GVKLNERVGGTLEIESGANDPMAILLVVMLTGLLQSTDQLSVLAFLGQMIQQFAIGGVL
FT                   GLLGGKLLLMILRRVPLIEGLYALLIISFGLAVFSGVNMIGGSGFLAVYLVGLSVGNGR
FT                   IKQQEAISQVMDGLAWLAQAGMFLLLGLLVTPSSLLTHGWQAVAIASFLIFVARPVAVM
FT                   ICLLPFDFRWPERLYISWVGLRGAVPIVLALYPVIAGLSNSELLFEITFTVVLISLLLQ
FT                   GSTVPQVARWLKIVVPPAPAPTTSFSLINDADSNHSLELYEFLVQTEGVRIPTSIVQNV
FT                   PSATVSTPQLVSLVRDQKPIVVNADTELKSGDRIWMLLHPGDVNDVAQIFSHKASASFL
FT                   LQNFFGEFAIRGDASLIDLAKVYGVPVDGIDEADTAAALLQRQLGKHLVVGDRVRFGNI
FT                   RLTIRQMDGNQIEIIGLKLQDKQV"
FT   gene            complement(617195..618298)
FT                   /locus_tag="Mmwyl1_0551"
FT   CDS_pept        complement(617195..618298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0551"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; KEGG:
FT                   maq:Maqu_0775 ion transport 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69487"
FT                   /db_xref="GOA:A6VSQ8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ8"
FT                   /protein_id="ABR69487.1"
FT                   /translation="MNSLSLLLKKKNSRRQFRKKVHLHESGDLKKRLILLAGVIALHSL
FT                   AMVFFEDLNWWQAFWLTMTSASTTGYGDISAATFWGQFSTIVLIYGMGITLLAQIASDY
FT                   VEIRLTRKEMRIKGRMRWDDMQNHILIINTPKYDAERYLGLLISQISQTPELIDVPIQI
FT                   LTKAFPEGLPLDLRSQGVVHHTGDALADGMLESAGTHKAKYIIVLCQDAQDSHSDSLTF
FT                   DALHRVQALNTSAFVMAEAINDSNRPRFKAAGANAVIRPVRAYPEMLVRSLIAPGTEQV
FT                   LEDLFRHQGDHTIRLDVEITGVTWAKIVTTLIQKDVGTALGYVNKDGDIITHPQTYSLI
FT                   DAQGLIVLINDDQEIPSLAEIGLFFNE"
FT   sig_peptide     complement(618158..618298)
FT                   /locus_tag="Mmwyl1_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.765 at
FT                   residue 47"
FT   gene            complement(618313..618786)
FT                   /locus_tag="Mmwyl1_0552"
FT   CDS_pept        complement(618313..618786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0552"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   asa:ASA_4202 RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69488"
FT                   /db_xref="GOA:A6VSQ9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSQ9"
FT                   /protein_id="ABR69488.1"
FT                   /translation="MLHIVLYQPEIPPNTGNVIRLCANTGYHLHLIEPLGFELEDKKLR
FT                   RAGLDYHEFTRLKRYPDFQAFVNQNEIGTIYALTTKGSHTHSEASFAENDVLVFGPETR
FT                   GLPAEFIEALPPAQRLRLPMQANSRSLNLSNTVAVMVYESWRQLGYAMPADSK"
FT   gene            618906..618981
FT                   /locus_tag="Mmwyl1_R0001"
FT                   /note="tRNA-Phe1"
FT   tRNA            618906..618981
FT                   /locus_tag="Mmwyl1_R0001"
FT                   /product="tRNA-Phe"
FT   gene            619081..619156
FT                   /locus_tag="Mmwyl1_R0002"
FT                   /note="tRNA-Phe2"
FT   tRNA            619081..619156
FT                   /locus_tag="Mmwyl1_R0002"
FT                   /product="tRNA-Phe"
FT   gene            complement(619226..619504)
FT                   /locus_tag="Mmwyl1_0553"
FT   CDS_pept        complement(619226..619504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69489"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR0"
FT                   /protein_id="ABR69489.1"
FT                   /translation="MTNSDNSPSDTNTLDFDLSPSARSTITKQMHCMSYGLDALDGLSL
FT                   ILADSIDNDTGTTGDQVTGLLKCIEYSLLNSQRKIIKALQEDKGGVH"
FT   gene            619803..620771
FT                   /locus_tag="Mmwyl1_0554"
FT   CDS_pept        619803..620771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_0935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69490"
FT                   /db_xref="GOA:A6VSR1"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR1"
FT                   /protein_id="ABR69490.1"
FT                   /translation="MIIVTSNIDGIYATMDKQEEIKQPKEAVEKQGFNLWEWVKAISTL
FT                   VIVGVFSFKVYQTPIALTVDFPTLLSLLLGFFSVGLAAMFYFKATDSSNAFYDNTNKFT
FT                   KDISQLLAKIEAGFGERLKNIEDNGTSVSERIFQLAQKKQVLEDEIEEEESEVERVKAE
FT                   KDKIIDDLIQKADMTDEERSTFKKELQEREEALAFMAEKLSGYEKQIKHVKGVLEKNNQ
FT                   RAHGVGDVALGAGWRSLAHRGDLSGHYFSSKSHAQKIIREYCAGCANIETFKDGLIQGN
FT                   TPPDVMDALLSLNYVDAFGDITELGVLSIQSYIDLGKMNKK"
FT   gene            complement(620809..621924)
FT                   /locus_tag="Mmwyl1_0555"
FT   CDS_pept        complement(620809..621924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgl:SG1173 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69491"
FT                   /db_xref="GOA:A6VSR2"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR2"
FT                   /protein_id="ABR69491.1"
FT                   /translation="MPKKNNKWPKYVREVNGRIVWRPRITAEDRTVVDVDSHGFLKPPV
FT                   RLGSTKDSEARILAAYLAAKASLTARTGADKHTLKWIVGQYLNSSQFRALASTTHHRTK
FT                   SLVKVLEHPIAANGKDITFGDLPILSITKPMVRRLADKRLANMIDDGLKGTSTINQEIS
FT                   LLHSATRWAIEHIDNLGITDSPFKVKKFKVDENERYVTDEEYDIQYKIAAELSEYLPFF
FT                   FELTYLIASRGIETLDLRTSHIDPDPINGGIYVARRKGSKNNFIEWSDRLYKAYQAAVS
FT                   MLEKHKANGRDVPLIISSTGHKLSMSGLRTAMHRLKEKMEERELTNIFWSLHLLKSKGV
FT                   SDAESDHIAGHKTERMRNKYKTKIERHKAAR"
FT   gene            complement(622397..622588)
FT                   /locus_tag="Mmwyl1_0556"
FT   CDS_pept        complement(622397..622588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69492"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR3"
FT                   /protein_id="ABR69492.1"
FT                   /translation="MSQYQTLVIKYEGDKPPFDTFAETKSLKIVEIANYNVFEERDQLE
FT                   VKIELLEQEVKDYEYENG"
FT   gene            complement(622605..625316)
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0557"
FT   gene            complement(625320..625700)
FT                   /locus_tag="Mmwyl1_0558"
FT   CDS_pept        complement(625320..625700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0558"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: sth:STH26
FT                   two-component response regulator variant"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69493"
FT                   /db_xref="GOA:A6VSR4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR4"
FT                   /protein_id="ABR69493.1"
FT                   /translation="MKKIHASIIEKGPLTDKEAAVLRYLCEGYLQKQIALKLFRSHSTV
FT                   GKHLESISRKLDCHCAAEIVSTSVAMGIVKVEIRESVSTPIKALLFLLIFHMMIPQAGN
FT                   RRPPRPIRTVRASQIMRINRES"
FT   gene            626033..626482
FT                   /locus_tag="Mmwyl1_0559"
FT   CDS_pept        626033..626482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69494"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR5"
FT                   /protein_id="ABR69494.1"
FT                   /translation="MTNENLTPKKWIGKKKEGEIYRFQLFLAEKNINPEQIQIDTGVTA
FT                   RTVTNSIYEGKPLGAKLLREIHAKYGVSIDWLVSGKGRMFVDTPLSHLEISESRTDYKN
FT                   DDPRYNRIVGLVQEFMANANEDEAAWLETQMKFNISQFKQFLNDQ"
FT   gene            complement(626457..626564)
FT                   /locus_tag="Mmwyl1_0560"
FT   CDS_pept        complement(626457..626564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69495"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR6"
FT                   /protein_id="ABR69495.1"
FT                   /translation="MSQMSRFSLYASEKWQGESTFKTVLLRLIDHSKIA"
FT   gene            complement(627619..628347)
FT                   /locus_tag="Mmwyl1_0561"
FT   CDS_pept        complement(627619..628347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0561"
FT                   /product="KilA domain protein"
FT                   /note="PFAM: KilA domain protein; KEGG: ecv:APECO1_2037
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69496"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR7"
FT                   /protein_id="ABR69496.1"
FT                   /translation="MSQQQFLPIVEGVAITTDKEGRFNLNALHKASGLRESKEPNKWLA
FT                   LKSTNELITELEATARSCGSSINKQKGGANPGTFAHELLAISYAGWISPKFQLLVNQVF
FT                   LDYKTGKLTHKDDVFDVLIKVDRIKDPTLKRLAKERANELYDLNIPLMPENAYSAELLA
FT                   FWDVYHEIGDAVLNHSRQPDTIAINLAHLREEAALRDIELPVYNQLARILRSDKQLYRN
FT                   TAVNSVLWNKSVRCWIFKRD"
FT   gene            complement(628414..628641)
FT                   /locus_tag="Mmwyl1_0562"
FT   CDS_pept        complement(628414..628641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69497"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR8"
FT                   /protein_id="ABR69497.1"
FT                   /translation="MANNTKLSPELSHSLHRQMHRMSIGLDALDGLGELLANTTDDEIP
FT                   ITNQQASSLLKCIEFSLLTTQRETIALIND"
FT   gene            complement(628961..630121)
FT                   /locus_tag="Mmwyl1_0563"
FT   CDS_pept        complement(628961..630121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0563"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: tel:tll0709
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69498"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSR9"
FT                   /protein_id="ABR69498.1"
FT                   /translation="MRRPTQEAPFVKRRREQFNALKPQEEIKKGRMHRVVDWIDNWHVT
FT                   RLCQAIGSFLLILTIAGFYFDYEDHKQSRIVNAWQLITTKAPGNSGKIAALEYLNHRGQ
FT                   PLTGIDLSTNKKNGEIGVYLREAHLPLTDLNLAKLNNVDLSRANLKSSILTNADLTDAV
FT                   LLWADLTHANLTRANLTSAVLRFANLTGANLQGTNLTSADLTGADLTGAVLWWADLTHV
FT                   NLSRANLTNTQLQEANLIGSTLWLTKLSGTNLSGANLTGASLRRAHLKNTLLHRANLSS
FT                   ANLSSANLSGTNLSGANLSGANLSGANLSSANLSGANLLEANLTKANLDNANLLGGPPY
FT                   TTLREAGLTEVKNLTCEQLTQAINWKRSYRDKELACGADIPIKSLK"
FT   gene            complement(630192..631286)
FT                   /locus_tag="Mmwyl1_0564"
FT   CDS_pept        complement(630192..631286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_00373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69499"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS0"
FT                   /protein_id="ABR69499.1"
FT                   /translation="MDIVKTIKRIVNNLFPEISAGYHLPIFAEVVGVRETTKEGDLCDE
FT                   FRPRYAVDVQILNEYGEPDTKWPVLKDVILSVPVAGHEMGHFAYPDNGTWVEIAFAYGS
FT                   PNRPFIRSVLPHRLTMPGIERGEQKWQHSATSYQRIDKDGNQERVTDLEIHDKSLTRVI
FT                   EALDVIEKFHQSTKNTKANDTEIIGAIKRIEAFGAVVVQSGGVMDLSAVDHVRITTKAN
FT                   AIIKALANIKTDAADNIEHKAGSNITSNAGKNIQSTAGGNISNTASGDITETATGAMAI
FT                   SGQTAEVTGQTSVAIKAPSVWVGTPALNLVTLAGETAQLVADLAEIIASHTHPNVGPMS
FT                   QGGAITAVKTKVEKVKANIDTVAG"
FT   gene            complement(631277..631969)
FT                   /locus_tag="Mmwyl1_0565"
FT   CDS_pept        complement(631277..631969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_00374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69500"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS1"
FT                   /protein_id="ABR69500.1"
FT                   /translation="MRLNRVLTINNIKRDLVDERIALDLSAPGRAEFTIVGDDNAISQN
FT                   QLVTFDLGYSSQDALQRWFIGITEQIVHTGDKRVKIFCRELSSVLAHTLPLSLRHASLR
FT                   EILKAINDITGVNFSTPDKDYATRKVANFYNLGTGYQAMAALEKVFNIPDFIWQQQSGV
FT                   IYVGSWADSRWASVKNMLLPENLFIEHSAQNSAKVAAFPSCRPGIRINGKRINIIEFSG
FT                   NHMVLKWT"
FT   gene            complement(631972..632511)
FT                   /locus_tag="Mmwyl1_0566"
FT   CDS_pept        complement(631972..632511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69501"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS2"
FT                   /protein_id="ABR69501.1"
FT                   /translation="MLALNGQKIKGSELKISATLSLSGEDLSGSSSMSAQAETGDKPQS
FT                   LSINMEIKYSNAKDLTNLLNLAKAKTERGERVTYDVINHTAEAMSIRQVRFQGDISVRE
FT                   DASFELWKISFRLIEQRSVAELTESRQEAVPVTDQAPAGETVSDDTAPTAEDLSSMEKI
FT                   MKWADTKIAGTSGEAQ"
FT   gene            complement(632511..633185)
FT                   /locus_tag="Mmwyl1_0567"
FT   CDS_pept        complement(632511..633185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69502"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS3"
FT                   /protein_id="ABR69502.1"
FT                   /translation="MSWSPLSLSTPASSTSALSESITVFTVSPWTHGVKEGNGNHTLLS
FT                   FPNAVDAVVTKVDSSKAVFAIAITASNMTNFAQQAAALNAVFPFKEFEKWHRHAQALIT
FT                   LESDKFDLVDAVERPQAIAINAIPSISEQSKYAISTAALNEANALAGSDPLANLTTFQS
FT                   KRPSSPSAPVLSGGAGFRFYADSDIKNALRVNQRSHAYTITAMVVFMGSPAELSYLREL
FT                   MP"
FT   sig_peptide     complement(633126..633185)
FT                   /locus_tag="Mmwyl1_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.977 at
FT                   residue 20"
FT   gene            complement(633188..633457)
FT                   /locus_tag="Mmwyl1_0568"
FT   CDS_pept        complement(633188..633457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69503"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS4"
FT                   /protein_id="ABR69503.1"
FT                   /translation="MNDVQLSVAYAGSTFIGFSESELLKAGVPQDEINSVKKGAILSQR
FT                   EAAYKAESDPLYMEWQYDKTEEAEEKWRDKVAEIKVRFPLVTVD"
FT   gene            complement(633468..634298)
FT                   /locus_tag="Mmwyl1_0569"
FT   CDS_pept        complement(633468..634298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69504"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS5"
FT                   /protein_id="ABR69504.1"
FT                   /translation="MSTSAELTAQIGAAVEELNNAKNRFEAIRADTDQKVRDLTGEVSA
FT                   VINSFLNLNIYVSVGGSDSNTGSVSSPLATIAKAISIIPEGAVARIYLISAAEGSANNV
FT                   YDVVNNHDLGSRHVLIAPRGGSNVTLRFMNGGLFNTRSGGSIKIGNPNTLTIEVHASRQ
FT                   HDSLVNQYGGDVSFGGFYGTPLVNNSPHLKTLCKVNFHVGDNAFGSTFGRCSFMRFDLS
FT                   QSTETDFVLCDVVLGGMIFISLYSVTLAGDMAIYNPARRALSIDNANTGLILTY"
FT   gene            complement(634295..634867)
FT                   /locus_tag="Mmwyl1_0570"
FT   CDS_pept        complement(634295..634867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4006 tail fiber protein H, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69505"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS6"
FT                   /protein_id="ABR69505.1"
FT                   /translation="MADNISGTVTNAGARYIAQRSAILQPVKMSHFVLANIPGVDENSV
FT                   ANANAGLPASAHIVGGNVPIDGKPRYNNDNAVTYSLLLDHDAGNYDFNYYGIVTDTGVL
FT                   FAFQYIPTVKKRKAIGQVINRNLVTPFSNAKYLTGASLPIESWQFNYEDDMYELQLSTV
FT                   KNAVAQMSLLNTAMSQHERLLKLEGKL"
FT   gene            complement(634867..635589)
FT                   /locus_tag="Mmwyl1_0571"
FT   CDS_pept        complement(634867..635589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0571"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69506"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS7"
FT                   /protein_id="ABR69506.1"
FT                   /translation="MTARFNLPVWLKNGPEVTKLADAFGEYWDKVEGWIKTPLSQLDAE
FT                   TCHITVLKLMAYQRDVNRFAGEPDDLFRKRVAFAVQNAQSAGSPKGFKEIFERFDLPLL
FT                   GQIERDPEKDWDVITLWLGDSTITKNPELGQYLVRQYGRTCRRYHFLLVDFMPDLHVQG
FT                   NAASVDRQANNAIKVPDWVFKDMTDTTHFTASSGSVERVQSVPMAVAPYAFHDRSGDHS
FT                   LGFYSASVERYTDTIRGF"
FT   gene            complement(635586..636740)
FT                   /locus_tag="Mmwyl1_0572"
FT   CDS_pept        complement(635586..636740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0572"
FT                   /product="uncharacterized phage Mu protein GP47-like
FT                   protein"
FT                   /note="KEGG: hch:HCH_06780 uncharacterized phage Mu protein
FT                   GP47-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69507"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS8"
FT                   /protein_id="ABR69507.1"
FT                   /translation="MSNFEKVLKDSGVPISEAAIEAEFKQVVTDSGSRIANDSAYSPFW
FT                   RIVRQLVIKPTLWLIQELLIKRVMPQFFLKTVGEGWIDLWGDSYGVTRKGSQVLQGRVL
FT                   FSRSDVSADLEIAVGTSVYTDEINGSVYRLFTSETVTLKAGEDAKLVAVTAENAGAAYN
FT                   LESGYYRHCDVELTVINPQEWIDVLGADAEKIEAYRLRIRNAFNTLSHFHTDGVYRALI
FT                   SEFGGIDADKIWFKHNAPRGPGTANAYVLFELDTPSASFLETINRRISAEGHHGHGDDL
FT                   RVFPMPETHHSLTVIVHLPDSLMDVEREETLSGVRLSIEAAFRSNSAFIMTRVSPWSRF
FT                   SFTRLASEIYANFPDIVSINFDQNDIVSEMSVPRLSSLIVTEGA"
FT   gene            complement(636737..637060)
FT                   /locus_tag="Mmwyl1_0573"
FT   CDS_pept        complement(636737..637060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0573"
FT                   /product="putative phage protein"
FT                   /note="KEGG: hch:HCH_00381 probable phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69508"
FT                   /db_xref="InterPro:IPR019697"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSS9"
FT                   /protein_id="ABR69508.1"
FT                   /translation="MADYIDLLITNDDFTLDANGEPRLIYDADCIAQDIKHLIRESGLM
FT                   FEVIGQRDSLSVKYQMQKLTLLVEDDVRLVPGTINVTRVDTEMFYITATTYKYGEIGFE
FT                   VNA"
FT   gene            complement(637063..639258)
FT                   /locus_tag="Mmwyl1_0574"
FT   CDS_pept        complement(637063..639258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0574"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="TIGRFAM: phage tail tape measure protein, TP901
FT                   family; KEGG: hch:HCH_06778 phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69509"
FT                   /db_xref="GOA:A6VST0"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST0"
FT                   /protein_id="ABR69509.1"
FT                   /translation="MSALQRLDFIVSLMDRVSGPANKMMKTMDTVTSNIQTGYQKIGYG
FT                   VAGLFSVGYAFDQMLEPAKEMRTALGTISSLGVENAALENLRKTSMATAVQYGTDATEI
FT                   VNASYKLQSAISGLTGNELSMLANKSAMLATATKGGLESTNAYVGQMFNIHAVEADAIG
FT                   KTAFMDKLISKTAKAVQLFNTDGSQMGEAMKNIGKQATAMKVPLEEQLAVMGFLQNTMV
FT                   EGGRSGNAYSSFLANISKAETTLGMKFTDSQNKALPMIDIITKLQDKFGDLSKAGDQQM
FT                   LQKAFGKRGQQVLAAMAGSLDTFKGNLESIKAVKGLDDVTAMAMAIADPWDQSAAAVKN
FT                   FRMEFGERLLKVFSPVYTAITDTMTTLTKWMDMFPHLTGWVIKGVVGIGVLVGSLSALS
FT                   VAVGLSKFVMVGWSVVATSVGFIWGTLGKVISISRATWFAMNLQVALSGGLMNMLKINM
FT                   LTTWATMAAGTIQTTAMTLATGFWSKSMMVASIGSKGLTAGLALMKFGFLSSITAVWAF
FT                   SAALWANPITWIVVGVVALTAAVVAAVVYWDEWTGKLVEWGTAFLDFIGVFDFVDGVLA
FT                   VWDKIPQWWNSLMGWFGSFDVGSLFSSFLSGFGLVDGVLALWNKLPEWWASFKNYLSGM
FT                   NVFSFVGDSIDWLIDKINMIPGINIDTAKDMPKPVAAPASLSNQAPKMAGGGLVNQISN
FT                   ATSNNNNSRNVGDVHINNYGQAMDGRTFANELAFAAG"
FT   gene            complement(639424..639732)
FT                   /locus_tag="Mmwyl1_0575"
FT   CDS_pept        complement(639424..639732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69510"
FT                   /db_xref="InterPro:IPR024406"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST1"
FT                   /protein_id="ABR69510.1"
FT                   /translation="MPEIIITLGEGDDEKDIRFDVSMEDYNELLNNQVPGDKVGPGYNF
FT                   LVSHVHQEDKATFKERVLVNGKTPNGMLVMLIVNEITNEVTGDVAVKLKKPKALPSK"
FT   gene            complement(639743..640090)
FT                   /locus_tag="Mmwyl1_0576"
FT   CDS_pept        complement(639743..640090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0576"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="KEGG: har:HEAR2275 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69511"
FT                   /db_xref="GOA:A6VST2"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST2"
FT                   /protein_id="ABR69511.1"
FT                   /translation="MKQKPNSRKKDKTMPEKDPTTYSLITYSWVFVVAIYGGVVNYLRK
FT                   RRDGSIPRYSITEFVGEIMTSAFAGLVTFFLCEGANLDPMLSAALIAISGHMGARAIFM
FT                   FEKYLQNKLIK"
FT   gene            complement(640071..640550)
FT                   /locus_tag="Mmwyl1_0577"
FT   CDS_pept        complement(640071..640550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_06775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69512"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST3"
FT                   /protein_id="ABR69512.1"
FT                   /translation="MNIFKKLLDSVTGGFVSTAVDTFKDYFPPDMSAEQIADFELRTQK
FT                   LKSDIQKQTDDAANVAAELLTSRISQLEGTASDLKGVPFIGPLVLFLRGLQRPLWGYAT
FT                   LFMDYMWFSEWTTLTSKQESALMAINILVLGFLFGERAIKNVMPLVTKLFEAKAK"
FT   gene            complement(640547..641128)
FT                   /locus_tag="Mmwyl1_0578"
FT   CDS_pept        complement(640547..641128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_0704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69513"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST4"
FT                   /protein_id="ABR69513.1"
FT                   /translation="MKITTKAVLDALKKQDYPVFKGDWNITLVGVRSNDTAANTFNDRF
FT                   FVLFTLDGKQHAYDFACTTDPGVYYRENPINVDGTAWLMPGHHAGCWEIGYHQGKYKAL
FT                   AQRGEMTVYRDNNGDATLDKNSPTQTGLFGINCHHANPNTLSVQVDKWSAGCQVLADPV
FT                   DFALLMALVNKSAQKYGVRFSYTLLTEDQL"
FT   gene            complement(641141..641584)
FT                   /locus_tag="Mmwyl1_0579"
FT   CDS_pept        complement(641141..641584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0579"
FT                   /product="prophage PSPPH06, putative tail tube protein"
FT                   /note="KEGG: pat:Patl_0703 prophage PSPPH06, putative tail
FT                   tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69514"
FT                   /db_xref="InterPro:IPR019708"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST5"
FT                   /protein_id="ABR69514.1"
FT                   /translation="MRLTGKDFDTMIGDYSVRVESLSASITDNRKVIKENGIPVDFTNG
FT                   DVECSGEIELNIRNFKLIAAAAKDAGSWRDLKPFDIGITGSVTGENQTIDLDKCLLRIS
FT                   DLINIDPNSNDQMKIKLPFDVTGPDFVVIDGTPYLSAHDIRDL"
FT   gene            complement(641595..642728)
FT                   /locus_tag="Mmwyl1_0580"
FT   CDS_pept        complement(641595..642728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0580"
FT                   /product="prophage PSPPH06, putative tail sheath protein"
FT                   /note="KEGG: psp:PSPPH_4964 prophage PSPPH06, putative tail
FT                   sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69515"
FT                   /db_xref="InterPro:IPR019694"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST6"
FT                   /protein_id="ABR69515.1"
FT                   /translation="MAVGKIAVNALNLMQGPFPTVEKYFLFIGVGATNVDQILYLNTDS
FT                   DLDAELGAADSELKRNVVAAKANAGQNWAAAAIPVADGALWDAAVDFAMNNNIKVEAVV
FT                   VCTPVTEQAQLTAMHAKAMDLNTTYGRRAFFIAAARMIDGTPGTGESWSEYINDIKDLT
FT                   ETLSAFRVSIVPYIYDDAVGIYAGRLCNAQISVADTPMRVATGSIVGQDQSTLPTDKNG
FT                   IIYSNAHAIALNNQRFSVPAFYADYEGVYWSDGQLLDAVGGDFTVVENLRVIDKAARMV
FT                   RIILIQLIGDRRFNSTASGEAWAIRKLSRPLKNMSKSTEFNGMTFPAEIKPYQDGDIVI
FT                   NWITREKVEIYMVARPYSIPKDITANIMLDLSDPVAA"
FT   gene            complement(642715..643386)
FT                   /locus_tag="Mmwyl1_0581"
FT   CDS_pept        complement(642715..643386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0581"
FT                   /product="putative phage protein"
FT                   /note="KEGG: hch:HCH_00390 probable phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69516"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST7"
FT                   /protein_id="ABR69516.1"
FT                   /translation="MSKFITFDVRGALSLQKQLEVLRMPTALRRRLLSRTAKEVIRDSK
FT                   KRVRNQTDLNGNPFEERKRKRRRKMLTGLAKRQKVVRNDGTAATIGFNKSNDARIAAKH
FT                   QFGDEQMVSASSLPKGNGSKDGDATRRQAKALLEAGYKIPRKGGKGTKKPSQKWIMENL
FT                   TVGKAGAILRWLRDQDETAKTSWKVKLPARSFLGASNEEVTRYVEQIMNQIKQEVVNGR
FT                   R"
FT   gene            complement(643386..643838)
FT                   /locus_tag="Mmwyl1_0582"
FT   CDS_pept        complement(643386..643838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_06770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69517"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST8"
FT                   /protein_id="ABR69517.1"
FT                   /translation="MVKLQQITAFLVGLDLVAAENIDSWVENPRIVPRCSIIDDGQVIV
FT                   YTQTYDAMLSIERYPHTRHPAELLFAQVSVWLMENDEDRFEKELPMPATDVDILDSKTA
FT                   DIDIMITFEEDITAVLDENGPIVIDGQRYRLDDATITYVKEGEMKS"
FT   gene            complement(643839..644324)
FT                   /locus_tag="Mmwyl1_0583"
FT   CDS_pept        complement(643839..644324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0583"
FT                   /product="putative phage head completeion protein"
FT                   /note="KEGG: hch:HCH_00392 probable phage head completeion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69518"
FT                   /db_xref="GOA:A6VST9"
FT                   /db_xref="InterPro:IPR009225"
FT                   /db_xref="UniProtKB/TrEMBL:A6VST9"
FT                   /protein_id="ABR69518.1"
FT                   /translation="MSLTGKPSLTTAAPVANDGFWPDLSLSDLMNRYRIPSEYADDTIS
FT                   WGLSLALVRVNEQLERAKKAVLVIPFETFDGYLESSSAAALKVHYEHAVYSYAKAFLLQ
FT                   QFSTMNRRKEAENMAKESAETEQYWLDESKKSVAAILRHFVPGEEHSTKANFFVGLI"
FT   gene            complement(644432..645103)
FT                   /locus_tag="Mmwyl1_0584"
FT   CDS_pept        complement(644432..645103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0584"
FT                   /product="phage small terminase subunit"
FT                   /note="PFAM: phage small terminase subunit; KEGG:
FT                   hch:HCH_06767 probable phage small terminase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69519"
FT                   /db_xref="GOA:A6VSU0"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU0"
FT                   /protein_id="ABR69519.1"
FT                   /translation="MADGKDSTATMMIGGVGKHLFEQLQAAMVTDVARIKTKPVIEDKQ
FT                   ALKRELLPNYLPFVQAYVADGHDYPNDVAVQVMVWLFDVNDIDNALKIGMYLVATGNND
FT                   LPPKFSRNLPTFIADAIYDWANDQLKAEQTASPYLDDLVTYIDDDALVEKWDLHPAVIS
FT                   KNLALLAKHKEREGKFAECVALCERAEAVNPTGAGVKTMKERVQKLLDKSVESSDQETN
FT                   E"
FT   gene            complement(645409..646443)
FT                   /locus_tag="Mmwyl1_0585"
FT   CDS_pept        complement(645409..646443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0585"
FT                   /product="phage major capsid protein, P2 family"
FT                   /note="TIGRFAM: phage major capsid protein, P2 family;
FT                   PFAM: phage major capsid protein P2; KEGG: hch:HCH_06766
FT                   phage major capsid protein, P2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69520"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU1"
FT                   /protein_id="ABR69520.1"
FT                   /translation="MSAPTHLSAESRARLDQHFADTAEAFNVTPRDPSVGQHFSATPSV
FT                   AQTIYEKIVEHGDDFLKLINVIGVRDIKGEKVGMSLSGRSAGRTNTDGGIERKPKHLVK
FT                   TDSKGYELHHTEFDVALKYSKIDAWSKFKDFANRYMKMVRASIGDDMLQTGWTGISAET
FT                   FTDLEANPLLQDLNKGWLQIMREFKDGQQYLKATAEVPIVLGSDSIKNLDVLVHQAKQM
FT                   LPIYHRKRKDLVVIVGDDILSSQEETYFEVNGNTPTEKAVLANRITKAYGNLPIVYAPF
FT                   FPDGSLLVTPLDNLSIYFQDTSVRRLQKDKPELNEVQDFNSANQGYVVEDEEMAAFIEG
FT                   ITLA"
FT   gene            complement(646503..647417)
FT                   /locus_tag="Mmwyl1_0586"
FT   CDS_pept        complement(646503..647417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_2766 phage capsid scaffolding"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69521"
FT                   /db_xref="GOA:A6VSU2"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU2"
FT                   /protein_id="ABR69521.1"
FT                   /translation="MAKPKKEAKWYRFGRSGDTVDGRIIKEQDILDAVETFNSEYYPTR
FT                   IWPDHKRWFNLGKVIAIRAEKNDEGGTDMYGQVEANEYYKDMNKMGQRLFFSMELWPDF
FT                   RKSGKTYLSGLGATDEPASVATSEIHLSRVDEAVIVGESVESAPHYFDSQDGKEGDAKN
FT                   LLAAIASFFKSQTQSDDDSDDSQEETDMTKEQYEALSNGLTALTKRFNIAFPEQQQAPA
FT                   GNEAPTMEEQIIALTAQVKDLTDKQGTPPKDEPESGVSKEEFSQLKTALTTLTEQFKAA
FT                   TKEQPGTNGGEHDGDGKDLSACI"
FT   gene            647630..649435
FT                   /locus_tag="Mmwyl1_0587"
FT   CDS_pept        647630..649435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0587"
FT                   /product="protein of unknown function DUF264"
FT                   /note="PFAM: protein of unknown function DUF264; putative
FT                   terminase ATPase subunit; KEGG: hch:HCH_06764 Mu-like
FT                   prophage FluMu protein GP28"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69522"
FT                   /db_xref="GOA:A6VSU3"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU3"
FT                   /protein_id="ABR69522.1"
FT                   /translation="MAKTYSPEVKEAAKQLYIKGWAIQEISKDTGVETRTLYNWRDAGT
FT                   WDLFAPPDTVEQALARRINLLAEKDNKTPAEIDELAKLIAVFGDYQIKAAEAEKKQAEA
FT                   KAITSGGYISPEFPSSEGKSQGEKKSGGRGRKKKVKNDISSITEEMLDEVRNKLFFPYQ
FT                   EYWYQRKLDPLTRRTRMILKSRQIGATWYFAFEALDDAIRTGDNQLFLSSSRDQAEVFK
FT                   AYIIAFAMQHFDVELKGQGVITLSNGAELRFLSTNSRTANSYHGHLYCDEVFWMPDFVK
FT                   LWDMASGMSSHKKWRRTLFSVPSATSHPAYEMWNGNNYNKKLAESKRVTFDISHKNLKG
FT                   GWIGPDKMWRQIVTIEDAEEGGCDLFDIEQLRDENSTDAFNNKYLCKWIDDANSVFTLA
FT                   KLLSCMVDTETWTDYHKDAGQPFGNRPVAIGYDPSRTTDNASLALLSIPLGASDPWRLL
FT                   KKDSWRGVNFQWQAARIKEEKEKHNVKHIGIDVSGIGRGVFELVEQFYRRVTPITYSVQ
FT                   TKTELVLKALDLIENGLFKFSAGDKEVAQAFMMITKKVTDNGQITYVANRSNATGHADV
FT                   AWAIMHAFNYEPIAPKRKTTVAFSD"
FT   gene            649469..650485
FT                   /locus_tag="Mmwyl1_0588"
FT   CDS_pept        649469..650485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0588"
FT                   /product="phage portal protein, PBSX family"
FT                   /note="TIGRFAM: phage portal protein, PBSX family; PFAM:
FT                   phage portal protein; KEGG: hch:HCH_00397 phage portal
FT                   protein, PBSX family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69523"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU4"
FT                   /protein_id="ABR69523.1"
FT                   /translation="MTAAKETKTTKSATHMFEFGAPEPVLNNHISEYIGVYLDTLGEYY
FT                   RPPVSLSGLADLMNANPHHNSILHFKKNMVLKWFVPSTLMTYASMQRLALDYVVTGMMY
FT                   FQVFKNGFGKVVRTEWLPSLTMRRGRKKGVFFKLNKDGSKTEFKPGEVIQINNPDLKQD
FT                   IYGLPEYLGGIQSVLLSEEAGLFRRKYYINGAHMGYILVTNDADLDEETAAKIQKKVQD
FT                   SKGPGNFRSLYLNIGKSAAKDPVQIIPVGDIGTKDEFERVKNITMIEILSMHRMQPGLS
FT                   GIMPDNTGGFGDIEKIMRVYHELEIGALQQPFLEINQHIGAGAVSFREPVWMGVQKE"
FT   gene            complement(650513..650815)
FT                   /locus_tag="Mmwyl1_0589"
FT   CDS_pept        complement(650513..650815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69524"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU5"
FT                   /protein_id="ABR69524.1"
FT                   /translation="MTTPPTVTTIQEINDQYSYEDTTPGGKTDKKWVSCGQDSNYNELK
FT                   HIFEKHLQPKIDLGLFTKQKALNALNSACFDLSSPRTRTRFETYLETYLDVKIFS"
FT   gene            651040..651447
FT                   /locus_tag="Mmwyl1_0590"
FT   CDS_pept        651040..651447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_1721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69525"
FT                   /db_xref="InterPro:IPR041131"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU6"
FT                   /protein_id="ABR69525.1"
FT                   /translation="MTGAPPKKEVVLILGDTPQYLVEHANFPELPIVITGSVIEKACFD
FT                   HGIPTSLLKRLPSILDNPKGLFKSASFHVKGAAVVLTIEVHQSSPIIIPVHPNKQMGRG
FT                   KFYNVVASVYAKEGPNPEVKWTREGLLLWKK"
FT   gene            651679..651909
FT                   /pseudo
FT                   /locus_tag="Mmwyl1_0591"
FT   gene            complement(651930..652211)
FT                   /locus_tag="Mmwyl1_0592"
FT   CDS_pept        complement(651930..652211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69526"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU7"
FT                   /protein_id="ABR69526.1"
FT                   /translation="MGKPDKDLTQDFHMDRVNLDISTSDEIKRQIHHMSFGIDALDGLG
FT                   MMAAHAIEDDIGVTGEQIASLLKCVEYSLLTTQRKIIAAIDENDGNTH"
FT   gene            complement(652204..652629)
FT                   /locus_tag="Mmwyl1_0593"
FT   CDS_pept        complement(652204..652629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69527"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU8"
FT                   /protein_id="ABR69527.1"
FT                   /translation="MWFKVLITRIQTMNNAIVRSQHHHALFPSIGTLSALPTQRTGIGR
FT                   IVAVCVESDEPLFVQTPNGAIFSIGGLSDRQKQQLLTLLPDLIHTRVRFRYRQHNALGQ
FT                   AVDAVFQTLLIEGDTRHRASPVVFNNGFNNMQGVQHG"
FT   gene            652945..653340
FT                   /locus_tag="Mmwyl1_0594"
FT   CDS_pept        652945..653340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69528"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSU9"
FT                   /protein_id="ABR69528.1"
FT                   /translation="MIPKYKDISDLLDKGATVEALERIMELREATLELQEENLDLKVKV
FT                   KKLEEELEEKAKLNYEAPFYWMIEGDNKDGPFCQKCFDSDTKKIRLQTNGNDYWICNAC
FT                   KSQYRGKEFKVRKTKRVSSVSNHWLGN"
FT   gene            653342..653863
FT                   /locus_tag="Mmwyl1_0595"
FT   CDS_pept        653342..653863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69529"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSV0"
FT                   /protein_id="ABR69529.1"
FT                   /translation="MKIDQEYLLTLLSPLDDGDILTLSEYLSEVEKLGVVVCESNKRPT
FT                   EMFDLHLDYIISKKLISNIEGKSDRKSLGFFPGLSGQLSIIGSVKIMKTEKEEIASNST
FT                   FNFNAPVTTQQAQFGNGNTQNVTINMQELVEKVAASNDQEAKGVLKKLLDNSTVSSVIG
FT                   AGVSGLIGLL"
FT   gene            653894..654694
FT                   /locus_tag="Mmwyl1_0596"
FT   CDS_pept        653894..654694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atu:Atu5029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69530"
FT                   /db_xref="GOA:A6VSV1"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSV1"
FT                   /protein_id="ABR69530.1"
FT                   /translation="MDQIFTFFNQGWVGTLIGVVGIPVSAIVGYLIARYVRHKPKLVYQ
FT                   MNSLELLGEKESELPSDVTIFYQDQEVKRLKKTTIIFWNSGTAEFDGQNIVKSDPIRIE
FT                   FSDGDNVLSYEVIKATTPSNEFKISISGKRNIINIQFDYLNPKDGAKIVILHDSDFFFP
FT                   NIKGSLKGSAEGVLNFGLLLSKEIKRRSFFKLSTMMFFCIDFVLFYKLFILGYIHEYED
FT                   KMILGFLRLDFIVTFYVFGSFFFGIYFIARDFFFNNKKAPRELK"
FT   gene            655234..656283
FT                   /locus_tag="Mmwyl1_0597"
FT   CDS_pept        655234..656283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pau:PA14_59050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69531"
FT                   /db_xref="GOA:A6VSV2"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSV2"
FT                   /protein_id="ABR69531.1"
FT                   /translation="MTIKHVIIHVVMRDESTGVLHKQLRTEENKIRSSEKTSEALAEKL
FT                   TNDLRNLFGTASLSIGEFGVRGDNTLKPAFEQTLETFYETPETCSDFVQLTRRFAEQYY
FT                   AILTEENLTTVKGGYLVFYQYTARGQEWLAVVILNKTEGIDVNSTSLEVVPSEILDLKT
FT                   LHLAASINLTKWMLGDDTRYIRFKTGRAAQIRDYFEKFIGCQRDKYAAVVETHQLKAAV
FT                   QNFAKESGYNEEKVSNKVDKTHQFIIERQKDQEPVLLKALANAVFPDLSEEFEREARDT
FT                   YNLSEEISIDKNELKKYVKIFVQSKAFSMSFERDLVGKQIFVVNNEVRISQPPELLINA
FT                   INEELESRK"
FT   gene            656283..657542
FT                   /locus_tag="Mmwyl1_0598"
FT   CDS_pept        656283..657542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmwyl1_0598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmwyl1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABR69532"
FT                   /db_xref="GOA:A6VSV3"
FT                   /db_xref="UniProtKB/TrEMBL:A6VSV3"
FT                   /protein_id="ABR69532.1"
FT                   /translation="MKPEKHILKYYSDIFKTLSDRHLSDGDHVGWMKLDSDNIKIIKVL
FT                   SDSGLAKGVFSYSIDGVEQVGSLIPLENISDKHFNEKYLFKIKLVSVNIKTSAPIFKNW
F