(data stored in ACNUC7421 zone)

EMBL: CP000758

ID   CP000758; SV 1; circular; genomic DNA; STD; PRO; 2887297 BP.
XX
AC   CP000758;
XX
PR   Project:PRJNA19485;
XX
DT   14-JUL-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Ochrobactrum anthropi ATCC 49188 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Ochrobactrum anthropi ATCC 49188
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Brucellaceae;
OC   Ochrobactrum.
XX
RN   [1]
RP   1-2887297
RX   DOI; 10.1128/JB.05335-11.
RX   PUBMED; 21685287.
RA   Chain P.S., Lang D.M., Comerci D.J., Malfatti S.A., Vergez L.M., Shin M.,
RA   Ugalde R.A., Garcia E., Tolmasky M.E.;
RT   "Genome of Ochrobactrum anthropi ATCC 49188 T, a versatile opportunistic
RT   pathogen and symbiont of several eukaryotic hosts";
RL   J. Bacteriol. 193(16):4274-4275(2011).
XX
RN   [2]
RP   1-2887297
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Garcia E.,
RA   Tolmasky M.E., Richardson P.;
RT   ;
RL   Submitted (10-JUL-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 200a2fadc18d3ea4840b21e881833236.
DR   BioSample; SAMN02598421.
DR   EnsemblGenomes-Gn; EBG00001088945.
DR   EnsemblGenomes-Gn; EBG00001088946.
DR   EnsemblGenomes-Gn; EBG00001088947.
DR   EnsemblGenomes-Gn; EBG00001088948.
DR   EnsemblGenomes-Gn; EBG00001088949.
DR   EnsemblGenomes-Gn; EBG00001088950.
DR   EnsemblGenomes-Gn; EBG00001088951.
DR   EnsemblGenomes-Gn; EBG00001088952.
DR   EnsemblGenomes-Gn; EBG00001088953.
DR   EnsemblGenomes-Gn; EBG00001088954.
DR   EnsemblGenomes-Gn; EBG00001088955.
DR   EnsemblGenomes-Gn; EBG00001088956.
DR   EnsemblGenomes-Gn; EBG00001088957.
DR   EnsemblGenomes-Gn; EBG00001088958.
DR   EnsemblGenomes-Gn; EBG00001088959.
DR   EnsemblGenomes-Gn; EBG00001088960.
DR   EnsemblGenomes-Gn; EBG00001088961.
DR   EnsemblGenomes-Gn; EBG00001088962.
DR   EnsemblGenomes-Gn; EBG00001088963.
DR   EnsemblGenomes-Gn; EBG00001088964.
DR   EnsemblGenomes-Gn; EBG00001088965.
DR   EnsemblGenomes-Gn; EBG00001088966.
DR   EnsemblGenomes-Gn; EBG00001088967.
DR   EnsemblGenomes-Gn; EBG00001088968.
DR   EnsemblGenomes-Gn; EBG00001088969.
DR   EnsemblGenomes-Gn; EBG00001088970.
DR   EnsemblGenomes-Gn; EBG00001088971.
DR   EnsemblGenomes-Gn; EBG00001088972.
DR   EnsemblGenomes-Gn; EBG00001088973.
DR   EnsemblGenomes-Gn; EBG00001088974.
DR   EnsemblGenomes-Gn; EBG00001088975.
DR   EnsemblGenomes-Gn; EBG00001088976.
DR   EnsemblGenomes-Gn; EBG00001088977.
DR   EnsemblGenomes-Gn; EBG00001088978.
DR   EnsemblGenomes-Gn; EBG00001088979.
DR   EnsemblGenomes-Gn; EBG00001088980.
DR   EnsemblGenomes-Gn; EBG00001088981.
DR   EnsemblGenomes-Gn; EBG00001088982.
DR   EnsemblGenomes-Gn; EBG00001088983.
DR   EnsemblGenomes-Gn; EBG00001088984.
DR   EnsemblGenomes-Gn; EBG00001088985.
DR   EnsemblGenomes-Gn; EBG00001088986.
DR   EnsemblGenomes-Gn; EBG00001088987.
DR   EnsemblGenomes-Gn; EBG00001088988.
DR   EnsemblGenomes-Gn; EBG00001088989.
DR   EnsemblGenomes-Gn; EBG00001088990.
DR   EnsemblGenomes-Gn; EBG00001088991.
DR   EnsemblGenomes-Gn; EBG00001088992.
DR   EnsemblGenomes-Gn; EBG00001088993.
DR   EnsemblGenomes-Gn; EBG00001088994.
DR   EnsemblGenomes-Gn; EBG00001088995.
DR   EnsemblGenomes-Gn; EBG00001088996.
DR   EnsemblGenomes-Gn; EBG00001088997.
DR   EnsemblGenomes-Gn; EBG00001088998.
DR   EnsemblGenomes-Gn; EBG00001088999.
DR   EnsemblGenomes-Gn; EBG00001089000.
DR   EnsemblGenomes-Gn; EBG00001089001.
DR   EnsemblGenomes-Gn; EBG00001089002.
DR   EnsemblGenomes-Gn; EBG00001089003.
DR   EnsemblGenomes-Gn; EBG00001089004.
DR   EnsemblGenomes-Gn; EBG00001089005.
DR   EnsemblGenomes-Gn; EBG00001089006.
DR   EnsemblGenomes-Gn; EBG00001089007.
DR   EnsemblGenomes-Gn; EBG00001089008.
DR   EnsemblGenomes-Gn; EBG00001089009.
DR   EnsemblGenomes-Gn; EBG00001089010.
DR   EnsemblGenomes-Gn; Oant_R0002.
DR   EnsemblGenomes-Gn; Oant_R0003.
DR   EnsemblGenomes-Gn; Oant_R0004.
DR   EnsemblGenomes-Gn; Oant_R0005.
DR   EnsemblGenomes-Gn; Oant_R0006.
DR   EnsemblGenomes-Gn; Oant_R0007.
DR   EnsemblGenomes-Gn; Oant_R0008.
DR   EnsemblGenomes-Gn; Oant_R0009.
DR   EnsemblGenomes-Gn; Oant_R0010.
DR   EnsemblGenomes-Gn; Oant_R0011.
DR   EnsemblGenomes-Gn; Oant_R0012.
DR   EnsemblGenomes-Gn; Oant_R0013.
DR   EnsemblGenomes-Gn; Oant_R0014.
DR   EnsemblGenomes-Gn; Oant_R0015.
DR   EnsemblGenomes-Gn; Oant_R0016.
DR   EnsemblGenomes-Gn; Oant_R0017.
DR   EnsemblGenomes-Gn; Oant_R0018.
DR   EnsemblGenomes-Gn; Oant_R0019.
DR   EnsemblGenomes-Gn; Oant_R0020.
DR   EnsemblGenomes-Gn; Oant_R0021.
DR   EnsemblGenomes-Gn; Oant_R0022.
DR   EnsemblGenomes-Gn; Oant_R0023.
DR   EnsemblGenomes-Gn; Oant_R0024.
DR   EnsemblGenomes-Gn; Oant_R0025.
DR   EnsemblGenomes-Gn; Oant_R0026.
DR   EnsemblGenomes-Gn; Oant_R0027.
DR   EnsemblGenomes-Gn; Oant_R0028.
DR   EnsemblGenomes-Gn; Oant_R0030.
DR   EnsemblGenomes-Gn; Oant_R0031.
DR   EnsemblGenomes-Gn; Oant_R0032.
DR   EnsemblGenomes-Gn; Oant_R0033.
DR   EnsemblGenomes-Gn; Oant_R0034.
DR   EnsemblGenomes-Gn; Oant_R0035.
DR   EnsemblGenomes-Gn; Oant_R0036.
DR   EnsemblGenomes-Gn; Oant_R0037.
DR   EnsemblGenomes-Gn; Oant_R0038.
DR   EnsemblGenomes-Gn; Oant_R0039.
DR   EnsemblGenomes-Gn; Oant_R0040.
DR   EnsemblGenomes-Gn; Oant_R0041.
DR   EnsemblGenomes-Gn; Oant_R0042.
DR   EnsemblGenomes-Gn; Oant_R0043.
DR   EnsemblGenomes-Gn; Oant_R0044.
DR   EnsemblGenomes-Gn; Oant_R0045.
DR   EnsemblGenomes-Gn; Oant_R0046.
DR   EnsemblGenomes-Gn; Oant_R0047.
DR   EnsemblGenomes-Gn; Oant_R0048.
DR   EnsemblGenomes-Gn; Oant_R0049.
DR   EnsemblGenomes-Gn; Oant_R0050.
DR   EnsemblGenomes-Gn; Oant_R0051.
DR   EnsemblGenomes-Tr; EBT00001691474.
DR   EnsemblGenomes-Tr; EBT00001691475.
DR   EnsemblGenomes-Tr; EBT00001691476.
DR   EnsemblGenomes-Tr; EBT00001691477.
DR   EnsemblGenomes-Tr; EBT00001691478.
DR   EnsemblGenomes-Tr; EBT00001691479.
DR   EnsemblGenomes-Tr; EBT00001691480.
DR   EnsemblGenomes-Tr; EBT00001691481.
DR   EnsemblGenomes-Tr; EBT00001691482.
DR   EnsemblGenomes-Tr; EBT00001691483.
DR   EnsemblGenomes-Tr; EBT00001691484.
DR   EnsemblGenomes-Tr; EBT00001691485.
DR   EnsemblGenomes-Tr; EBT00001691486.
DR   EnsemblGenomes-Tr; EBT00001691487.
DR   EnsemblGenomes-Tr; EBT00001691488.
DR   EnsemblGenomes-Tr; EBT00001691489.
DR   EnsemblGenomes-Tr; EBT00001691490.
DR   EnsemblGenomes-Tr; EBT00001691491.
DR   EnsemblGenomes-Tr; EBT00001691492.
DR   EnsemblGenomes-Tr; EBT00001691493.
DR   EnsemblGenomes-Tr; EBT00001691494.
DR   EnsemblGenomes-Tr; EBT00001691495.
DR   EnsemblGenomes-Tr; EBT00001691496.
DR   EnsemblGenomes-Tr; EBT00001691497.
DR   EnsemblGenomes-Tr; EBT00001691498.
DR   EnsemblGenomes-Tr; EBT00001691499.
DR   EnsemblGenomes-Tr; EBT00001691500.
DR   EnsemblGenomes-Tr; EBT00001691501.
DR   EnsemblGenomes-Tr; EBT00001691502.
DR   EnsemblGenomes-Tr; EBT00001691503.
DR   EnsemblGenomes-Tr; EBT00001691504.
DR   EnsemblGenomes-Tr; EBT00001691505.
DR   EnsemblGenomes-Tr; EBT00001691506.
DR   EnsemblGenomes-Tr; EBT00001691507.
DR   EnsemblGenomes-Tr; EBT00001691508.
DR   EnsemblGenomes-Tr; EBT00001691509.
DR   EnsemblGenomes-Tr; EBT00001691510.
DR   EnsemblGenomes-Tr; EBT00001691511.
DR   EnsemblGenomes-Tr; EBT00001691512.
DR   EnsemblGenomes-Tr; EBT00001691513.
DR   EnsemblGenomes-Tr; EBT00001691514.
DR   EnsemblGenomes-Tr; EBT00001691515.
DR   EnsemblGenomes-Tr; EBT00001691516.
DR   EnsemblGenomes-Tr; EBT00001691517.
DR   EnsemblGenomes-Tr; EBT00001691518.
DR   EnsemblGenomes-Tr; EBT00001691519.
DR   EnsemblGenomes-Tr; EBT00001691520.
DR   EnsemblGenomes-Tr; EBT00001691521.
DR   EnsemblGenomes-Tr; EBT00001691522.
DR   EnsemblGenomes-Tr; EBT00001691523.
DR   EnsemblGenomes-Tr; EBT00001691524.
DR   EnsemblGenomes-Tr; EBT00001691525.
DR   EnsemblGenomes-Tr; EBT00001691526.
DR   EnsemblGenomes-Tr; EBT00001691527.
DR   EnsemblGenomes-Tr; EBT00001691528.
DR   EnsemblGenomes-Tr; EBT00001691529.
DR   EnsemblGenomes-Tr; EBT00001691530.
DR   EnsemblGenomes-Tr; EBT00001691531.
DR   EnsemblGenomes-Tr; EBT00001691532.
DR   EnsemblGenomes-Tr; EBT00001691533.
DR   EnsemblGenomes-Tr; EBT00001691534.
DR   EnsemblGenomes-Tr; EBT00001691535.
DR   EnsemblGenomes-Tr; EBT00001691536.
DR   EnsemblGenomes-Tr; EBT00001691537.
DR   EnsemblGenomes-Tr; EBT00001691538.
DR   EnsemblGenomes-Tr; EBT00001691539.
DR   EnsemblGenomes-Tr; Oant_R0002-1.
DR   EnsemblGenomes-Tr; Oant_R0003-1.
DR   EnsemblGenomes-Tr; Oant_R0004-1.
DR   EnsemblGenomes-Tr; Oant_R0005-1.
DR   EnsemblGenomes-Tr; Oant_R0006-1.
DR   EnsemblGenomes-Tr; Oant_R0007-1.
DR   EnsemblGenomes-Tr; Oant_R0008-1.
DR   EnsemblGenomes-Tr; Oant_R0009-1.
DR   EnsemblGenomes-Tr; Oant_R0010-1.
DR   EnsemblGenomes-Tr; Oant_R0011-1.
DR   EnsemblGenomes-Tr; Oant_R0012-1.
DR   EnsemblGenomes-Tr; Oant_R0013-1.
DR   EnsemblGenomes-Tr; Oant_R0014-1.
DR   EnsemblGenomes-Tr; Oant_R0015-1.
DR   EnsemblGenomes-Tr; Oant_R0016-1.
DR   EnsemblGenomes-Tr; Oant_R0017-1.
DR   EnsemblGenomes-Tr; Oant_R0018-1.
DR   EnsemblGenomes-Tr; Oant_R0019-1.
DR   EnsemblGenomes-Tr; Oant_R0020-1.
DR   EnsemblGenomes-Tr; Oant_R0021-1.
DR   EnsemblGenomes-Tr; Oant_R0022-1.
DR   EnsemblGenomes-Tr; Oant_R0023-1.
DR   EnsemblGenomes-Tr; Oant_R0024-1.
DR   EnsemblGenomes-Tr; Oant_R0025-1.
DR   EnsemblGenomes-Tr; Oant_R0026-1.
DR   EnsemblGenomes-Tr; Oant_R0027-1.
DR   EnsemblGenomes-Tr; Oant_R0028-1.
DR   EnsemblGenomes-Tr; Oant_R0030-1.
DR   EnsemblGenomes-Tr; Oant_R0031-1.
DR   EnsemblGenomes-Tr; Oant_R0032-1.
DR   EnsemblGenomes-Tr; Oant_R0033-1.
DR   EnsemblGenomes-Tr; Oant_R0034-1.
DR   EnsemblGenomes-Tr; Oant_R0035-1.
DR   EnsemblGenomes-Tr; Oant_R0036-1.
DR   EnsemblGenomes-Tr; Oant_R0037-1.
DR   EnsemblGenomes-Tr; Oant_R0038-1.
DR   EnsemblGenomes-Tr; Oant_R0039-1.
DR   EnsemblGenomes-Tr; Oant_R0040-1.
DR   EnsemblGenomes-Tr; Oant_R0041-1.
DR   EnsemblGenomes-Tr; Oant_R0042-1.
DR   EnsemblGenomes-Tr; Oant_R0043-1.
DR   EnsemblGenomes-Tr; Oant_R0044-1.
DR   EnsemblGenomes-Tr; Oant_R0045-1.
DR   EnsemblGenomes-Tr; Oant_R0046-1.
DR   EnsemblGenomes-Tr; Oant_R0047-1.
DR   EnsemblGenomes-Tr; Oant_R0048-1.
DR   EnsemblGenomes-Tr; Oant_R0049-1.
DR   EnsemblGenomes-Tr; Oant_R0050-1.
DR   EnsemblGenomes-Tr; Oant_R0051-1.
DR   EuropePMC; PMC2725468; 19542343.
DR   EuropePMC; PMC2810298; 20021660.
DR   EuropePMC; PMC3147672; 21685287.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC5107632; 27839533.
DR   EuropePMC; PMC5353553; 28300153.
DR   EuropePMC; PMC6191975; 30345061.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000758.
DR   SILVA-SSU; CP000758.
DR   StrainInfo; 389567; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773013
CC   Source DNA available from Emilio Garcia (garcia12@llnl.gov)
CC   Bacteria available from ATCC: ATCC 49188
CC   Contacts: Emilio Garcia (garcia12@llnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Note: This projects consists of 2 chromosomes and 4
CC   plasmids.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2887297
FT                   /organism="Ochrobactrum anthropi ATCC 49188"
FT                   /chromosome="1"
FT                   /strain="ATCC 49188"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:439375"
FT   gene            85..261
FT                   /pseudo
FT                   /locus_tag="Oant_0001"
FT   gene            277..543
FT                   /locus_tag="Oant_0002"
FT   CDS_pept        277..543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0002"
FT                   /product="ribosomal protein S20"
FT                   /note="PFAM: ribosomal protein S20; KEGG: bmb:BruAb1_2158
FT                   RpsT, ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12733"
FT                   /db_xref="GOA:A6WUS9"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WUS9"
FT                   /protein_id="ABS12733.1"
FT                   /translation="MANTPSAKKAVRKIAARTEINKSRRSRVRTFVRKLEDALLSGDKQ
FT                   AAEVAFKAAEPELMRAASKGVMHKNTASRKVSRLAQRVKALKA"
FT   gene            1439..3001
FT                   /locus_tag="Oant_0003"
FT   CDS_pept        1439..3001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0003"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: bme:BMEI1943 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12734"
FT                   /db_xref="GOA:A6WUT0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT0"
FT                   /protein_id="ABS12734.1"
FT                   /translation="MMTGKSTATMGDDAHANRIHGSSATGNEKSLVELSGNAGDEVFER
FT                   LTAKLKARVGTEIYSSWFGRLKLDDISKSIVRLSVPTAFLRSWINNHYSELLTELWQEE
FT                   NPQILKVEVVVRGVSRVVRSAAPVEACEAVETKPAVAPREKMVFPVGQSLGEKRGSAVV
FT                   AESASGSVLGSPLDPRYTFDSFVDGASNRVALAAARTIAEAGSSAVRFNPLFIHASVGL
FT                   GKTHLLQAIAAAALQRQEKARVVYLTAEYFMWRFATAIRDNNALSFKEQLRDIDLLVID
FT                   DMQFLQGKSIQHEFCHLLNTLLDSAKQVVVAADRAPSELESLDVRVRSRLQGGVALEVA
FT                   APDYDMRVEMLRRRLAVAQAEDSSLNIGEEILSHVARTVTGSGRELEGAFNQLLFRQSF
FT                   EPNISIDRVDELLGHLTRVGEPKRIRIEEIQRIVARHYNVSKQDLLSNRRTRTIVKPRQ
FT                   VAMYLAKMMTPRSLPEIGRRFGGRDHTTVLHAVRKIEDLVGADTKLAQELELLKRLIND
FT                   QAA"
FT   gene            3169..4326
FT                   /locus_tag="Oant_0004"
FT   CDS_pept        3169..4326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0004"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: bms:BR0002 DNA polymerase
FT                   III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12735"
FT                   /db_xref="GOA:A6WUT1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT1"
FT                   /protein_id="ABS12735.1"
FT                   /translation="MQLSCPSERVRLNMRVTLERSNLLKSLNHVHRVVERRNTIPILSN
FT                   VLLQAEGASLALKATDLDLEVNEATAAMVEQAGATTVPAHLLYDIVRKLPDGAEVMLST
FT                   NPDGGSISVISGKSSFRLQCLPQSDFPELTAGAFTHSFRIEAQALKRLIDRTQFAISTE
FT                   ETRYYLNGIFFHAIESEGALKLRAVATDGHRLARAELEAPSGTEGMPGIIIPRKTVAEL
FT                   QKLVDVPDVVVTVELSDAKIRFTVGSVVLTSKLIDGTFPDYQRVIPSGNDKKLTIGRQE
FT                   FAASVDRVSTISSERGRAVKLSIADGQLTLTVNNPDSGSATDELAADYDADPLDIGFNS
FT                   KYLLDITSQLSGSDAVFMLADAGSPTLVRDTGDEDVLYVLMPMRV"
FT   gene            4338..5501
FT                   /locus_tag="Oant_0005"
FT   CDS_pept        4338..5501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; SMART: AAA ATPase; KEGG:
FT                   bms:BR0003 recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12736"
FT                   /db_xref="GOA:A6WUT2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT2"
FT                   /protein_id="ABS12736.1"
FT                   /translation="MNTPEPNQSRPERVSIRRLKLVNFRNYAELSLPLGPGHVVLTGEN
FT                   GSGKTNLIEAISFLSPGRGLRRAAYDDVARANSLDGFAIHAALDCMIYGEAEIGTGTAG
FT                   GGEGGRKVRINGIAGSGDDMLDYARILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAH
FT                   GKRVLDYEKAMRSRNRLLNDGSNDDQWLDAIESQMAELGTAIAAARAEAMRLIAAMIER
FT                   LPVEGPFPKADCFLEGTLEQRINVEAALDLEEDFRRTLRDGRARDRAAGRTLEGPHRTD
FT                   LIVQHRPKSMPAALCSTGEQKALLIGLVLAHARLTAELSGMAPILLLDEIAAHLDTGRR
FT                   AALFGILDELGGQAFMTGTDRALFEALEGEAQFFNVSAGHLTRLSDT"
FT   gene            5574..6356
FT                   /locus_tag="Oant_0006"
FT   CDS_pept        5574..6356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0006"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bmb:BruAb1_0004 MoeB,
FT                   molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12737"
FT                   /db_xref="GOA:A6WUT3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT3"
FT                   /protein_id="ABS12737.1"
FT                   /translation="MFGGMNAPSRPFSSEELERYARHIVLPEIGGPGQQKLKAARVLIV
FT                   GAGGLGAPVLQYLAAAGVGTLGIVDDDTVSLSNLQRQVIHDTESVGQPKVESALATIAR
FT                   INPHVKVEGHQLRLDADNVETLIGNYDVLVDGSDNFTTRYILADAAARVEKPLVTGAMG
FT                   RFDGTVTVLMPYTTGPDGTQNPSYRDLFPEAPPPGTVPTCAEAGVLGVLPGVIGSLQVM
FT                   EVIKLITGIGEPLVGRLLLYNALNVRFETIRYKARKPK"
FT   gene            6353..6853
FT                   /locus_tag="Oant_0007"
FT   CDS_pept        6353..6853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0007"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mlo:mll5576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12738"
FT                   /db_xref="GOA:A6WUT4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT4"
FT                   /protein_id="ABS12738.1"
FT                   /translation="MTALRVEAIGENFGQWEELLGMIRDSFAYMDGVIDPPSSAGLLTA
FT                   ENLRQKAQEETGFAAFLDDRLVGCVFIREKAEGFYLGKLAVAPAFEGRGIGRLLMQKAE
FT                   DVAVAKDKPSIELQVRIELTRNRAVFEKLGYRKIAETAHPGYSRPTSITMRKEITRGTD
FT                   INA"
FT   gene            6831..8090
FT                   /locus_tag="Oant_0008"
FT   CDS_pept        6831..8090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0008"
FT                   /product="protein of unknown function DUF521"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   rde:RD1_3781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12739"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT5"
FT                   /protein_id="ABS12739.1"
FT                   /translation="MALTLTHEERSIAAGDLGEGAAMAMRIVADTARLMGAPRLIPVAS
FT                   AHIDGALYHGDSGTLFAEKLVEGGAKVKVRSTLNVGSIDLTGCSRNLLPAHEADMAKRM
FT                   MRAYIKLGCEPTWTCAPYQAGHRPAKGTDVAWGESNAVVFCNSVLGARTNRYGDFLDIA
FT                   CAIAGRAPDYGLHRSENRRATVVIDISGLDPAFLSSEVAWPILGNLFGRSVGTNIGVVA
FT                   GSPVHPDEDDLKAFGAASASVGAVGLFHVAGVTPEAPDLETALQHQKPEGVIRVTREMI
FT                   EATRKRLSTVEQVDHIDAVAIGSPHLSRTEFDRLERAIAERKLAVPLYACTGRHALVEL
FT                   EKDGRRQALEKAGVVIVADTCVVVTPILPAKDDAILMTNSGKFAHYAPGNTGYGVLYGS
FT                   LEECVESAVAGRPVFGRQAA"
FT   gene            8087..8554
FT                   /locus_tag="Oant_0009"
FT   CDS_pept        8087..8554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0009"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   pde:Pden_4854 protein of unknown function DUF521"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12740"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT6"
FT                   /protein_id="ABS12740.1"
FT                   /translation="MSIGESTVLVAGKGADAEALVLSAPISFWGGVDPKSGRIADVRHP
FT                   EHGRSIAGRVLCLPGTIGSSSAAAVLLELVHSGHAPAAIVLHEPDAILLLGLIVAREMG
FT                   HDVPIAIELDREAQKQLAGHRVAVGEDGAIGMRVKTNDWSADLIQSDRNAL"
FT   gene            complement(8551..9507)
FT                   /locus_tag="Oant_0010"
FT   CDS_pept        complement(8551..9507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0010"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: bms:BR0005 D-isomer specific
FT                   2-hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12741"
FT                   /db_xref="GOA:A6WUT7"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT7"
FT                   /protein_id="ABS12741.1"
FT                   /translation="MSETKGNILLAITDWDPEIWLKTFRDHAPDRPVVTDRTEKDPSVK
FT                   YALVWKQKPGSLENLPNLKVIFSLGAGVDHVFRDDRIPDVPLVRIISDDLTMRMTEYVV
FT                   WQVLDHHRLGQRYRKQQQNHVWHEDRRQPAAHEVTVGIMGLGVLGRDAAEKLKLLGFNV
FT                   TGWSRRPQEIDGVQTYHGKDGFGKFLKTTDIFVCLLPLTPDTKGILSMSMFAQLKSDGP
FT                   LGAPVLINAGRGGLQNEADILAALDRGLLSAASLDVFNQEPLPTSSPLWDHPRVTITPH
FT                   AAASSSATALVPQIIRQIEAFERDGTLEHIVDRSTQY"
FT   gene            complement(9504..11165)
FT                   /locus_tag="Oant_0011"
FT   CDS_pept        complement(9504..11165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0011"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: bmb:BruAb1_0006 ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12742"
FT                   /db_xref="GOA:A6WUT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT8"
FT                   /protein_id="ABS12742.1"
FT                   /translation="MSGPMSGSMIESGNKILLSVRDLSVAFRQNGEERISVDRVSFDIA
FT                   EGETVALVGESGSGKSVSALSILKLLPYPSASHPSGEILFNGKDLMKASEPELRRVRGN
FT                   DITMIFQEPMTSLNPLHSVERQIGEILKMHQGMGEQAARARTLELLNEVGIREPEKRLS
FT                   AFPHQLSGGQRQRVMIAMALANKPKLLIADEPTTALDVTVQAQILKLLAELKAAQGMSM
FT                   LFITHDLGIVRKIADKVCVMSKGKIVEAGPTKEIFENPQHPYTKHLLAAEPKGEPPAAD
FT                   PAAKTVMEGKDIRVWFPIKKGFMRKTVDHVKAVDGIDVNLRAGQTLGVVGESGSGKTTL
FT                   GLALSRMISSKGEIRFDGRDIAKFSFSDMRPLRREMQIVFQDPFGSLSPRMTIADIIAE
FT                   GLLVHEPKLSADERDARVVAALNEVNLDPETRFRYPHEFSGGQRQRVAIARAMVLNPKF
FT                   VMLDEPTSALDMSVQAQVVDLLRALQKKHDLAYLFISHDLKVVRALANDVLVMRNGKAV
FT                   EYGAAKDVFANPQTDYTKALMAAAFRMEATEGGARQ"
FT   gene            complement(11162..12301)
FT                   /locus_tag="Oant_0012"
FT   CDS_pept        complement(11162..12301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0012"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bme:BMEI1937 oligopeptide
FT                   transport system permease protein OppC"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12743"
FT                   /db_xref="GOA:A6WUT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUT9"
FT                   /protein_id="ABS12743.1"
FT                   /translation="MTDTTLTPVVQPVKRPFLSPLNKRRWQNFKANKRGYWSLWIFLFL
FT                   LIAALCSEFIANDRPILVSYKGELLMPVFVDYPEEKFGGFYAVTDYRDPMIQDEINNNG
FT                   WAIWPPIRYSYNTVNNEIPEAAPSKPFWLYSAEERCQRYPQGVSDPNCRFGNFNLLGTD
FT                   DQARDVFARALYGFRISVLFGLILTFFSAIIGVTAGAVQGYFGGWVDLLFQRFIEIWSS
FT                   IPVLYLLLIIAAILPPGFWVLLGIMLLFSWVAFVGVVRAEFLRARNFEYVNAARALGVK
FT                   NGTIMWRHLLPNAMVATLTFLPFILNGSITTLTSLDFLGFGLPPGSASLGELLAQGKNN
FT                   LQAPWLGITGFVVISLMLSLLIFIGEATRDAFDPRKAFQ"
FT   gene            complement(12301..13398)
FT                   /locus_tag="Oant_0013"
FT   CDS_pept        complement(12301..13398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0013"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bmb:BruAb1_0008 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12744"
FT                   /db_xref="GOA:A6WUU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU0"
FT                   /protein_id="ABS12744.1"
FT                   /translation="MGAYILRRLLLMIPTILGIMAISFAVVQFAPGGPVERVIAQLSGQ
FT                   GGDALDRLSGGGGDFGQSAVDSGSVNSKYRGAQGLDPQFIADLEKQFGFDKPPLERFGQ
FT                   MLWNYLRFDFGRSYFRDISVIDLIKEKMPVSISLGLWLTFLSYMISIPLGIRKAIKDGS
FT                   RFDTWTSAVIIVGYAIPSFLFAILLIVLFAGGSFFDWFPLRGLTSPDFAQMSFWGKIGD
FT                   YLWHMVLPVTALVLSAFATTTLLTKNSFLEEIRKQYVTTARAKGLTENQVLYRHVFRNA
FT                   MLIVIAGFPGAFISAFFTGSLLIETIFSLDGLGLLGYQSVINRDYPVVFANLFIFSLIG
FT                   LLVGLLSDLTYTWIDPRIDFDRRDV"
FT   sig_peptide     complement(13321..13398)
FT                   /locus_tag="Oant_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.880 at
FT                   residue 26"
FT   gene            complement(13505..15352)
FT                   /locus_tag="Oant_0014"
FT   CDS_pept        complement(13505..15352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0014"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bmb:BruAb1_0009 ABC transporter, periplasmic
FT                   substrate-binding protein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12745"
FT                   /db_xref="GOA:A6WUU1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU1"
FT                   /protein_id="ABS12745.1"
FT                   /translation="MTILRMNRRHFLGLSGSAAVAAFLPPRAFADIPTGKALHGLSAFG
FT                   DLKYGPDFPHFDYASPEAPKGGTFNFAPSSWVWNQNTDTFNTLNTFTFKGDAPPRMELT
FT                   FDTLMASALDEPDSVYGLIAESATLSKDRRSCTFKLRKEARFHDGSPIEAKDVLFTYAT
FT                   IKQKGHPTLRQYLAGVEKVEATGNREVRMRFVEGRGPNAILDAVAVPILSESWFKDRDF
FT                   EATTMEPVLGSGAYKVGNFAAGQFIEYERVEDYWAKDLPVQKGFNHFDRIRIEFFRDRQ
FT                   PQFEAFKKGSIDYREETVSKNWATAYDFPAIQQGKVIKRTFPKEKRPLMQAWALNQRRE
FT                   RFRDPRVREAIALCFDFEWTNENLFYKVYARSQSCFNGSDFQASGMPTPDELKVLERYR
FT                   GKLPDEVFSEAVLMPVSDGTGRDRAQFAQAIKLLEEAGFERKNGQFHDRDGSKFALEIL
FT                   SNSEAFTRVYNPFVQKLRAIGIDASLRLVDASQYQVRMQDFQFDMVGMALQFSPTPTQE
FT                   SLAGMLGSESAKVPGSYNLPGTEDPLIDALIADIGKVSTREELVATMRVLDRYLRIRRD
FT                   WIPNWTTANHLAAYWDRFGFKEPKPDYGFPVETLWWIKA"
FT   sig_peptide     complement(15260..15352)
FT                   /locus_tag="Oant_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(15366..17234)
FT                   /locus_tag="Oant_0015"
FT   CDS_pept        complement(15366..17234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0015"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bme:BMEI1934 periplasmic oligopeptide-binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12746"
FT                   /db_xref="GOA:A6WUU2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU2"
FT                   /protein_id="ABS12746.1"
FT                   /translation="MRAFWAGAFAVAMLASTVSIGRANDAEPQWRYSSSLLGEPKYPAD
FT                   FKHYDYVNPDAPKGGTLNMVAVGTFDSLNPFVVQGVAAAGLSDFGGGLLYDTLMTDSLD
FT                   QGSTQYPLIAEALQYPDDFSWVKFKLNPKAKWHDGQPITVDDVIWSFDVLKKQSPMYNK
FT                   YYGDVEKAEKTGEHEVKFTFSQKGNRELPQILGQLAVLPKHWWEGKDAQGKQRDITRPM
FT                   LEIPLGSSAYKIDSMTPGRSITWARVDDYWGKDLGVNVGRNNFDRLRYEYYFNEDATWE
FT                   AFKKGGQYDYRNENRAQRWAEQYNFPAVQRGDVVKASFPFHAAGRMQGYFLNTRRDKFK
FT                   DPKVRQALTYAFDFESMNRLLFFNQYKRINSYFAGNELELSGPPTPEEQAILETVKDSL
FT                   PADALTKEFKLPVYDTPQATRENLRTALKLFSEAGWTVQGNKLVDAKGNPFTIEFLGKD
FT                   PTDERIYNPFAASLRKIGINATVRIVDTAQYQARVNDFDYDVVTSVIPQSSSPGNEQRD
FT                   MWGSKAADFKGSRNYAGIKNPAIDKLIDHVIYAKDREELVASTHALDRALLWNYYVIPQ
FT                   WYSDHINVAYWNKFGMPEKQPDYLGIDPFSWWIDPAKEAKLKTGSE"
FT   sig_peptide     complement(17163..17234)
FT                   /locus_tag="Oant_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.758 at
FT                   residue 24"
FT   gene            complement(17381..18055)
FT                   /locus_tag="Oant_0016"
FT   CDS_pept        complement(17381..18055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0016"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bms:BR0039
FT                   cytochrome c, membrane-bound"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12747"
FT                   /db_xref="GOA:A6WUU3"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU3"
FT                   /protein_id="ABS12747.1"
FT                   /translation="MNSTRTNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFIIEA
FT                   AEASTGEGGAAPAKEEVSIATLLQSADPARGETVFKRCAACHTGEKGGANKVGPHLWDV
FT                   VNRPAASVEGFGYSAPMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNER
FT                   ADLIAYLRTLSDNPAPLPTADAAPAAGGDAKPAEGGEAKPAEGEKPAAGGEQKPAEPAP
FT                   AN"
FT   sig_peptide     complement(17972..18055)
FT                   /locus_tag="Oant_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.876 at
FT                   residue 28"
FT   gene            18302..19051
FT                   /locus_tag="Oant_0017"
FT   CDS_pept        18302..19051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0017"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase; KEGG: bmb:BruAb1_0038 KdsB,
FT                   3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12748"
FT                   /db_xref="GOA:A6WUU4"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WUU4"
FT                   /protein_id="ABS12748.1"
FT                   /translation="MLQTLKTLTLIPARMASTRLPNKPLADICGKPMIVHVADRAAAAK
FT                   LGRTVVATDSEEIFAIVTAHGHEAIMTREDHESGSDRIYEALMKVDPAGEFDAVVNVQG
FT                   DLPTIDPDIIRRALLPLEDGPADIATLGVEIEEESEKTNPSVVKIVGSPLAGNSRLRAL
FT                   YFTRATAPYGEGPLYHHIGLYAYRRSALERFVKLGPSPLEKREKLEQLRALEAGMRIDV
FT                   ELVRTVPLGVDTQADLDRARILVAQGI"
FT   gene            19091..19954
FT                   /locus_tag="Oant_0018"
FT   CDS_pept        19091..19954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0018"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: bmb:BruAb1_0037 PheA, prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12749"
FT                   /db_xref="GOA:A6WUU5"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU5"
FT                   /protein_id="ABS12749.1"
FT                   /translation="MKTNRISFQGEAGANSDTACRNMFPDMEPLPCPTFEDAFNAVETG
FT                   AADLAMIPIENTLAGRVADIHYLLPLADMHIIGEYFLPIHFQLMVLPGVKREEIKTVHS
FT                   HVHALGQCRNVIRQNGWKGVIAGDTAGAARLVADMKDRSMAALAPSLAAELYGLDILEE
FT                   NVEDSEDNVTRFVVLSKNKQWAQRPENGERIVTTFVFRVRNVPAALYKALGGFATNGIN
FT                   MTKLESYQIGGRFIATQFYADVEGHPEDANLQLALEELRFFTKEVRILGVYKGSDIRDT
FT                   HLLAAE"
FT   gene            complement(19955..20938)
FT                   /locus_tag="Oant_0019"
FT   CDS_pept        complement(19955..20938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0019"
FT                   /product="NADH pyrophosphatase-like protein"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: bms:BR0036
FT                   MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12750"
FT                   /db_xref="GOA:A6WUU6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU6"
FT                   /protein_id="ABS12750.1"
FT                   /translation="MRFKSPNNSEIDMTFRLYDLPEIEPSRSVGFSGNRIDRQSEKRQD
FT                   DSAFTALELPETRIMLLGGNRLLLDYADEKAPRALFRLGEAKDFAPDLHEPIFLGLQDG
FT                   APLVALTTPLDPETMEAPFRLQDYRSIYTEGLVSADMLGALAQAAALTAWHANHRFCGR
FT                   CGAKTDMRAGGAKRQCPNCGAEHFPRTDPVAIMLPVRGEKCILARSPHFAPGSYSCLAG
FT                   FIEHGETIEAAVRRESVEEMGLSIGRVAYHASQPWPFPYSLMIGCHAEVLSDDFTIDRS
FT                   ELEDGRWFSKAEVRTMLEGTHENGLRVPPSGAIATHLIKAWVYDAG"
FT   gene            complement(20987..21391)
FT                   /locus_tag="Oant_0020"
FT   CDS_pept        complement(20987..21391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0020"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bmb:BruAb1_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12751"
FT                   /db_xref="GOA:A6WUU7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU7"
FT                   /protein_id="ABS12751.1"
FT                   /translation="MEQFEVDKRLNADTFSVAKLGLCELRLMNDRRWPWLILVPRRPGL
FT                   AEIHDMTPLDQTMLTFETGIVAQALKTVTGCQKINTGALGNIVRQLHLHVIARNEGDAG
FT                   WPGPVWGFGTRETYDEKDARQLIADIRTAL"
FT   gene            21484..21589
FT                   /gene="ffs"
FT                   /locus_tag="Oant_R0001"
FT   misc_RNA        21484..21589
FT                   /gene="ffs"
FT                   /locus_tag="Oant_R0001"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            21700..23517
FT                   /locus_tag="Oant_0021"
FT   CDS_pept        21700..23517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0021"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bmb:BruAb1_0034 DnaX, DNA polymerase III,
FT                   gamma and tau subunits; TIGRFAM: DNA polymerase III,
FT                   subunits gamma and tau; PFAM: AAA ATPase central domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12752"
FT                   /db_xref="GOA:A6WUU8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUU8"
FT                   /protein_id="ABS12752.1"
FT                   /translation="MDTKSADGAYRVLARKYRPQNFNDLIGQEPMVRTLNNAFETGRIA
FT                   QAWMLTGVRGVGKTTTARILARALNYKTDTIDQPTIDLSVQGENCQAIMEGRHVDVIEM
FT                   DAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSNQAFNGLLKTLEEPPPHVKF
FT                   IFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEAEQIAVDDTSLAMIARAGE
FT                   GSARDSLSIFDQAIAHGAGTVTAEAVRSMLGLADRARIIDLFEMLMRGDVAGALTEFRA
FT                   QYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERVRGREFAQKLSVRVLSR
FT                   TWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIRSLDNGSVSAPRPQPGN
FT                   PRPNGGGGAPEARFAADAVGSSSMAPASGGPATAMRIVETPQPVQPSAAPQQFVENTPQ
FT                   PSVPVNSLHDVVALADKHRDMQFKILVKGCVRLASIAPGRLEIGLTDDAPKSLPSDISQ
FT                   RLLNWTGIRWVVTVARDVAGQTISEAETERRDNLVTDARADPDVAAILAAFPGAKITDV
FT                   RIAVPEQNDDEDIDLDAVVETPGAPSEDD"
FT   gene            23542..23865
FT                   /locus_tag="Oant_0022"
FT   CDS_pept        23542..23865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0022"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103; KEGG:
FT                   bmb:BruAb1_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12753"
FT                   /db_xref="GOA:A6WUU9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WUU9"
FT                   /protein_id="ABS12753.1"
FT                   /translation="MRDMMGMMKQAKELQAKMKAMQDEIATMEASASSGGGLVTITLSG
FT                   KGTLSALKIDPSLMKEEEVEILEDLIIAAHNDAKAKLEAAMAEKTQSLTAGLPIPPGFK
FT                   LPF"
FT   gene            23974..24579
FT                   /locus_tag="Oant_0023"
FT   CDS_pept        23974..24579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0023"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: RecR
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein; KEGG: bmb:BruAb1_0032 RecR, recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12754"
FT                   /db_xref="GOA:A6WUV0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WUV0"
FT                   /protein_id="ABS12754.1"
FT                   /translation="MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLVP
FT                   LGGAMQEAAEKVRICSCCGNVDTSDPCTICTDERRDPTTLIVVEDVSDLWALERAGTMN
FT                   VRYHVLGGRLSPLDGIGPDDLNIKGLVERVSTGEIKEVILAVNATVEGQTTAHYITDQL
FT                   SSFDVRVTRLAHGVPVGGELDYLDEGTLAAALRARTTL"
FT   gene            24596..25855
FT                   /locus_tag="Oant_0024"
FT   CDS_pept        24596..25855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0024"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein; KEGG:
FT                   bmb:BruAb1_0031 hypothetical transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12755"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV1"
FT                   /protein_id="ABS12755.1"
FT                   /translation="MAAGNWKHSLKIGLALLASLAISPAIAAPSKAQIESQYRNWLEKD
FT                   LWPEAKAAGVSRAVFDQAFAGVSINWKLPDLVIPGEKPSTPKEQKQAEFGAPGKYFNAK
FT                   TMGAVTSGGKARYGQYANLLKRIEQKYGVPGPILLAVWGRESGFGTVKIPYNAYEVLGT
FT                   KAFMATRKDMFRKELIAALEIASKGYINEAAMKSSWAGALGQPQFMPTSYLKHAVDFDG
FT                   DGKRDIWNSVPDTLASIANYLKLHGWRKGRDWGFEVSVPQNVSCSLEGPDQGKTIAEWA
FT                   KLGITRVNGKPFPANEMKGEGFLLMPAGRYGPAFVVSPNFYVLKDYNMSDLYALFIGHV
FT                   GDRIAYGAGDFSRGWGDVGSMYRSDIGAMQKRMQALGYDVGKPDGLPGFKTRRSIGLWQ
FT                   AKNGMASTCFPQPELLRQLR"
FT   sig_peptide     24596..24679
FT                   /locus_tag="Oant_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 28"
FT   gene            25982..26617
FT                   /locus_tag="Oant_0025"
FT   CDS_pept        25982..26617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BR0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12756"
FT                   /db_xref="GOA:A6WUV2"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV2"
FT                   /protein_id="ABS12756.1"
FT                   /translation="MNICLFLHLLIFLKVNMGNIDYISNSSEEFFHVRVLTGVVVSLCM
FT                   SRLLASVAGFIRHPKDKRYNKIQLLWTLNLIFWMMRWWWIILDLKESVVFNYYIYIMIV
FT                   FYSSLHFFIVFLITPDDIDEYSSFEEYFNRVIKIIYIICIIISSDCFLLFDFDTKSLFS
FT                   FLFYSSIFLFKSSAYIIAIMYKGMQFQQLFITILLVFSAVDILLEFLI"
FT   gene            complement(26656..27543)
FT                   /locus_tag="Oant_0026"
FT   CDS_pept        complement(26656..27543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0026"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bmb:BruAb1_0029 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12757"
FT                   /db_xref="GOA:A6WUV3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV3"
FT                   /protein_id="ABS12757.1"
FT                   /translation="MTLEQLRIFIEVAEREHLTRASEALHLTPSAVSSAIRTMEDRYGA
FT                   TLFNRIGRRIELTGDGRMFLDEARATFARARSAERMLSELGGGKRGILAIHASQTIASY
FT                   WLPSFLARFHAAYPLIDVRLTLGNTESVTQATQEGVADIGLVEGAVQAPSLSISKVASD
FT                   QLILVARPDHDWGTGGKLTWDRLFEGKWILREQGSGTRSVFEDAMRASGYNPARLHVAL
FT                   ELPSNEAICSAVRSGDYVTAISELVAAPHLAAGTLVKADFALPQRQFLMLQHNDRYRTK
FT                   ATRIFADMIGNTRK"
FT   gene            27693..28733
FT                   /locus_tag="Oant_0027"
FT   CDS_pept        27693..28733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0027"
FT                   /product="conserved hypothetical protein 698"
FT                   /note="PFAM: conserved hypothetical protein 698; KEGG:
FT                   bme:BMEI1914 hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12758"
FT                   /db_xref="GOA:A6WUV4"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV4"
FT                   /protein_id="ABS12758.1"
FT                   /translation="MQTVRFEMLKMTYSKIQNILPGLGLSVAVAIAAIGLEKVEEHYAG
FT                   RAWLEALVIAILLGTVVRTFLRPGKHFNKGIGFSAKLLLEIAVVLLGASISASAVVAAG
FT                   SGLIFGIAGVVVLAITLSYGIGRLLKLPHRMAVLVACGNSICGNSAIAATAPVIGAGSE
FT                   DVAASIAFTAILGVVVVLLLPLLVPFLGLSHTQYGVLAGLTVYAVPQVLAATAPVATIS
FT                   VQLGTLVKLVRVLMLGPVILALALLAGNKDANAKPGFFQLVPWFILGFLGMMALHSLHL
FT                   IPESILPGIQYASTILTIISMAALGLGVDIRSVASAGGRVTLTAILSLVALGTISLGLI
FT                   HILSVA"
FT   gene            complement(28782..29528)
FT                   /locus_tag="Oant_0028"
FT   CDS_pept        complement(28782..29528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12759"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV5"
FT                   /protein_id="ABS12759.1"
FT                   /translation="MISRTTTLTAMLLSTALLSASFAVPSFAESAAKPNAPATESTKAA
FT                   QQDAIKKLDAISGDGLAAVRGVTLARLAIFQGTPDQAKVILSTVKDDLDKAQKDTPSLL
FT                   DKMKAAGAPADEVAEVQSGTLPVDMEVGVVDDYKLTPEKAAHLKKANEHIQHGRKKEAQ
FT                   DELKLADVDLVITETTANLPAIDKDVDLALEQLGNGKYYDANLTLIKAEHVVTIRSNMS
FT                   VDDKKDASKTANAPADAKPTDAAKKS"
FT   sig_peptide     complement(29442..29528)
FT                   /locus_tag="Oant_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 29"
FT   gene            complement(29804..31504)
FT                   /locus_tag="Oant_0029"
FT   CDS_pept        complement(29804..31504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0029"
FT                   /product="ribosomal protein S1"
FT                   /note="TIGRFAM: ribosomal protein S1; PFAM: RNA binding S1
FT                   domain protein; KEGG: bms:BR0027 ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12760"
FT                   /db_xref="GOA:A6WUV6"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV6"
FT                   /protein_id="ABS12760.1"
FT                   /translation="MSEFNPSLADFESLLAESFATNDLAEGYVVKGRIVAIEKDMAIID
FT                   AGLKVEGRVPLKEFGAKGKDGTLKPGDEVEVYVERIENALGEAVLSREKARREESWVKL
FT                   EQKFANGERVDGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVTPLMHVPQPFEIL
FT                   KMDKRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVEGVVKNITDYGAFVDLGGIDG
FT                   LLHVTDMAWRRVNHPSEILTIGQTVKVQIIRINQETHRISLGMKQLESDPWDGIGAKYP
FT                   IGKKITGTVTNITDYGAFVEIEPGIEGLIHVSEMSWTKKNVHPGKILSTTQEVEVVVLE
FT                   VDPVKRRISLGLKQTLDNPWTTFAQKYPVGTVVEGEVKNKTEFGLFIGLDGDVDGMVHL
FT                   SDLDWNRPGEQVIEEYNKGEVVKAVVLDVDIDKERISLGIKQLSGDKVGEAAASGELRK
FT                   NAVVTCEVTAVTDGGLEVRLVDHDLESFIKRSDLSRDRDEQRPERFTVGQKLDARVIAF
FT                   DKKTRKLQVSIKALEIAEEKEAVAQYGSSDSGASLGDILGAALKKQEKN"
FT   gene            complement(31720..32364)
FT                   /locus_tag="Oant_0030"
FT   CDS_pept        complement(31720..32364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0030"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="TIGRFAM: cytidylate kinase; PFAM: cytidylate kinase
FT                   region; KEGG: bme:BMEI1916 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12761"
FT                   /db_xref="GOA:A6WUV7"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV7"
FT                   /protein_id="ABS12761.1"
FT                   /translation="MTPFIVAIDGPAASGKGTLARRIAIHYGMPHLDTGLTYRAVAKAL
FT                   IDKGLPLDDEAVAADAALNLDLREMDKAVLSAHAIGEAASKVAVMPKVRRALVEAQRNF
FT                   ANALPSSVLDGRDIGTVVCPDAAIKLFVTASPEVRAERRFEEIVARGEKADFAEILADL
FT                   RKRDERDTNRIDSPLRPAEDAHLLDTSEMSIEAAFLAAKKLIDHALAQHRG"
FT   gene            complement(32361..33713)
FT                   /locus_tag="Oant_0031"
FT   CDS_pept        complement(32361..33713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0031"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   bms:BR0025 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12762"
FT                   /db_xref="GOA:A6WUV8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WUV8"
FT                   /protein_id="ABS12762.1"
FT                   /translation="MSHSAPPKPATARRSEALTGEIRIPGDKSISHRSFMFGGLASGET
FT                   RITGLLEGEDVINTGRAMQAMGAKIRKDGDAWIINGVGNGCLLQPEAALDFGNAGTGAR
FT                   LTMGLVGTYDMRTSFIGDASLSKRPMGRVLNPLREMGVQVEAAEGDRMPLTLIGPKTAN
FT                   PITYRVPMASAQVKSAVLLAGLNTPGVTTVIEPVMTRDHTEKMLQGFGADLSVETDKDG
FT                   VRHIRITGQGKLIGQTIDVPGDPSSTAFPLVAALLVEGSDVTIRNVLMNPTRTGLILTL
FT                   QEMGADIEVLNARLAGGEDVADLRVKASKLKGVVVPPERAPSMIDEYPVLAIAAAFAEG
FT                   ETVMDGLDELRVKESDRLAAVARGLEANGVDCTEGEMSLTVRGRPDGKGLGGGTVATHL
FT                   DHRIAMSFLVMGLASEKPVTVDDSTMIATSFPEFMDMMPGLGAKIELSDAR"
FT   gene            34027..34446
FT                   /locus_tag="Oant_0032"
FT   CDS_pept        34027..34446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12763"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUV9"
FT                   /protein_id="ABS12763.1"
FT                   /translation="MSPCELTRLDVAKAELGTKRIDPETGKKFYDLNRDPIVSPYTGIS
FT                   YPRSYFDSTLESRVVEEETEEEELDTALEKPEFVSLEDADDETKGSGDDLPDMDDDDVD
FT                   LGDDDEDTFLEEEEDEDDDMSGILGGGVGGEDEEG"
FT   gene            34671..34746
FT                   /locus_tag="Oant_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            34671..34746
FT                   /locus_tag="Oant_R0002"
FT                   /product="tRNA-Ala"
FT   gene            34830..35480
FT                   /locus_tag="Oant_0033"
FT   CDS_pept        34830..35480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0033"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bja:blr5350 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12764"
FT                   /db_xref="GOA:A6WUW0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW0"
FT                   /protein_id="ABS12764.1"
FT                   /translation="MSFPMTEMILATFDWVPKMPRGFVRDLRVRWALEEAGLPYRVEGV
FT                   PFKNRGPEHFTHQPFGQVPWLIDGDMSVFESGAILLHIAEKSDALLPPDPRARNEVIQW
FT                   LFAALNSVEMAALPLALYKFTGDEEQTPGRQLMDSFLAGRLAHMEQALSGREWLTDQFS
FT                   VADILMADVLRLVDHFDGLAQHPVCRAYVGRATARPAFQKAFTDQMEHFAAAD"
FT   gene            35591..36727
FT                   /locus_tag="Oant_0034"
FT   CDS_pept        35591..36727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0034"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bmb:BruAb1_0023
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12765"
FT                   /db_xref="GOA:A6WUW1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW1"
FT                   /protein_id="ABS12765.1"
FT                   /translation="MKRLQDFDGLRFLLCIGIAIFHFSFRVPVNDEILNSFILTFAYFT
FT                   DVFFIVSGLFLARRQNYLWSWPRYVAFVGKRLARIYPLHVVTFSCFALLSVLTAAGILH
FT                   PLVEPSMSWRDGLTQLLLIHNWGLGRTLSYNYVSWSLSALFAMYLAFPLFDMLCRRFGS
FT                   WVLVGVMAAAVGGDYLAQQLGVLSLTRIQLSDAGVLRALPSFVFGMWLARREHPPMPAS
FT                   AIKALLATCLIVFLFYHPANGPDEPHTLEGPWRLAFLYAGVYVLYAASTRGIYTPLQWR
FT                   GFTRLSRYSFGIFILHPAVGMVFFKAAPERWGEATAGAVLLIAAGVLASVLTAIASYHL
FT                   FENPVHRWLVKRIDAWVSRSEGSSGFSGSTRDGLPVSR"
FT   gene            complement(36750..37604)
FT                   /locus_tag="Oant_0035"
FT   CDS_pept        complement(36750..37604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0035"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rle:RL1692 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12766"
FT                   /db_xref="GOA:A6WUW2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WUW2"
FT                   /protein_id="ABS12766.1"
FT                   /translation="MVAACSAYAAVNVATQWAGTRTGIPSVIIAFWQYVIALVLTLPLL
FT                   VRDGTRALRTSHFGLHVMRVALAAAGVQVWIYALTHVPIWQVVALSMTSPFFVILCARL
FT                   FLQEKVTPARLLTTFTGFIGALIIIAPWSDSYTVYSLLPILAAALWAGYSVMTKYLTRF
FT                   EKPASISAYMLVLLTPINAALWLASGLSMSAITAPDVEIWSILIVIGAFTALAQYFQTA
FT                   AYSIADAVYLQPFDDLRLPINVIFGWIVFAAAPSINFWPGAALIIGASLYLMRQDSGTS
FT                   RTA"
FT   misc_binding    complement(37849..38001)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 110.29"
FT   gene            38261..40249
FT                   /locus_tag="Oant_0036"
FT   CDS_pept        38261..40249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0036"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: bms:BR0021
FT                   acetoacetyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12767"
FT                   /db_xref="GOA:A6WUW3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW3"
FT                   /protein_id="ABS12767.1"
FT                   /translation="MSTNAVPTQFSHDHPLWQPDAGRIAASNLEQFRIRAEQRTGLSLP
FT                   DYAALHRWSVEDRGGFWQLVWDFCEVIGERGKTALVDKGHMRDAKFFPEARLNFAENLL
FT                   RHEGGEEAIVFRGEDKIERRLTWDDLHALVSKLQQFMLAEGVQPGDRVAGMMPNMPEAV
FT                   ALMLAASSIGAVWSSCSPDFGIQGVLDRFGQIEPKLFFACDGYWYNGKRIEVADKVAEV
FT                   TAKLPGLKRAVIVTYLGEAEAVADRAEKGIALDVALEPFKAKDVEFTRLPFDHPLCILF
FT                   SSGTTGIPKCIVHRAGGVLLQHLKEHRLHADIRDGDRFFYFTTCGWMMWNWLASGIASG
FT                   ATLLLYDGSPFYPDGNVLFDYAAAEGMTYFGTSAKFIDAVLKAGLKPGETHDLSALRTV
FT                   SSTGSPLSPEGFAFVYEAIKPDVHLASISGGTDIVSCFVLGVPTEPVWLGEIQGAGLGM
FT                   AVDVWNDDGKPVRREKGELVCTKAFPCMPLQFWNDPEGAKYQAAYFERFDNIWCHGDFA
FT                   EWTEHDGIVIHGRSDATLNPGGVRIGTAEIYNQVEQMPEIAEALCIGQDWDNDVRVVLF
FT                   VRLAEGVALDDDLKARIKTKIRTGATPRHVPAKIVAVRDIPRTKSGKIVELAVRDIVHG
FT                   RDVKNREALANPEALELYRDIAELHED"
FT   gene            40436..41599
FT                   /locus_tag="Oant_0037"
FT   CDS_pept        40436..41599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0037"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bmb:BruAb1_0020
FT                   Ivd, isovaleryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12768"
FT                   /db_xref="GOA:A6WUW4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW4"
FT                   /protein_id="ABS12768.1"
FT                   /translation="MFASGMNFGLGEEIEALRDTVRRFAESRIAPLAAETDRNNAFPMH
FT                   LWRELGELGVLGITAPEEYGGAGMGYLAHCIAMEEISRASASIGLSYGAHSNLCVNQIK
FT                   RNGSPEQRAKYLPKLISGEHVGALAMSEPGAGSDVVSMKLAAEKRGDRYVLNGNKMWIT
FT                   NGPDADVLVVYAKTDPSAGPRGISAFIVEKGFKGFSTAQKLDKLGMRGSNTCELVFEDC
FT                   EVPAENLLGEVGKGVNVLMSGLDYERVVLAGGPLGIMAACLDVVVPYVHERKQFDQPIG
FT                   EFQLMQGKLADMYVTFNASRAYTYAVAAACDRGETSRKDAAGCILYTAENATQMALQAI
FT                   QSLGGNGYINDYPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFQETR"
FT   gene            41599..43206
FT                   /locus_tag="Oant_0038"
FT   CDS_pept        41599..43206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0038"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: bms:BR0019
FT                   carboxyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12769"
FT                   /db_xref="GOA:A6WUW5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW5"
FT                   /protein_id="ABS12769.1"
FT                   /translation="MAVLKSEISTRSASFEANRKAMLAAIDVVGEASQIALDGGGEKAR
FT                   ERHVARGKLLPRERVAQLLDPGAPFLEVGLTAAHGMYGGAAPSGGIITGIGRVSGRDCM
FT                   IVCNDATVKGGTYYPVTVKKHLRAQEIAGENRLPCIYLVDSGGANLPNQDEVFPDRDHF
FT                   GRIFYNQAQMSAAGIPQVAVVMGSCTAGGAYVPAMSDETVIVRNQGTIFLAGPPLVKAA
FT                   TGEVVTAEDLGGGDVHTRLSGVADHLANDDAHALQIARAITANLNSKKREFIPRGDSAA
FT                   PLYDPEEILGVVSADTRIPYDVREVITRLVDGSDFDEFKARYGTTLVCGFASVYGMPVG
FT                   IIANNGVLFSEAALKGAHFIELCCQRNIPLVFLQNITGFMVGRKYEAEGIAKHGAKLVT
FT                   AVATANVPKITMLIGASYGAGNYGMAGRAYSPRFLWTWPNSRIAVMGGEQAAGVLATVK
FT                   RDGIERTGGTWSADEEAEFKRPTLEMFERQSHPLYASARLWDDGIVDPRKSREVLGLSL
FT                   SATLNAPIEPTRFGLFRM"
FT   gene            43219..45186
FT                   /locus_tag="Oant_0039"
FT   CDS_pept        43219..45186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0039"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: bmb:BruAb1_0018
FT                   biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12770"
FT                   /db_xref="GOA:A6WUW6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW6"
FT                   /protein_id="ABS12770.1"
FT                   /translation="MFKKILIANRGEIACRVIRTARELGIATVAIYSDADANALHVEMA
FT                   DEAVRVGPAISAQSYLNVEAIIKAAKETGAETIHPGYGFLSENAGFVDAVEAAGLVFIG
FT                   PSAKAIRAMGLKDAAKALMEKAGVPVVPGYHGDNQDGAFLKSEADRITYPVLIKARAGG
FT                   GGKGMRRVDQSVDFAAALDSARREAEASFGDSAVLVEKYMTKPRHIEVQVFGDNHGNAV
FT                   HLFERDCSLQRRHQKVIEEAPAPGMTPEMRAAMGEAAVKAALAIGYCGAGTVEFIADVS
FT                   EGLRPDRFFFMEMNTRLQVEHPVTEAITGLDLVEWQLRVASGEVLPKRQDELSIDGWAF
FT                   EVRLYAEDPARDFLPATGKLALFAPPENARVDSGVRTGDTITPFYDPMIAKIIAHGATR
FT                   DEALNRLDASLNKTRIAGLVTNRQFLSALCDLKAFRTGDVDTGLIARETATLFADKQPS
FT                   DIAFALAALGALDLLDAPAKDDPWSSLRGFRLWGEASRSALIDHHGERHTVSFTTMGDR
FT                   HFGFAFGTIEIRFHENGLVRFAVDGCVSEASVVRIGHDVTVQLEGRDTIFHHVQSVGAE
FT                   EDASSESRILSPMPGLVRLVSVVEGASVAKGDPLVTMEAMKMELSLTAPRDGKVASVTV
FT                   VAGDQVNEGILLVELEEEHG"
FT   gene            45179..46042
FT                   /locus_tag="Oant_0040"
FT   CDS_pept        45179..46042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0040"
FT                   /product="Hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bmb:BruAb1_0017 3-hydroxy 3-methylglutarate-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12771"
FT                   /db_xref="GOA:A6WUW7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW7"
FT                   /protein_id="ABS12771.1"
FT                   /translation="MAEHVEIVEMAARDGLQNEKRFVPTADKIALIDRLSDCGYARIEA
FT                   TSFVSPKWVPQLADAAEVMAGIRRADGVRYSVLVPNMKGYEAAAAANVDEIAVFISASE
FT                   GFSKANINCTIAESIERLSPVIGAAINDGLAIRGYVSCVVECPYDGPVAPQAVADVTEQ
FT                   LFSLGCHEVSLGDTIGRGTPDKIAAMLDAVLAIAPAHSLAGHYHDTGGRALDNIRVSLE
FT                   KGLRVFDASVGGLGGCPFAPGAKGNVDTVSVVEMLHGLGFETGLNLDKLKSAALFAQAL
FT                   RQDKAA"
FT   gene            46039..46833
FT                   /locus_tag="Oant_0041"
FT   CDS_pept        46039..46833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0041"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bms:BR0016 enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12772"
FT                   /db_xref="GOA:A6WUW8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW8"
FT                   /protein_id="ABS12772.1"
FT                   /translation="MKAFDTIQIAIDQRGVATLTLNRPEQHNALSGRMIDELLTATLHL
FT                   ADDDAVRLVVLTGNGTSFCAGGDLGWMQEQVKATRAQRIEEARKLALMLKALRDLPKPL
FT                   IGRINGQAYGGGVGLISVCDAAISVSGARFGLTETKLGLIPATISPYVVARIGQANALR
FT                   TFTSARLFDAEEARRIGLVHDVVEAERLDAAVEAEIKPYFATAPAAVAASKRLVHALGA
FT                   PIDEAVIEMTLTRLADTWETPEAAEGIAAFFAKKSPSWKGGN"
FT   gene            47159..48265
FT                   /locus_tag="Oant_0042"
FT   CDS_pept        47159..48265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0042"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bms:BR0014 branched-chain amino acid ABC transporter,
FT                   perisplasmic amino acid-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12773"
FT                   /db_xref="GOA:A6WUW9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUW9"
FT                   /protein_id="ABS12773.1"
FT                   /translation="MNLKLLSSVAFAATLGFASAAYADITIGVVAPLTGPVAAFGDQVK
FT                   KGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGPVTTGVA
FT                   IPVSDVFSENGVLMVTPTATGPDLTARNLENVFRTCGRDDQQAEVMADYVLKNFKDKKV
FT                   AVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGTDVVYFG
FT                   GYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPASK
FT                   DAIEALKAKGIPAEAFTMNAYAAVEVIKAGIERADSTDDSAAVAKALHDGKPIETAIGT
FT                   LTYGANGDLSSPSFDIFKWDDGKIVGLE"
FT   sig_peptide     47159..47230
FT                   /locus_tag="Oant_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            complement(48336..48929)
FT                   /locus_tag="Oant_0043"
FT   CDS_pept        complement(48336..48929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0043"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: atc:AGR_C_2266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12774"
FT                   /db_xref="GOA:A6WUX0"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX0"
FT                   /protein_id="ABS12774.1"
FT                   /translation="MSFFRKYVDWSFTYARMAGLGLLVGSSVMGGYLYTLQYKGNVHTI
FT                   IDGQAYRSNQPDPARIASLQKLYGIKTIINLRGPEPGSKWYDEEIATAKTLGIKHADFE
FT                   MSSRRELSPAQTRQLIALMQNAEKPVLIHCKSGADRTGLAAALYVAAVAKGSEGKAERQ
FT                   MSIAYGHFGFPLSPTYAMEKTFEAIEAELGYTGS"
FT   gene            49232..49432
FT                   /locus_tag="Oant_0044"
FT   CDS_pept        49232..49432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12775"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX1"
FT                   /protein_id="ABS12775.1"
FT                   /translation="MQRYRFDDKRILIEAIVELLNRGVEPDELDLVLSRIGPVDLDLMR
FT                   QCLIEVWNYNHPDVAETPMAA"
FT   gene            50115..50423
FT                   /locus_tag="Oant_0045"
FT   CDS_pept        50115..50423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0045"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: atc:AGR_C_1419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12776"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX2"
FT                   /protein_id="ABS12776.1"
FT                   /translation="MIRHIVLVKFRSELGAAQIEEKLQAVVALKDKIGGILSITAGENN
FT                   SPENLEKGFRHGFVVDFTDSAARNAYLPHPEHAKVGKSLVEAAEGGIEGILVFDYAF"
FT   gene            complement(50420..51379)
FT                   /locus_tag="Oant_0046"
FT   CDS_pept        complement(50420..51379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12777"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX3"
FT                   /protein_id="ABS12777.1"
FT                   /translation="MIFAEMPLDEAEGAILGYAMMAGALTLRKGTVLDVLNLALLREAG
FT                   ISSVLAARLEKGDIGEDEAALAIGRMLISGEVEIGSPTTGRVNLHARKNGVFLVDADRI
FT                   DAVNAHDARISIATLRNHVRVEAGQMVATVKIIPFAVPGTLLRDIGLDARPALRVHPFN
FT                   GARIGLIQSRLPSIRETVLEKTRELMGKRTTRNGGTLVCEKRVAHDQVALAAAIAEVSR
FT                   ACDIIVIFSASAVADEADIVPQSIRMSGGEILRIGMPVDPGNLLVLGRHDGKYIVAAPG
FT                   SARSARENSLDWVLDRLMAGITLSADDLSRMGVGGLVL"
FT   gene            51602..51844
FT                   /locus_tag="Oant_0047"
FT   CDS_pept        51602..51844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12778"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX4"
FT                   /protein_id="ABS12778.1"
FT                   /translation="MAVFILQTLSFGPIRSAAPDNWRPIQTAGQDIDPLRGPMDLLHLC
FT                   IAQNMARISDLAGLFRQNARFWARHYDPAQFSSGT"
FT   gene            51957..52964
FT                   /locus_tag="Oant_0048"
FT   CDS_pept        51957..52964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0048"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; COX aromatic rich domain
FT                   protein; KEGG: bmb:BruAb1_0042 CyoA, ubiquinol oxidase,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12779"
FT                   /db_xref="GOA:A6WUX5"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX5"
FT                   /protein_id="ABS12779.1"
FT                   /translation="MKHGTPRTIVSFAVLALTAFLAGCENQVLLSPKGEIGMAERDLML
FT                   FATGIMLLVVLPVIFMTLYFAWKYRASNEKADYQPDWHHSTKIELAVWLIPLAIIVVLG
FT                   SVTWVATHKLDPYRPLESNAKPINVEVVALDWKWLFIYPDQGIATVNEMAMPVDVPVNF
FT                   KLTSSNIMNSFFIPQLGSQVYTMPSMQTKLHLIANHAGEFDGISANYSGQGFAQMRFKA
FT                   HAYNQADFDKWVAEVKAKANGEELSRDRYASLVQPSEKVPPQFFTYNDQALFHNIVNRC
FT                   WDGKSVCLDDEMHRQQMIREARANLRKSSPVDFSQWASDIICAVQPQRLSQLEN"
FT   sig_peptide     51957..52028
FT                   /locus_tag="Oant_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.790 at
FT                   residue 24"
FT   gene            53094..55073
FT                   /locus_tag="Oant_0049"
FT   CDS_pept        53094..55073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0049"
FT                   /product="Cytochrome o ubiquinol oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: Cytochrome o ubiquinol oxidase subunit I;
FT                   PFAM: cytochrome c oxidase subunit I; KEGG: bme:BMEI1900
FT                   cytochrome O ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12780"
FT                   /db_xref="GOA:A6WUX6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX6"
FT                   /protein_id="ABS12780.1"
FT                   /translation="MFGKLTLEAIPYHEPIIMVTLAAVAGGALAILAAITYYRKWAPLW
FT                   NDWLTSVDHKRIGVMYIILALVMLFRGFSDAVMMRAQQAIASGANEGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFIVGLMNFAVPLQIGARDVAFPYLNSLSFWLTVAGAILINISLGVG
FT                   EFAKTGWLAYPPLSGKEFSPDVGVDYYIWALQISGMGTLLSGVNLITTIIKMRAPGMGM
FT                   MQVPVFTWTALCSNVLIVAAFPILTVTLALLSLDRYLDFHFFTNDAGGNPMMYVNLIWI
FT                   WGHPEVYILVLPCFGIFSEIVATFSGKRLFGYKSMVYATVAITVLSFLVWVHHFFTMGG
FT                   GANVNAFFGVATMIISIPTGAKVFNWLFTMYKGRVRMETPVMWTIGFMCTFVIGGMTGV
FT                   LLAVPPADFVLHNSVFLIAHFHNVIISGVLFGCFAGLVYWWPKAFGFKLNERLGKNAFW
FT                   CWLVGFILAFMPLYVLGLMGMTRRLNHTENPAWHIYLIIAAIGVAIILCGIVFQVLQIA
FT                   VSIRDREKLRDNNGDSWGTGRTLEWSLASPPAFYNFAEVPHVRDHDGWWDMKQNGYVRR
FT                   TEKFARIHMPKNTGTGFIIGILNIPLGFALVWHIWWLAIASAVAVLAVAIAHSFNNDRD
FT                   FYVSAEEVQEVEDLRTRQLTAQEA"
FT   gene            55079..55708
FT                   /locus_tag="Oant_0050"
FT   CDS_pept        55079..55708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0050"
FT                   /product="Cytochrome o ubiquinol oxidase subunit III"
FT                   /note="TIGRFAM: Cytochrome o ubiquinol oxidase subunit III;
FT                   PFAM: cytochrome c oxidase subunit III; KEGG: bms:BR0044
FT                   ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12781"
FT                   /db_xref="GOA:A6WUX7"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX7"
FT                   /protein_id="ABS12781.1"
FT                   /translation="MSASISTTAPFTGGNEHPAHEDHHDAGSTTLVGFWIYLMSDCVLF
FT                   SGLFATYAVLAHQFAGGPTGRELFDLNFVLIETMLLLVSSLTYGLATLSMFKKNRAGLL
FT                   FWLGVTFLLGAAFLAMEVYEFNHLIHEGAGPGRSAFLSAFFALVGTHGLHITSGLIWIL
FT                   VLSAQLLRDGLTEKNQTRVMCLSLFWHFLDIIWIGVFTLVYLLGVL"
FT   gene            55708..56076
FT                   /locus_tag="Oant_0051"
FT   CDS_pept        55708..56076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0051"
FT                   /product="Cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: Cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG:
FT                   bmb:BruAb1_0045 QoxD, ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12782"
FT                   /db_xref="GOA:A6WUX8"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX8"
FT                   /protein_id="ABS12782.1"
FT                   /translation="MSSAHETHDHGASHGSLKTYLIGFVLAVVLTVVPFMLAMNGYFTP
FT                   GTTAAIVLGIAVVQILVHLVYFLHLDPKSEGGWNILALIFTVIILAIVLAGSIWVMHHL
FT                   DTNMMPMYMSPEDVRNLP"
FT   gene            56593..57300
FT                   /locus_tag="Oant_0052"
FT   CDS_pept        56593..57300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0052"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="PFAM: protein of unknown function DUF1058; SH3 type
FT                   3 domain protein; SMART: SH3 domain protein; KEGG:
FT                   bms:BR0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12783"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUX9"
FT                   /protein_id="ABS12783.1"
FT                   /translation="MSLFKGMLTNNRILGAAVIAATLFTPAIASAATAYVSASVNVRSG
FT                   PGSNYGRLAALPAGATVNAGSCRNGWCQIYNGSRVGWVSARYVRFGAYSGPAYAAPSST
FT                   TVIVNNDGYDDGFGLGLGIGWATGGYWGPGWGGGWGPGWRGGPNYVNGCIGRNCQSNRG
FT                   GWNPRWGHGPRWNGGGNWGGRGWPQGQIRRNWGPGPVMSPTRFGGFNRGFGGGGMGGGG
FT                   FHFGNMRPMHAGR"
FT   sig_peptide     56593..56688
FT                   /locus_tag="Oant_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.903 at
FT                   residue 32"
FT   gene            57594..59609
FT                   /locus_tag="Oant_0053"
FT   CDS_pept        57594..59609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0053"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: bms:BR0048 putative
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12784"
FT                   /db_xref="GOA:A6WUY0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY0"
FT                   /protein_id="ABS12784.1"
FT                   /translation="MNGTPPGDRIDRNRTVARMTWSNRTIQGRGIAVLLLAAQFSSFIV
FT                   SPALAFEIFGVRLWGEDKKEDPDIIDPKTYSVEVTTTGDRKNADGTEADLKSTIEGASG
FT                   LVSDAERPASGSAGLLAKARGDYRRILAALYGEGRYGGTISIQVDGREANDIPPDAEIP
FT                   NDAKVAISVDPGPQFLFSRTAISNIAPPPVDKRDHVQSPEDAGFAPGQVARSGTVIKAE
FT                   RLAVEAWRQQGYAKARVTDEDIVADHADNRVSADVSLDPGQKAHYGPVSVVGTARMDPQ
FT                   FVAWMTGLKEGQEYDPDDIEKAKKRLGRMEVFRAMSFEEAEKIEPDGSLPMTLNVQERK
FT                   PRRFGFGAEYSTIDGFGLTGYWMHRNLFGRGERLRFDAKVSGIGGTQDNSFDPKNFTYL
FT                   LGTSFTKPGVYTPDTDFVASLDAKREVLDAYTETSVNAKTGFTQIFSDELSGALYAKAS
FT                   QGHFDDDVFGSRSFTTAGLEGNLLYDSRNNKPDPSSGFYLEGNIQPFYEFQYGNFATRF
FT                   TAEGRTYYGFGEKDRVILAGRLKFGSIVGASIEDLPPSQLFLAGGGGSVRGYGYRNIGV
FT                   SAGNGEIIGGRSLVEANGEVRTRITDSIGAVAFVDAGYVGEKSFPDFSEQMRVGVGGGL
FT                   RYLTGLGPIRLDVAVPLNRRSGDPSYGLYVGIGQAF"
FT   sig_peptide     57594..57746
FT                   /locus_tag="Oant_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.784 at
FT                   residue 51"
FT   gene            59606..64342
FT                   /locus_tag="Oant_0054"
FT   CDS_pept        59606..64342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0054"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   bmb:BruAb1_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12785"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY1"
FT                   /protein_id="ABS12785.1"
FT                   /translation="MTRFLAIIAFVAFAVTAVIFGWPEQQKQLQAQAQVPAQAQDQASG
FT                   QEQAEAPAEEEKSYFLSFVESQLSAPNRRISISGISGVLSSEATVGSITIADREGVWLR
FT                   IENAKLNWSRTALLVGRLSIQSLAAERIDIIRKPLPDNSLPSPESSTFSLPELPISISL
FT                   DQLAIARLHFGPDIFGLESEVSANGSLSLADGSLDSNFDIKRLDGPGGNFALRAAYANS
FT                   DQKVDLDLKVSEPANGIVANLLNIDGRPPVDLTLKGAGPLDELKVDLALDTNGSRTLTG
FT                   EFALNRQGQAPDGGRVFSARFNGPIAVLVPPVFRDFFGAETVLSADGFLKDAGGFRLDD
FT                   LALNSAALKLKASAETGNDRFLNKLRIDASIADESKGRVLLPVKGAETYIDNAKFQVAY
FT                   GDRPTNDWTGTLAIAGLKNATISADSIALDMGGVAENLSDAANRHITFKVNGGMDGISA
FT                   ERAEIAEALGSKIALAIDGAWRAGSPVELAQANIAGNGLSLDLKGNIDDFAFNGDIAAK
FT                   IASLAPFGALADRDLAGSIDVNAKGIVRPVSGAFQLDLNGTAQNMRTGTEAVDRILDGA
FT                   VNLSGALGRSSEGFSARDFRIGNELSEITANGSFASDKASFDFGVMLSDLKLLSDQASG
FT                   RMTVKGSARGDDKLIALALRADAPEGTLAGRKLSEGGLDFNAMLDGNAKTGAALSGKLA
FT                   GSAFLNGQRVDLGTLIDIVNDEKRLTDLVFNAGGAHLSGNVTQTAKGLLTGALKLDAPD
FT                   ISTAAALALAEATGAANADITLDANDGRQNASVTANAKDIKVNGNRITSADIALTAKDL
FT                   FGVPVVDGNAAARDIMVGTFGIDSFDAKANATGSKTDFTANTKLKIGTVASAAGSLEPK
FT                   NGGFELGLASAHVKQGTLSANLAAPATISMKGEEISFGDIIINTGADASAGQVKVNGVV
FT                   DGRLDLSVALSNLPLALANTFKPELGLGGTVNGTARITGTKEAPNVAFDMAARGVTAAE
FT                   LKKQGIAALNADAKGTSANNRLNVDAHVTGGGGIDVRANGGVPLSKGDLAIDVNLANLP
FT                   LTALNGAVKGQDLAGNVTGTARVTGPLTNPAAIFNLRGTGLAAKPLRDNGLAPLTLQAA
FT                   GSYAAMAIDFSSLTVDGPRGLNVTANGKVPFSGQGLGVNVNGSIPLALANRFLADRGAQ
FT                   VNGTLTLTASVSGGFNRPQLRGMFSTNGATFVDPDTNVRLNNINVMGSLDGETVTLRQV
FT                   NAALGSGGSVSASGTISTNAEASFPANIEIKLNRARYADGKLVVATVDGGITISGPLMR
FT                   DPLISGRIDVDRAEISVPENLGGGAAYVPVRHKNTPKNVQVTLDRAKVETRRSKVPTPT
FT                   ARPTVPRLDVVINAPNQIFVRGRGLDTELGGRLRLTGPVTDIKPVGAFDMIRGRIGILG
FT                   QRITFDEGNVTLVGDLNPQLNFVARSEGNEITAIVTVTGTVDNLDIKFSSTPELPQDEV
FT                   LAQLIFKRSIGELSAFQIAQLAAAAAELAGGSNNSLMNKLRAGTGLDDLDVVTDDKGQT
FT                   AVRAGRYIRDNIYLGVEAGSGGSTKGTVNLDITRNLKAKGSLGAEGDSSGGIFYEKDY"
FT   sig_peptide     59606..59659
FT                   /locus_tag="Oant_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.502 at
FT                   residue 18"
FT   gene            64667..65392
FT                   /locus_tag="Oant_0055"
FT   CDS_pept        64667..65392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0055"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bmb:BruAb1_0050 lipoprotein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12786"
FT                   /db_xref="GOA:A6WUY2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY2"
FT                   /protein_id="ABS12786.1"
FT                   /translation="MTKFIDDLSRRRFLFGTGAVLLTGAAGCNQTMDMSAFQMNVDPMS
FT                   TGGITPMRPQISVDRDITTPDVMYAAVQEGPYSLPAIPYEKVPKQFRRQIVPDPTGQAP
FT                   GTIVVSLKDHLLYYVLPGGEALRYGIGIGKAGFEWSGTANVQYKKQWPVWTPPPEMIQR
FT                   KPELAKYRNGQEPGPQNPLGARALYIFQNGQDTGYRIHGSPEWWSIGQSMSSGCIRLMN
FT                   QDIIDLYNRVQGKAPIIVG"
FT   sig_peptide     64667..64750
FT                   /locus_tag="Oant_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.700) with cleavage site probability 0.443 at
FT                   residue 28"
FT   gene            complement(65603..65818)
FT                   /locus_tag="Oant_0056"
FT   CDS_pept        complement(65603..65818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12787"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY3"
FT                   /protein_id="ABS12787.1"
FT                   /translation="MQARTERRLGIAAALVLTAGAFVMPGVSTQIVQNDVVPQSQIHMA
FT                   SAENLRAELRHFVNLGEAMPKSVRYE"
FT   sig_peptide     complement(65729..65818)
FT                   /locus_tag="Oant_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.465 at
FT                   residue 30"
FT   gene            complement(65918..66427)
FT                   /locus_tag="Oant_0057"
FT   CDS_pept        complement(65918..66427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0057"
FT                   /product="conserved hypothetical cytosolic protein
FT                   (cysteine-rich)"
FT                   /note="KEGG: bme:BMEI1892 hypothetical cytosolic protein
FT                   (cysteine-rich)"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12788"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY4"
FT                   /protein_id="ABS12788.1"
FT                   /translation="MNMRISQLNGANTAGYFDRLPEKLVLEGYRRWTAGFETGSIIPWE
FT                   MTWGLYSEVLGPSEAKRAVGELSHFIRVLRHCASCQLRAFPFDSHHVCREECLTLGLIS
FT                   GIQNQDALLLDTCLEAIACHRRCDDVAGAARNFADTLADFGQTLLPIPIHAIDSALNFT
FT                   PRATFH"
FT   gene            complement(67168..68196)
FT                   /locus_tag="Oant_0058"
FT   CDS_pept        complement(67168..68196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0058"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; nuclear
FT                   export factor GLE1; KEGG: bmb:BruAb1_0054 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12789"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR021174"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY5"
FT                   /protein_id="ABS12789.1"
FT                   /translation="MKNYRLFASAISIAALCASAGLAQAHSSLDQSEAKAGGFYKATFR
FT                   VPHGCDGKATTEVKVELPEGFISAQPQVKAGWKIETVKGDYAQSYKVHGKDVTSGVREV
FT                   RFTDGNLPGDFYDEFTVVGQLAKFDKDTTLSFPVTQVCGSDASVAWTEVPKDGQNPHDL
FT                   AHPAPQLLVKAAGADDGHGGHGGHDKMGQMDGASMQAAMPTKLGELEITAPSVRAMVPG
FT                   AKVAGGFMTIANDGKDADKLVSVTTGGVKRVEIHEMSMQNDVMKMRQLEGGLDIPAGEK
FT                   VELKSGGYHLMFIQPEKPYKEGETVPVTLEFEKAGKVTIDFPVTAQSGQKGGQKDGEHS
FT                   GH"
FT   sig_peptide     complement(68119..68196)
FT                   /locus_tag="Oant_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            complement(68316..68714)
FT                   /locus_tag="Oant_0059"
FT   CDS_pept        complement(68316..68714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12790"
FT                   /db_xref="GOA:A6WUY6"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY6"
FT                   /protein_id="ABS12790.1"
FT                   /translation="MKTSIGQYRISLAIRVLSVFALMFVAFAHKPIDLNAPDSYLLAQY
FT                   QLPDGTYPVLCIGDHGSDPNHQGHDKHLSNNSCEACRISSAFLCPAPTGSTGAAPHIAM
FT                   ADGIVPPQPILQHNTYPPSAPPQAPPLA"
FT   sig_peptide     complement(68628..68714)
FT                   /locus_tag="Oant_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(68846..70417)
FT                   /locus_tag="Oant_0060"
FT   CDS_pept        complement(68846..70417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0060"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; KEGG:
FT                   bja:blr7491 putative 2-keto-gluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12791"
FT                   /db_xref="GOA:A6WUY7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY7"
FT                   /protein_id="ABS12791.1"
FT                   /translation="MAAPYNLKDDKVVVIIGSGAGGGTLGNELAQKGIDVVILEAGKRH
FT                   EFEDFINDEWDSFAQLAWLDKRTTSGSWRVANDFPNLPAWIVKAVGGTTTHWAGASLRF
FT                   QDYEFETLTHYGKIEGANLLDWPITLADLEPYYAKAEDKMGVTRTNGIEGLPGNNNFKV
FT                   MKAGADKLGYKECHTGRMAINSAPRDDRMACQQTGFCFQGCKWGAKWSTLYTEIPKGEE
FT                   TGRLEVRPECTALKIEHNAAGKVTGVLYADKDGKQHLQKARVVCVAGNSIESPRLLLNS
FT                   ASSKFPDGLANSSGQVGRNYMRHTTGSVYASFEKPVHMYRGTTMAGIIRDEAAHNPKRG
FT                   FVGGYEMETVSLGLPFMAAFLNPGGWGRSFTSALDDYVNMAGLWIVGEDMPQEKNRITL
FT                   SKDVKDEHGLPVPDVYYDDHPNDIAMRDHAYAQGKALYEAVGAVRTFPTPPYPSTHNLG
FT                   TNRMSEKPQDGVVNKHGQTHDIKNLFVSDGSQFTTGGAENPTLTIVALAIRQADYIAEQ
FT                   MKKRAI"
FT   gene            complement(70514..71068)
FT                   /locus_tag="Oant_0061"
FT   CDS_pept        complement(70514..71068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_4709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12792"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY8"
FT                   /protein_id="ABS12792.1"
FT                   /translation="MTTVFDGLSTREKKTLSRRDILKRGAGLSLGAMLVVSGNAVICPQ
FT                   FAWALETTTLKPETMATLIQLARDIYPHDKLPDRFYAIAVKPYDADSAKDETLKKLIED
FT                   GVADLNKRAGAGGYLGLGWEEERVAILREIEKSPFFHKVRSGLVTGLYNQKDIWPLFGY
FT                   EGEAYSKGGYIQRGFDDIEWL"
FT   sig_peptide     complement(70919..71068)
FT                   /locus_tag="Oant_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.810 at
FT                   residue 50"
FT   gene            complement(71207..71602)
FT                   /locus_tag="Oant_0062"
FT   CDS_pept        complement(71207..71602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0062"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bms:BR0056 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12793"
FT                   /db_xref="GOA:A6WUY9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUY9"
FT                   /protein_id="ABS12793.1"
FT                   /translation="MAKAIHSMIRVLDEEKSVSFYNQAFGLDIAERIDFETFTLIYLRN
FT                   AEADFEVELTVNKGRTEPYNLGDGYGHLAVAVDDVDAEHARFTELGFKVGKLVDFKNNG
FT                   VQLARFFFAEDPDGYKIEVLQRGGRYQ"
FT   gene            71746..72039
FT                   /locus_tag="Oant_0063"
FT   CDS_pept        71746..72039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VF1213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12794"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ0"
FT                   /protein_id="ABS12794.1"
FT                   /translation="MCKVFAEQDPEGYRQINRSVRIGGHSTSIQLEATFWRLLDEIAAS
FT                   QNLTTPRFISTLYDEALEANGAIPNFASMLRTTCALYLMGHRPEAAVCEEAA"
FT   gene            72166..73335
FT                   /locus_tag="Oant_0064"
FT   CDS_pept        72166..73335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0064"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   bms:BR0057 mrp-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12795"
FT                   /db_xref="GOA:A6WUZ1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ1"
FT                   /protein_id="ABS12795.1"
FT                   /translation="MTSVTREQVQERLKTVTGPDFESDVVSLGLVSDIFIADGKVFFSI
FT                   TVPAARADALEPMRLAAEKAVKEIPGVTGALVTLTAEKKGGRTSDDAPPPPKPQARPAA
FT                   APVQHRHPPQPQRAATKPGIPGVGAIIAVASGKGGVGKSTTAVNLALGLAANGLKVGIL
FT                   DADIYGPSMPRLLGLSGRPETVEGRILKPMENYGIKVMSMGFMVDEETPMIWRGPMVMS
FT                   ALTQMLREVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVVVSTPQDLALIDARKGL
FT                   NMFRKVDVPLLGIVENMSYFIAPDTGARYDIFGNGGARREAERLEVPFLGEVPLHMDVR
FT                   AYSDAGTPITVHEPDSEHAKIYREIARKVWDNMKGGKGAGKPAPAIVFE"
FT   gene            complement(73369..75000)
FT                   /locus_tag="Oant_0065"
FT   CDS_pept        complement(73369..75000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0065"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: bmb:BruAb1_0058 Pgm, phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12796"
FT                   /db_xref="GOA:A6WUZ2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ2"
FT                   /protein_id="ABS12796.1"
FT                   /translation="MTVKTIATTPYQDQQPGTSGLRKKVPVFQQPNYAENFIQSVFDVL
FT                   EGFAGKTLVVGGDGRYYNREVIQKLIKMAAANGFGRIMVGQGGILSTPAASNMIRKYKA
FT                   FGGMILSASHNPGGPNEDFGIKYNIGNGGPAPEKITEAIFARSKVIDQYKIADVVDVDI
FT                   DKIGTSRIGDTEVVIFDPVTDYAELMESLFDFDAIRAMIKGGFGLKFDAMHAVTGPYAK
FT                   EIFEHRLGAPEGSVVNFVPLPDFGGHHPDPNLVYAKDLYDLLMSDHAPDFGAASDGDGD
FT                   RNLIIGRGIFVTPSDSLAMLAANAHLAPGYKDGIKGIARSMPTSAAADRVADKLGIGMF
FT                   ETPTGWKFFGNLLDNGKVTICGEESSGTGSDHVREKDGLWAVLLWLNILAVRKESVKDI
FT                   VEEHWARFGRNYYTRHDYEAVDSDIAKQLVADLRGKLASLPGTTVNGLTIEKADDFAYH
FT                   DPVDGSISEHQGIRIYFPDGGRVVLRLSGTGTSGATIRIYVERYEADTTRHNLDTQETL
FT                   APFIDAAEQIAEVKKRSGRTEPSVIT"
FT   gene            75138..76010
FT                   /locus_tag="Oant_0066"
FT   CDS_pept        75138..76010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0066"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bch:Bcen2424_5008 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12797"
FT                   /db_xref="GOA:A6WUZ3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ3"
FT                   /protein_id="ABS12797.1"
FT                   /translation="MTDNARPINGPRDVMRLKRDDTTGLEAVAARFHSHAYDMHFHDEW
FT                   LVGVTHAGVQDFFCRGRRRQSTPGRVILIEPGERHDGQAVAADGFAYNMLYMPQSLVRS
FT                   AMGGNDAHIGFRETLADDGQLFHAVARACEAIFLEAPRLMIEDCRDQVTNHLARHLARH
FT                   LGQDVTEKGSAPHPVAARAMDYLRARFDEEFGLDELAEAVGAADRFQLSRGFRREYGTS
FT                   PHACLVQLRLAEARRLLREKVAPAEAAALSGFADQSHMGRWFRRAYGMTPAAYRKGRTN
FT                   VPEIAAKSR"
FT   gene            76038..76448
FT                   /locus_tag="Oant_0067"
FT   CDS_pept        76038..76448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12798"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ4"
FT                   /protein_id="ABS12798.1"
FT                   /translation="MIFDTKVAILVLHDLPVWQKLNVTAFIATGISGAVPHAMGDPYED
FT                   AAGRKHTRLLGQPMLIFSATPDVLQRAWQQSIQRDLIRAPYVRAMFETGYDVANRAVFK
FT                   AENADAPDLVGLALYGPKKDIDKAIKGTNLHP"
FT   gene            complement(76432..77751)
FT                   /locus_tag="Oant_0068"
FT   CDS_pept        complement(76432..77751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0068"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ret:RHE_CH00464
FT                   sugar transcriptional regulator protein, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12799"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ5"
FT                   /protein_id="ABS12799.1"
FT                   /translation="MVRHKVEGEPDSGSADTLSSTLSGTLSGTPGPAMLQFAGPGASVN
FT                   RGSNQIGVRAYNERLVLALVRRHGALARAEIARLTGLSAQTVSVIIRALEKDGLITQGE
FT                   RVRGRVGQPSMPMRLAADGVFSFGLKIGRRSAEIILMDFLGAIRERRHITYRWPVPGEI
FT                   RRFAVESVAAFTAALEPAKRDRIAGLGIALPFELWNWVEEVGAPAEDLDAWLGADLVGD
FT                   FAKAFSFPVFVQNDGTAACGAELTFGRGPEFTDFVYFFIGSFIGGGVVLNNTLYPGRTG
FT                   NAGALGSMPMRMRGTWERGETLQLIDTASLFVLERMLQERHLPSDDLWLSPENWRNFGT
FT                   PLDEWVALAARGLAHATVAAASVIDFPAAVIDGWLPGNVRHRIVEATRVELSCLDLQGL
FT                   RAPKIIEGKVGVHAKAMGAASLPLSNRYLFDQSVLFKDAG"
FT   gene            78213..79244
FT                   /locus_tag="Oant_0069"
FT   CDS_pept        78213..79244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0069"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: sme:SMc02171 putative
FT                   periplasmic binding ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12800"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ6"
FT                   /protein_id="ABS12800.1"
FT                   /translation="MKKTVLSAAFAAFTLGAAAIPLSSANAADVGACLITKTDTNPFFV
FT                   KMKEGAIAKAKELGVNLKTYAGKIDGDSESQVAAIETCIADGAKGILITASDTKGIVPS
FT                   LQKARDAGLLIIALDTPLEPADAADATFATDNFLAGELVGKWAAATLGDKAKDARVAFL
FT                   NLTASQPSVDVLRDQGFATGFGIDPKDKTKLGDEDDPRIAGRDLTDGNEEGGRRAMENL
FT                   LQKDPNINVVHTINEPAAAGAYEALKAVGREKDVLIVSIDGGCPGVKNVEAGVIGATSQ
FT                   QYPLQMAALGIEAIKKFADTGEKPKPTEGKDFVDTGVSLVTDKPVEGVPSIDTKTALDK
FT                   CWG"
FT   sig_peptide     78213..78296
FT                   /locus_tag="Oant_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            79321..80415
FT                   /locus_tag="Oant_0070"
FT   CDS_pept        79321..80415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0070"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sme:SMc02170 putative permease ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12801"
FT                   /db_xref="GOA:A6WUZ7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ7"
FT                   /protein_id="ABS12801.1"
FT                   /translation="MSEPQAASAAQKPSMQDYEKTLAQSAADVASFDAGDQSLLYRMRN
FT                   FLHHNPAAVPLIVLVLSLLVFGITLGGKFFSAFALTLILQQVAITGIIAVAQTLVILTA
FT                   GIDLSVGAIMVLSSVVMGQFTFRYGLPAELSVLFGFATGALCGFINGFLVAYVRLPPFI
FT                   VTLGMWQVILATNFLYSANETIRAQEITAEAPILQFFGESIRFGGAVFTYGVIAMVLLV
FT                   LLFWYVLNHTAWGRHVYAIGDDPEAAQLSGVSVKPILMSVYVLAGIICALAGWAMIGRL
FT                   GSVSPTAGQFANIESITAVVIGGISLFGGRGSILGTMFGALIVGVFSLGLRLWGTDPQW
FT                   TYLLIGVLIIAAVAIDQWIRKAAA"
FT   gene            80412..81191
FT                   /locus_tag="Oant_0071"
FT   CDS_pept        80412..81191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0071"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_CH00467 fructose ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12802"
FT                   /db_xref="GOA:A6WUZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ8"
FT                   /protein_id="ABS12802.1"
FT                   /translation="MKTNTTPVLSGRNLVKRYGRVTALDHADFDLYPGEILAVIGDNGA
FT                   GKSSLIKALSGAIKPDEGEILLDGKPVSFHSPMEARQAGIETVYQNLALSPALSIADNL
FT                   FLGREIRRKGPLGSLFRMLDRGAMEKIAREKLSELGLMTIQNIGQAVETLSGGQRQGVA
FT                   VARAAAFGSKVVIMDEPTAALGVKESRRVLELIQDVKRRGMPIVLISHNMPHVFEVADR
FT                   IHIHRLGRRLTVIDPKEYSMSDAVALMTGAMRPKEAA"
FT   gene            81259..81900
FT                   /locus_tag="Oant_0072"
FT   CDS_pept        81259..81900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12803"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WUZ9"
FT                   /protein_id="ABS12803.1"
FT                   /translation="MTPIEREALPSEILARLAETDKRLIVAIAGPPGAGKSTISDYLLH
FT                   AINKGGETPSIVVPMDGFHLDDGILDQRGLLSRKGSPPTFDCAGFAVLLQRLKQAEGEI
FT                   FIPVFDRSLELSRAAASVVGPEHRVLLVEGNYLLLDQQPWTQLAPFFDMTLYLDVPFAE
FT                   LERRLIERWLSFGFDAETARNRALSNDIPNAELVVAQSRKADFVVVSDGR"
FT   gene            81994..82683
FT                   /locus_tag="Oant_0073"
FT   CDS_pept        81994..82683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0073"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bms:BR0063 fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12804"
FT                   /db_xref="GOA:A6WV00"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV00"
FT                   /protein_id="ABS12804.1"
FT                   /translation="MTTYVFAPPPQPFLPVKGTDARFPVHRIYCVGQNYADHAIEMGGD
FT                   PTRNPPFFFQKNPDSLVIEGGDFPYPPKTEDVHHEIELVVALKAGGTDIAVEKALDHVY
FT                   GYAVGIDMTRRDLQAVAKKAGRPWEVAKAFEHSAPCSAIVPVSEIGHPEKAAISLAING
FT                   ETRQSGDLNQMIWKVAETISYLSSLFELQPGDLIFTGTPAGVGPVKRGDRLEGKVDGVA
FT                   TLTVTVV"
FT   gene            82708..82899
FT                   /locus_tag="Oant_0074"
FT   CDS_pept        82708..82899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12805"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV01"
FT                   /protein_id="ABS12805.1"
FT                   /translation="MSIYLPDDVHDALERFIAEKHPGLNQTEAMTLILRKWLVREGYLS
FT                   AEPEHGTPPDELNATNDD"
FT   gene            82918..83130
FT                   /locus_tag="Oant_0075"
FT   CDS_pept        82918..83130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12806"
FT                   /db_xref="GOA:A6WV02"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV02"
FT                   /protein_id="ABS12806.1"
FT                   /translation="MAKQPPEGAGRKTALGRRLLILMILAIVLVIALVWMSIYLFDPNG
FT                   GLDFDDLGIFAFDFNVVDAMSPRIL"
FT   gene            83295..83483
FT                   /locus_tag="Oant_0076"
FT   CDS_pept        83295..83483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12807"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV03"
FT                   /protein_id="ABS12807.1"
FT                   /translation="MAFEDIKAEIALLFEQMVNQPQDAHEIRETVREKLNTLRASGLPL
FT                   PEDLVELEKRIEKDFDS"
FT   gene            83552..84394
FT                   /locus_tag="Oant_0077"
FT   CDS_pept        83552..84394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0077"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bmb:BruAb1_0067 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12808"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV04"
FT                   /protein_id="ABS12808.1"
FT                   /translation="MLLGCAVALSACNTTNDGKPVKTALITQTDTSSQTASAAGSAASA
FT                   TANAAGTATADAGAAAGTQTVAAVTDPSDPVLPAVVPIPGIRGQSEPMMAYAGAQAAAS
FT                   PASVAANMAFETPDHAPEELDALITKYSVAYDVPERLVRRVVHRESRFNPGARNGPYWG
FT                   LMQISHPTARGMGYTGAAKGLLDAETNLKYAVRYLSGAYKVAGGDESQAVRYYARGYYY
FT                   DAKRKGLLQETGLDGSWKRNGPTRDAAASIQPASLPEGGTAPLPGVAPIQASYAPAAQ"
FT   gene            84576..85232
FT                   /locus_tag="Oant_0078"
FT   CDS_pept        84576..85232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0078"
FT                   /product="Hly-III family protein"
FT                   /note="PFAM: Hly-III family protein; KEGG: bmb:BruAb1_0068
FT                   channel protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12809"
FT                   /db_xref="GOA:A6WV05"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV05"
FT                   /protein_id="ABS12809.1"
FT                   /translation="MNVRLPHPVKWKYDRAELWADGVIHVLGVGLALAGAIAMLIYFLP
FT                   NMPAATSISSGVYLASLLAALGISAVYNIWPVSPTKWFLRRFDHSAIYLLIAGTYTPFA
FT                   MHMGDRALPLLLFVWSVAFVGIMLKLFMPGRFDRLSILLYLALGWSGVMVYDTMVQSLP
FT                   PAVFWLIAAGGMVYSLGVIFHVWERLRFQNAIWHGFVVVGAALHYCAVFFVGAWN"
FT   gene            complement(85494..88727)
FT                   /locus_tag="Oant_0079"
FT   CDS_pept        complement(85494..88727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0079"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bmb:BruAb1_0069 DnaE-1, DNA polymerase III,
FT                   alpha subunit; TIGRFAM: DNA polymerase III, alpha subunit;
FT                   PFAM: nucleic acid binding OB-fold tRNA/helicase-type; DNA
FT                   polymerase III alpha subunit; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12810"
FT                   /db_xref="GOA:A6WV06"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV06"
FT                   /protein_id="ABS12810.1"
FT                   /translation="MAPYFEMAAASNFSFLCGASHPQELVARAHELGLSGIGIADRNTL
FT                   AGVVRAHAAWKDFRDKSDFRLFIGCRLSFTDGTPDMVVYPRDRPAYGQLCRLLTEGKAR
FT                   AAIKGECHLEWGDLLFRARQFQIAVFPPEDDRPDFAARLTEIAQAAPGSVWLALAMPHQ
FT                   GHDGRRAERIARFAAEANVPLLATNDVLYHHPDRRALQDVLTATRYHTTVFAAGQLLEK
FT                   NAERHLKPPKEMLRLFRDYAEAVEATADFVAPITFQLDELKYDYPDEPVPPGKTPQQHL
FT                   HDLTWEGAARHYGANSIPPKVQTLIHKELALIEKLQYAAYFLTVYDIVSYARREDILCQ
FT                   GRGSAANSVVCFCLGVTGVDPTQVDLLFERFLSVERKEPPDIDVDFEHERREEVMQYVY
FT                   KRYSRDRAAIVATVISYRSRSAIRDVGKALGLTEDVTAALANTVWGISGGGIDKQHIRQ
FT                   AGLDPDNPIIRRAVELAITLIGFPRHLSQHVGGFVLTRDRLDETVPIGPAAMEDRSFIE
FT                   WDKDDIDEVGLMKVDVLSLGMLTCIRKAFDLIHQHKPEKYDGKKLTLANLPREDEAVYD
FT                   MLCKGDSLGVFQVESRAQMNMLPRLRPREFYDLVIEVAIVRPGPIQGDMVHPYLRRRNN
FT                   EEPCTLPSPAPEYGPPDELLQILGKTKGVPLFQEQAMRIAMEAAKFTPDEANQLRRAMA
FT                   TFRKMGTIHTMETKMIEGMVNRGYDRTFAENCFNQIKGFGEYGFPESHAASFAHLVYIS
FT                   AWIKCHHPEVFAAALLNSQPMGFYAPAQIVRDAREHGVTVLPVDVNFSHWDNMLEDTLD
FT                   IRPALRLGFRQIDGFSKRDTELLIADRQEPYRTIEDMHRRLRLDRRAFTLLADADAFGS
FT                   LDIDRRAALWAVRRLPNDETLPLFRAAATSELAEEPRTKLPEMAASEHVIADYETTRLS
FT                   LKGHPLQYLREGLAAEGVSTCRAVQEGADGRRMKVAGVVTVRQRPGSAKGVVFLTIEDE
FT                   TGIANIVVWPKIMKAFRREVMGARLIHIEGRLQRSPEGVVHLVASKLQDRSAALIEMSG
FT                   REAQRLVAPSQMAHHPRNVKIMPNSRDFH"
FT   gene            complement(88727..90196)
FT                   /locus_tag="Oant_0080"
FT   CDS_pept        complement(88727..90196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12811"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV07"
FT                   /protein_id="ABS12811.1"
FT                   /translation="MVVTERTANALRLTAVDAGAAKLGLFPGMALTDARARVERLEVAT
FT                   AAPEHDAALLKRLAHWCERYTPLVAFDEPHGLMLDITGCAHLFGGLDAMRADAIRRLER
FT                   AGLGVQAAIADNSFAARLLARRTKGSVFSRAEADRLLPRLPLSALELTQAAETGLKRAG
FT                   LKRIGDVMGLPRAALTARFGTDLATRLDRLARQERAPISPLRIMPLSTVERRLSEPVTA
FT                   MELVERILQELAQELFTQLEPEGKGALLIESSFFRVDGEVRHIHIETGQPLRSDKVFLR
FT                   LARERLNALTDPLDAGFGFDMIRLAALRSAAIAQRQTGLDQHEEDEAGFSQLVDRLSAR
FT                   LGQNRVLVSFSRNTHIPERAFGLRPALHTDSKGEADYENTAALPPALPNDPPARPIKLF
FT                   RPPQLIESVAEVPDSPPSFFLWRRVRHHVRLAEGPERIEPEWWLAIGHTVPELRDYYRV
FT                   EDENGQRFWIFREGLYDGANHPRWFLHGLFA"
FT   gene            complement(90216..91034)
FT                   /locus_tag="Oant_0081"
FT   CDS_pept        complement(90216..91034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12812"
FT                   /db_xref="InterPro:IPR017026"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV08"
FT                   /protein_id="ABS12812.1"
FT                   /translation="MVTTIEGNDPQGSFANQGQTDFGRTRSFTLGLAGADAAFPHGLAG
FT                   DALHEVFAENPGAHMAATGFALAFAARAAERAIEPRRPIIWIEEESAASEYGGLYPPGL
FT                   HAFGIDPSRLLIVRCPTAQDVLKAANDALEAGTGGKASHLVSGVVASVTGQPKCLDLTA
FT                   SRRLLLATETAQLPVILLRSHRTAVQSAAVSRWRVAPAPSRSSGANAPGKPVFSAVLER
FT                   NRHGTCGQWIMEWNNETQEFGANERDGRTSVSRPLVSVSADRPASQQRSA"
FT   gene            complement(91226..91582)
FT                   /locus_tag="Oant_0082"
FT   CDS_pept        complement(91226..91582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpd:RPD_2767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12813"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV09"
FT                   /protein_id="ABS12813.1"
FT                   /translation="MTYYLAELYSPKSSWHALDAEGRQAFFEKVGAGMGGLGALGIEAL
FT                   ALGPVDATKSFAPSQSFFAIWRFPDEAALDMLIAGITATGWHDYFDTINAAGAGTDLPG
FT                   HLAQLAGVPFRDAA"
FT   gene            complement(91579..92109)
FT                   /locus_tag="Oant_0083"
FT   CDS_pept        complement(91579..92109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0083"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rpd:RPD_2769
FT                   regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12814"
FT                   /db_xref="GOA:A6WV10"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV10"
FT                   /protein_id="ABS12814.1"
FT                   /translation="MEIIEQKHHALLGEMERRHSPSTDALKTCFEVLSLAAAIDRDCAS
FT                   RLAPHKLSEGKFVLLFLLHNAPDGLSPHELSERAGVTRATITGLLDGLERDGFLKRHAD
FT                   SEDRRKLTVRLTSEGMLLAQQLFEQHTAWIASLMSDLSSGEQQLLSTLLRRIWSRTDAG
FT                   RSFKINETLRDMT"
FT   gene            92247..92468
FT                   /locus_tag="Oant_0084"
FT   CDS_pept        92247..92468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ilo:IL2066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12815"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV11"
FT                   /protein_id="ABS12815.1"
FT                   /translation="MGIVKIGDELHEELRKASDVMCRSINAQAEYWMKIGMLAQAHPDL
FT                   SFNEIVQMQLRAAQVELPVLPVLTVQSS"
FT   gene            92465..93253
FT                   /locus_tag="Oant_0085"
FT   CDS_pept        92465..93253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0085"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: bxe:Bxe_B0269 peptidase M24A,
FT                   methionine aminopeptidase, subfamily 1"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12816"
FT                   /db_xref="GOA:A6WV12"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV12"
FT                   /protein_id="ABS12816.1"
FT                   /translation="MTKTPAEVEKMAASGALLASVFALLDRTPLAGMTTMQVNDLVEDY
FT                   ITRELQARPASKGQYDYPYVLNSSKNEVVCHGMPSNDQIIENGEIINFDITLEKDGYIA
FT                   DSSKTYMVGEVAPFASRLVRVTYEALWKGIAAVRPGATLGDIGHAIERHAKRHDYSIVR
FT                   EYCGHGIGREMHEEPQVLHFGKPGTGVRLREGMVFTIEPMLNQGTAKVKTEKDGWTVVT
FT                   RDGKLSAQFEHTVAVTANGVRVLTLRPGEEKMLAGIKHAA"
FT   sig_peptide     92465..92542
FT                   /locus_tag="Oant_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.536 at
FT                   residue 26"
FT   gene            complement(93357..94595)
FT                   /locus_tag="Oant_0086"
FT   CDS_pept        complement(93357..94595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0086"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG:
FT                   bmb:BruAb1_0074 ArgG, argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12817"
FT                   /db_xref="GOA:A6WV13"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV13"
FT                   /protein_id="ABS12817.1"
FT                   /translation="MRRKFIMSKWKDVKKVVLAYSGGLDTSIILKWLQTELGAEVVTFT
FT                   ADLGQGEELEPARKKAEMLGIKEIFIEDVREEFVRDFVFPMFRANAVYEGVYLLGTSIA
FT                   RPLISKHLIEIARKTGADAIAHGATGKGNDQVRFELSAYALNPDIKIIAPWRDWSFKSR
FT                   THLLEFAEQHQIPVAKDKKGEAPFSVDANLLHSSSEGKVLEDPAVEAPEYVHMRTISPE
FT                   TAPDKATIIKIGFEKGDAVSINGERLSPATLLAKLNDYGRDNGIGRLDLVENRFVGMKS
FT                   RGVYETPGGTILLAAHRAIESITLDRGAAHLKDELMPRYAELIYYGFWFSPEREMLQAA
FT                   IDHSQRHVEGEVTLKLYKGNVMVIGRESDKSLYSDKLVTFEDDQGAYDQKDAAGFIKLN
FT                   ALRLRTLAARDRK"
FT   gene            complement(94693..94992)
FT                   /locus_tag="Oant_0087"
FT   CDS_pept        complement(94693..94992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0087"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   mlo:mll2956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12818"
FT                   /db_xref="GOA:A6WV14"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV14"
FT                   /protein_id="ABS12818.1"
FT                   /translation="MLLIVGTVRLPPENLDRAREAMQRMILASRAEDGCVDYGYAADIL
FT                   EPGLIHVKEMWRDRASLDRHFASPHIAEWRAAWPELGIGDRNLVVYEVGEPQIT"
FT   gene            95066..95725
FT                   /locus_tag="Oant_0088"
FT   CDS_pept        95066..95725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0088"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bme:BMEI1869 homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12819"
FT                   /db_xref="GOA:A6WV15"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV15"
FT                   /protein_id="ABS12819.1"
FT                   /translation="MSFLTNLTFIPEWTIFVQFAIATAILSITPGPDMTLFVGRALSEG
FT                   KAAGFACMAGASTGIVIHTTMVALGLSALILASPAAFTALKVVGAGYLVWLAVQAIRKG
FT                   SAFSPEKNGGKKHTLFQNWLTGLGINLLNPKIILFNMTFLPQFVSAHDPHAMGKLFFLG
FT                   LSFIPMALPFTIPMVVAADRFAGLLKKNPTVTRIVDWMFAGVFSAFALKIITAQAK"
FT   gene            complement(95788..96291)
FT                   /locus_tag="Oant_0089"
FT   CDS_pept        complement(95788..96291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12820"
FT                   /db_xref="GOA:A6WV16"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV16"
FT                   /protein_id="ABS12820.1"
FT                   /translation="MNDTFDYITRFAIVVFGYCCGVLTAGWFLAAILFRTLGIDSFMND
FT                   FVMMASDADAGSLFAATSFWSAVFVGGFAIAAMAGGFSFVPALILIILAEARGYKSSLF
FT                   YCVAGALIGLAAAGASLPFSDGRSVPESSLWIATIAGAGVVGSFVYWLLAGRNAGRLLT
FT                   RPVE"
FT   gene            complement(96322..97557)
FT                   /locus_tag="Oant_0090"
FT   CDS_pept        complement(96322..97557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0090"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: bme:BMEI1867 florfenicol
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12821"
FT                   /db_xref="GOA:A6WV17"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV17"
FT                   /protein_id="ABS12821.1"
FT                   /translation="MSISFDLTIDDTRDQLARHARASLEAKPSLIGMSREEMAEALIKA
FT                   GVPERQVKMRISQLWHWLYVRGVSDFADMRNISKDLRAMLAQHFTIARPEVVEEQISQD
FT                   GTRKWLFRFPPRGAGRPVEIESVYIPEEGRGTLCVSSQVGCTLTCSFCHTGTQKLVRNL
FT                   TSEEILAQLLTARDRLGDFPDKDTPDGAMVPAEGRKITNIVMMGMGEPLYNFEEVKKAL
FT                   LIASDGDGLSLSKRRITLSTSGVVPEIYRTGDEIGVMLAISLHAVRDELRDILVPINKK
FT                   YPLEQLIKACREYPGLSNAKRITFEYVMLKDINDSLEDAKLLVKLLQGIPAKINLIPFN
FT                   PWPGTNYQCSEWEQIEKFADYVNAAGYASPIRTPRGRDILAACGQLKSESERMRKSERL
FT                   ALEAMMIAGHGE"
FT   gene            complement(97823..98326)
FT                   /locus_tag="Oant_0091"
FT   CDS_pept        complement(97823..98326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12822"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV18"
FT                   /protein_id="ABS12822.1"
FT                   /translation="MLGKSIVAASVFMIGMAGSALAQTPSQISQFNAWGAYSYQSGNGK
FT                   VCYVLSVPTQKAPANVDHGDNFFLVSQKPGQNISFEPQFMAGYDLNTNAKVVVSIGNRN
FT                   FNMFVNGKSGWMENAAEEPQLIAAMRGGSEMKVQAQSKRGTKTNYTYSLKGISDALKAI
FT                   QKCK"
FT   sig_peptide     complement(98258..98326)
FT                   /locus_tag="Oant_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(98678..99058)
FT                   /locus_tag="Oant_0092"
FT   CDS_pept        complement(98678..99058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0092"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   bms:BR0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12823"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV19"
FT                   /protein_id="ABS12823.1"
FT                   /translation="MDDVRIGEILEPGSESEFKKRSERVKNGFWKAARRAGRMVPFMDE
FT                   VVAAYYCALDQRTPTHVRMTLMAALAYFVLPFDAIPDILAGIGFTDDVAVLMAALTAVR
FT                   AHITPAHRLAARQALEDEGARE"
FT   gene            99280..99789
FT                   /locus_tag="Oant_0093"
FT   CDS_pept        99280..99789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12824"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV20"
FT                   /protein_id="ABS12824.1"
FT                   /translation="MEVLMHLTGYGENFIRSDRSTRLFRGNQLLAAGSEDNYITVDLSE
FT                   AGCYDAAVYLRFLFGAGISLNTLRGTSSQNWIPILNFRAGEQWNGYSALPFGKAIGFYD
FT                   VQAGHIFHAAISLGDVHIRGVHGGKLGQNWQDRINLTRVLPYSSRNPDGSFNYDRRKIY
FT                   VYISKL"
FT   gene            complement(99792..100082)
FT                   /locus_tag="Oant_0094"
FT   CDS_pept        complement(99792..100082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0094"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: bmb:BruAb1_0080 PhhB,
FT                   pterin-4-alpha-carbinolamine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12825"
FT                   /db_xref="GOA:A6WV21"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV21"
FT                   /protein_id="ABS12825.1"
FT                   /translation="MARNRLTENELNEALTELDGWQKVDGREAIAKSFKFKDFNAAFGF
FT                   MTRAALHAEKLDHHPEWFNVYNRVDVTLATHSENGITELDIKLARKMNAIA"
FT   gene            100139..100660
FT                   /locus_tag="Oant_0095"
FT   CDS_pept        100139..100660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0095"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bme:BMEI1863 low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12826"
FT                   /db_xref="GOA:A6WV22"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV22"
FT                   /protein_id="ABS12826.1"
FT                   /translation="MIVSVAAQAPTSILFVCAGNICRSPLAEGVMGHVLEKRGIRHVLV
FT                   DSAGTNGYHTGEEPDERSISVAAHHGLDISAQRCRQLIAGDFSRFDLILGMDRYNMRMI
FT                   AERRPASADAHIGLFAEIAEGRAVEIPDPYYGGTGDFEKVYRMVLAASIALADQFWPER
FT                   ATKGQASSTI"
FT   gene            complement(100570..101160)
FT                   /locus_tag="Oant_0096"
FT   CDS_pept        complement(100570..101160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0096"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: bmb:BruAb1_0082 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12827"
FT                   /db_xref="GOA:A6WV23"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV23"
FT                   /protein_id="ABS12827.1"
FT                   /translation="MPRLFTALEIPRDAALSLSLLRGGLPGARWIDVENYHITLRFIGD
FT                   VEGHVADEVANALDRVRRPEFMLNLSGVNAFGSKKPHSIYAGVSPSPELNALQAEIERI
FT                   CRRLHIPADPRKFTPHVTLARLRNPRIEDVVRYLSSRGNFATLPFKVGRFVLMSSRDSV
FT                   GGGPYIVEEAWPLVARSGQNWSASAMEAARTIR"
FT   gene            complement(101341..102060)
FT                   /locus_tag="Oant_0097"
FT   CDS_pept        complement(101341..102060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0097"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bmb:BruAb1_0083 lipase/acylhydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12828"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV24"
FT                   /protein_id="ABS12828.1"
FT                   /translation="MRFKLSIPAWLPIFAMMASFMAASPITTAQAQEDPTGLEDALPTE
FT                   QLSQVKIVGFGDSLMAGYLLPANAAFPQQLEKALNDKGVEVSIENAGVSGDTTTGGLSR
FT                   IDWSVPDGTDLVILELGANDALRGIEPDITEKNLDEMLARLKQRGISVILAGMMAPPNM
FT                   GKDYAAKFNPIYPKLAQKYGVPLYPFFLDGVATKKDFLLEDGMHPNEKGVETMVSNFMP
FT                   TIEKSLTNMQNKGTSGG"
FT   sig_peptide     complement(101965..102060)
FT                   /locus_tag="Oant_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 32"
FT   gene            102192..102920
FT                   /locus_tag="Oant_0098"
FT   CDS_pept        102192..102920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0098"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bmb:BruAb1_0084 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12829"
FT                   /db_xref="GOA:A6WV25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV25"
FT                   /protein_id="ABS12829.1"
FT                   /translation="MTEQVVGPIIELENVHLTLGHAASSVHVLKGVSLHISQGQSVGIV
FT                   GPSGSGKSTLLMVLAGLEHVDNGTVKIAGETISQMSEDQAAAFRGANIGIVFQSFHLIP
FT                   NMTALENVAVPLELAGRRDAFEVAERELRAVGLGERLTHYPSELSGGEQQRVAIARALA
FT                   PSPKILIADEPTGNLDTTTGRQIADLLFAKQRENGLTMVLVTHDPALAARCDIEIPVRS
FT                   GRIEEPAQGGSVLESLAAGA"
FT   gene            102917..105466
FT                   /locus_tag="Oant_0099"
FT   CDS_pept        102917..105466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0099"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bmb:BruAb1_0085 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12830"
FT                   /db_xref="GOA:A6WV26"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV26"
FT                   /protein_id="ABS12830.1"
FT                   /translation="MSAAKSFSLALRFALREMRGGLSGFYIFLACIALGVAAIGGVNSV
FT                   ARSVSTGIASEGQSILGGDVSFALNQRETTAEERAFIAKQGRMAESATMRSMARMPDGS
FT                   DQSLVEVKAVDAAYPLYGELKVQPQQSLADMTGEKDGTYGAAVSQDFLNRMDLSLGAKV
FT                   LLGSQVFELRGLIESEPDLLSSGFNFAPRFLVSLDGLRASGLIQPGSLVDHIYKVALPD
FT                   GAPDAAIAEVRRQAAADFPDAGWNIRSRTNAAPALSANIERFSQFLTLVGLTALIVGGV
FT                   GVANAVRAYLDGKRGVIATFKSLGAPARFAVLVYLVQIMVIGFIGIVLGLILAAIIPFA
FT                   AAMALANYLPVAGGGGFFPDALALAAVFGLITTLAFAIIPLGRARDIPATALFREQGFE
FT                   QRGLPPFLYLTLAVLLIAALAGLALYVAYDRRIAAIFIVSAIAAFGVLRLVADGIRWLA
FT                   RRVPRVRSTSLRLAVGNIHRPGALTPSVVLSLGLGLTLMVAIALIDGNLRRQVTENIPA
FT                   QAPDFFFVDIQNRDIGDFTKLVSGIVPDGKLTSGPMLRGRIVAFNGTNVRDMTIPPEAA
FT                   WVLRGDRGITFSDTVPENSTLTEGEWWPNDYSGEPLVSFAEREGKELGLKLGDTVTVNV
FT                   LGRNITAKIASFRQVQWETLAMNFVMVFSPNTFAGAPATWLATLTIPDSQKNLAPDVLR
FT                   QVTKTWPAVTTVSVTDALNVANDLISQLATAIRAAASIALAASVLVLGGALAAGNRARV
FT                   HDAVVLKTLGATRGTLITAYVLEYMLLGLATALFALVAGSVAGWYVVVEIMKLKASFLP
FT                   DVALMTVAIALVLTVGFGLAGTWRVLGQKPAQVLRTI"
FT   gene            105701..106483
FT                   /locus_tag="Oant_0100"
FT   CDS_pept        105701..106483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0100"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   bmb:BruAb1_0086 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12831"
FT                   /db_xref="GOA:A6WV27"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV27"
FT                   /protein_id="ABS12831.1"
FT                   /translation="MADFRNIQAQQRPVGGARADAGIDQGLRSYMLGVYNMMAIGLAVT
FT                   GLAAFAVAALATTTDPSAAVAQLANGKMLTGLGVALYTSPLRWVVMLAPLAAVFFLSFR
FT                   IERLSVSTANAVFWGYAALVGLSLSSIFLVFTGQSIVRTFFVTAASFGALSLYGYTTKR
FT                   DLSAMGSFLIMGLFGLILASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQSIKEMYY
FT                   EGDSSDAHGRKVVMGALRLYLDFINMFTFLLQFMGNRE"
FT   gene            106560..107141
FT                   /locus_tag="Oant_0101"
FT   CDS_pept        106560..107141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0101"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bms:BR0089 phosphinothricin N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12832"
FT                   /db_xref="GOA:A6WV28"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV28"
FT                   /protein_id="ABS12832.1"
FT                   /translation="MVEALSKHFTPVPPMPVIRDFQPADIETITTIYTEAVLTGAGSYE
FT                   IEPPTMDEMVKRFEAFVEQGFPILVAEEDGRVLGYAYASYFRVRPAYRWLAEDSIYIAP
FT                   DAKGKGIGKLLLRELIDRIAALGFRQLLAVIGDGEHNIGSVKLHESLGFTHCGRIEGSG
FT                   FKHGRWLDTVLMQLPLNGGRSIEPGTPPLS"
FT   gene            complement(107162..107554)
FT                   /locus_tag="Oant_0102"
FT   CDS_pept        complement(107162..107554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12833"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV29"
FT                   /protein_id="ABS12833.1"
FT                   /translation="MNTSSVANEDLSSPSPSSASPKVVPIDRVRPAPISFNRHELAKIL
FT                   NIYGRMVASGTWRDYAIDHLADRAVFSIFRRASEVPLFRIEKNPKLAQKQGAYSVIAAS
FT                   GLIMKRGHELERVLRVFDKSLKLVES"
FT   gene            complement(108114..108932)
FT                   /locus_tag="Oant_0103"
FT   CDS_pept        complement(108114..108932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0103"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   bme:BMEI1856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12834"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV30"
FT                   /protein_id="ABS12834.1"
FT                   /translation="MILHAPFYGTGSWLTGEHLPGWRSICAVLGLAFTGCISMQGPAKA
FT                   QDSGKKTAVLELYTSQGCKSCPKADQNFAKYADDPNVLALSFHVNYWDYMGWRDTLATQ
FT                   ENTDRQNAYRNSFNARMIYTPQAIINGTTEVNGRDSEAVQAQIAANKLDVPVSITQLDD
FT                   GRLSIDIGAGKKPEAPVHVVLFYFRDSVTIPITEGENAGEAVTYRNTVRDTNTIGMWDG
FT                   KPLKIEIPASELKRKDVSGCAVVLQETRDDNSLGPIHGAAMFKQKKPIGL"
FT   gene            109086..109328
FT                   /locus_tag="Oant_0104"
FT   CDS_pept        109086..109328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_02263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12835"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV31"
FT                   /protein_id="ABS12835.1"
FT                   /translation="MRERDWLNMRSSLREKAIAICDEKIAKKGDTVGISFYAFFANKNT
FT                   EPELLMEAAEWWIKTHTLDHFEKAVKIREMIRSGR"
FT   gene            complement(109402..112089)
FT                   /locus_tag="Oant_0105"
FT   CDS_pept        complement(109402..112089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0105"
FT                   /product="aconitate hydratase 1"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: bme:BMEI1855 aconitate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12836"
FT                   /db_xref="GOA:A6WV32"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV32"
FT                   /protein_id="ABS12836.1"
FT                   /translation="MSHIDSFKCRKTLTVGGKDYVYYSLTEAEKNGLEGVSKLPFSMKV
FT                   LLENLLRFEDDRSVKKSDIEAVAKWLNDRGSAGAEIAYRPARVLMQDFTGVPAVVDLAA
FT                   MRDGLKALGGDPEKINPLVPVDLVIDHSVIVDEFGNPSAFKANVDLEYQRNGERYRFLK
FT                   WGQQAFKNFRVVPPGTGICHQVNLEYLAQAVWTKEEDGETVAYPDTCVGTDSHTTMVNG
FT                   LGVLGWGVGGIEAEAAMLGQPVSMLLPEVVGFRLTGKIKEGVTATDLVLTVTQMLRKKG
FT                   VVGKFVEFFGEGLENMTLADRATIANMGPEYGATCGFFPVDRETLNYMNTTGRDEHRIE
FT                   LVEAYCRAQGMWRDKGAADPVFTDILELDMSDVVPSMAGPKRPEGRIALENIASGFATS
FT                   LENEYKKTTGQTARYAVEGEDYDLGHGDVAIAAITSCTNTSNPSVLIAAGLLARNAVAK
FT                   GLKTKPWVKTSLAPGSQVVAAYLESAGLQKDLDALGFNLVGFGCTTCIGNSGPLPAPIS
FT                   KTINEKGLIAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAHALAGTVTKDLTKEPLGE
FT                   DQNGNPVFLRDIWPSSQEIQEFIAKNVTRKIFSEKYADVFKGDENWQAVQVPAGQTYAW
FT                   DDNSTYVQNPPYFVGMGKSAGTIGDVKGARILGLFGDKITTDHISPAGSIKAQSPAGKY
FT                   LIDHGVGIADFNQYGTRRGNHEVMMRGTFANIRIRNHMLGENGREGGYTIHYPSKEETS
FT                   IYDAAMQYKAEGVPLVVFAGVEYGNGSSRDWAAKGTNLLGVKAVIAQSFERIHRSNLVG
FT                   MGIVPFVFEEGTSWQTLGLKGDEMVTIEGLADVRPRQKVDASITFADGTVKKVPLICRI
FT                   DTLDELDYMKNGGILQTVLRDLAA"
FT   gene            112421..113038
FT                   /locus_tag="Oant_0106"
FT   CDS_pept        112421..113038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0106"
FT                   /product="heme exporter protein CcmA"
FT                   /note="TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; KEGG:
FT                   bmb:BruAb1_0091 CcmA, heme exporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12837"
FT                   /db_xref="GOA:A6WV33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV33"
FT                   /protein_id="ABS12837.1"
FT                   /translation="MRLEAENLAGERGGETIFAGLSFALGEGEALVVTGPNGSGKSTLL
FT                   RIISGLLQPEAGKVELREDGTVFPVRAACHYLGHQNAMKPALSVRENLSFWQKFNGAAQ
FT                   TEIDEALEAVDLPGVEHLPFGYLSTGQKRRVSIARLLVSHRPLWIVDEPTAGLDKASEA
FT                   RFAELMRGHMRGGGMIVAATHIPLGLEGVSALDMAACSVEAA"
FT   gene            113038..113703
FT                   /locus_tag="Oant_0107"
FT   CDS_pept        113038..113703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0107"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   bmb:BruAb1_0092 CcmB, heme exporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12838"
FT                   /db_xref="GOA:A6WV34"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV34"
FT                   /protein_id="ABS12838.1"
FT                   /translation="MLALFLRDLRLSFRAGGGALIGILFFLAVISVMPFGVGPDLNLLA
FT                   RIGPAMLWIGALLATLLGLDRLFQADREDGSLDLLLIGADSHMLAFTVFVKCVAHWVAS
FT                   VLPLVIASPMLGLFMNMDASAIGATSLTLLVGTPAIAFIGAVGAALAVALPRGGLLVSV
FT                   IVLPLTIPVLIFGVSASHGATVDNAPFLAPFLILAALTLFFAVLGPLAASAALKSSAD"
FT   gene            113860..114657
FT                   /locus_tag="Oant_0108"
FT   CDS_pept        113860..114657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0108"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: bme:BMEI1851 heme
FT                   exporter protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12839"
FT                   /db_xref="GOA:A6WV35"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV35"
FT                   /protein_id="ABS12839.1"
FT                   /translation="MEKDMTKDAVKTTSWLDLANPTRFLAFAGKVLPWLAVLSVLFLAA
FT                   GLYMVFFLSPEDYQQGMTVRIMYIHVPFAWLSMMCYSIMAVSALGTLVWRHPLADVSIR
FT                   AAAPLGAVFTALALATGSLWGKPMWGTWWVWDARLTSVFVLFLMYLGIIALSRAMDDPA
FT                   KSAKPVAVLTLVGFINIPIIKFSVDWWNTLHQPASVFRMDGPTIDGSMLRPLFVMAIGF
FT                   SLLFFTLHMMAMRNEIWRRRVASMKKLAARNADRNRKAQEGAV"
FT   gene            114654..114824
FT                   /locus_tag="Oant_0109"
FT   CDS_pept        114654..114824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0109"
FT                   /product="Heme exporter protein D (CcmD)"
FT                   /note="PFAM: Heme exporter protein D (CcmD); KEGG:
FT                   bmb:BruAb1_0094 heme exporter protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12840"
FT                   /db_xref="GOA:A6WV36"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV36"
FT                   /protein_id="ABS12840.1"
FT                   /translation="MNHLGYVLASYGITVAALAVTIGWILIDQRIHKNELKRLEAQGVR
FT                   RRSAKASGKAQ"
FT   sig_peptide     114654..114713
FT                   /locus_tag="Oant_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.723 at
FT                   residue 20"
FT   gene            114821..115402
FT                   /locus_tag="Oant_0110"
FT   CDS_pept        114821..115402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0110"
FT                   /product="periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein; Thioredoxin domain; KEGG: bmb:BruAb1_0095 CycY,
FT                   thiol:disulfide interchange protein, thioredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12841"
FT                   /db_xref="GOA:A6WV37"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV37"
FT                   /protein_id="ABS12841.1"
FT                   /translation="MTETTEKPAAPKKRSTWVALLPLAIFVGLAAVFAVQLLSGKDNTT
FT                   IPSALIGKQAPQTNLPPVEGLVRDGVPVPGLNSEEFKGKLTLVNVWGSWCVPCRQEHPL
FT                   LMEIAKDERIRVVGLNYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGVYGVPETF
FT                   LVGPDGKIVYKHVGPFTPESVKNDLMPLIK"
FT   sig_peptide     114821..114925
FT                   /locus_tag="Oant_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.861 at
FT                   residue 35"
FT   gene            115428..116084
FT                   /locus_tag="Oant_0111"
FT   CDS_pept        115428..116084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12842"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV38"
FT                   /protein_id="ABS12842.1"
FT                   /translation="MEPLEKLVGLYLRLNGYFLSKYIIHSPKSGTVRGEVDWLAFKGAH
FT                   HSQSHVGDSGCDFLSLKEKHNDIIICEVKSSASSDFNKSLKSTENIKDILSWIGVVSDR
FT                   DIDSLAEKVSKLVSRDVDKIEAQLGIVYQNYVFRPLLAIGVDSDRDFEKRWRLNTGIIF
FT                   NFIKKRLATENHIPSCSRNYGASQWGDDYKDLIDWFKKNNAETINIENFNKKFKG"
FT   gene            complement(116127..117962)
FT                   /locus_tag="Oant_0112"
FT   CDS_pept        complement(116127..117962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0112"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase; KEGG:
FT                   bmb:BruAb1_0096 IlvD, dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12843"
FT                   /db_xref="GOA:A6WV39"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV39"
FT                   /protein_id="ABS12843.1"
FT                   /translation="MPPYRSRTTTHGRNMAGARGLWRATGMKDEDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAREIESAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAALRLNIPVVFVSGGPMEAGKVVWDDQVKKLD
FT                   LVDAMVAAADDSYTDDQVKAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTL
FT                   ATHADRKRLFVEAGHLVVDLARRYYEQDDESVLPRSIASFPAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEAEIDFTMADIDRLSRRVPVLCKVAPANNTVHMEDVHRAGGIMGILGQLD
FT                   KAGLINTDLPTVHSETVAKALDHWDVTRTNSDMVHKFYSAAPGGVPTQVAFSQERRFDS
FT                   VDTDREKGVIRSKEHAFSQDGGLAVLYGNLAEDGCIVKTAGVDDSILKFSGPARIFESQ
FT                   DTAVLGILNGKIKAGDIVLIRYEGPRGGPGMQEMLYPTSYLKSKGLGKACALITDGRFS
FT                   GGSSGLSIGHVSPEAAEGGTIGLVREGDIIDIDIPNRKIHLAVDDATLAERRAEQEETG
FT                   WKPAETRKRKISTALKAYASMATSAAKGAVRKLPD"
FT   gene            complement(118197..118643)
FT                   /locus_tag="Oant_0113"
FT   CDS_pept        complement(118197..118643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12844"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV40"
FT                   /protein_id="ABS12844.1"
FT                   /translation="MLRNRPDFATVLKEVEADASPEENTRPPQFGFASAVFSVGFGDTP
FT                   ATPRQPDNLESLFDIESVPEAAPEPEQERQAIEARMQKQSPDAIRQELDLHSGLKRSEL
FT                   QRRRRSFAASNHPDRLPEEFRLAAEQRMKTANALLDAAMADAPS"
FT   gene            complement(118643..119026)
FT                   /locus_tag="Oant_0114"
FT   CDS_pept        complement(118643..119026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0114"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bmb:BruAb1_0099 response regulator, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12845"
FT                   /db_xref="GOA:A6WV41"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV41"
FT                   /protein_id="ABS12845.1"
FT                   /translation="MNDLGQRRVLVVEDEIFVALDVAATVEDANGTVLGPVGTVRQAID
FT                   IINRNEVDAAILDVNLADGDVEAVLDRLKSRDVFVVIHTGGGLPARLAARYPGIPVFQK
FT                   PVLPSRLTRALASAFSSHRVQQA"
FT   gene            complement(119164..119400)
FT                   /locus_tag="Oant_0115"
FT   CDS_pept        complement(119164..119400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0115"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bmb:BruAb1_0100 transcriptional regulator, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12846"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV42"
FT                   /protein_id="ABS12846.1"
FT                   /translation="MKPVFLQLQCAPGKTYEVADTLFQREIVSELYSTSGEFDLLAKIY
FT                   IAEDQDIGKFINENVLNIPNIIRSLTTLTFTAF"
FT   gene            119642..120790
FT                   /locus_tag="Oant_0116"
FT   CDS_pept        119642..120790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0116"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: reh:H16_A0406 hypothetical
FT                   protein with GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12847"
FT                   /db_xref="GOA:A6WV43"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV43"
FT                   /protein_id="ABS12847.1"
FT                   /translation="MKFVLPAVLLLFAFAFFSAWLSDRGRQFLVSCGACFLLIGLAMLV
FT                   QLGDFPSDDNLNTVLSAAFYVGGTLVGGYGILQRSGLRLTSAFYILSFALIVGGVWYYC
FT                   YIEPDLLSRVYVLNLGMATLILSFAWQARRLFKGPLVDKLLLVMLVLVALQFVPRTLLT
FT                   ARSLLGDVDGDDFATTVFWQWTVFSTAIAAVVTGFALLAAAGYDRIGELSHERDSDPLT
FT                   GLLNRRGLEMRYDALSQTKKGVPGWVAVCDIDYFKALNDAYGHAAGDAVLKEFAGILRK
FT                   LIGERPLIARTGGEEFVICVDDMHADNVFQLMEGVRQNIERHRFQRLAKEASVTCSIGC
FT                   VRLPEQGDFWQAVDKADKILYAAKKEGRNRTYVEGLNPNSDG"
FT   sig_peptide     119642..119707
FT                   /locus_tag="Oant_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.796 at
FT                   residue 22"
FT   gene            120933..121343
FT                   /locus_tag="Oant_0117"
FT   CDS_pept        120933..121343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0117"
FT                   /product="protein of unknown function DUF930"
FT                   /note="PFAM: protein of unknown function DUF930; KEGG:
FT                   bmb:BruAb1_0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12848"
FT                   /db_xref="InterPro:IPR009273"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV44"
FT                   /protein_id="ABS12848.1"
FT                   /translation="MKFKSLVLPASAVVGLLSFGPAVSPSFAMNASEKAQLEKLDPATR
FT                   LEQRCDVEAMERITREQKFSVDKVLAYAFSDPVTTKNSIEADGAAFRSREHWYKLSFVC
FT                   KTDEEHINIVSFRYDIGDEVPQNQWDKHYLVP"
FT   sig_peptide     120933..121019
FT                   /locus_tag="Oant_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 29"
FT   gene            complement(121353..121739)
FT                   /locus_tag="Oant_0118"
FT   CDS_pept        complement(121353..121739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12849"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV45"
FT                   /protein_id="ABS12849.1"
FT                   /translation="MAYGKRSICTLFAVIAGPAMLFAPSVSAQAQDANPIERVDYICER
FT                   GVVVPVTYIRNGSAPGFAVLDAEGKMIALQWHDSLKKYVAIDEQDSYRWSDKDGQAVLS
FT                   HLEADHTAKEVTLLSACRSDDSEE"
FT   sig_peptide     complement(121647..121739)
FT                   /locus_tag="Oant_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.849 at
FT                   residue 31"
FT   gene            122087..122920
FT                   /locus_tag="Oant_0119"
FT   CDS_pept        122087..122920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0119"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   bme:BMEI1842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12850"
FT                   /db_xref="GOA:A6WV46"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV46"
FT                   /protein_id="ABS12850.1"
FT                   /translation="MMLNLIVVFVVAGLLLHFFNWRKTGIVLIGLAAIFYGAIASAILP
FT                   DTLMSRLQSAYSSQLQTQLEDNTAFIVFGMGTQTVDGDGQKVVEPLAFSYGPILAAVAM
FT                   NRQCVEKGFRCKFIASGADVAGTGVSEAASIATQLEKAGVDPASVLLDEKSRNSWQNSR
FT                   NVAAILREIRPAKVVLLQAAPMMKRDLLYLAHFGVKPEPVAAGYLTGSHTNMSSPGLYF
FT                   LMTDLALHEEIGVWRYTLYNFMGWNEPKQPPLQLGQATSSLPTQTSPAAGPVSAQ"
FT   gene            123093..124121
FT                   /locus_tag="Oant_0120"
FT   CDS_pept        123093..124121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0120"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: bmb:BruAb1_0104 sulfate ABC
FT                   transporter, sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12851"
FT                   /db_xref="GOA:A6WV47"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV47"
FT                   /protein_id="ABS12851.1"
FT                   /translation="MKISRFSLTLAALVAAASLTGTVQASFADQTLLNVSYDPTRELYK
FT                   DYNAAFAAHWKAETGETVTIRASHGGSGKQARSVIDGIKADVVTLALESDIDAIAALSG
FT                   KIDKDWRKRLPNNSAPYTSTIVFLVRKGNPKGIKDWGDLVKDGVEVITPNPKTSGGARW
FT                   NYLAAWAWAYKQYGGDEQKIKDYIGELFRHVPVLDTGARGSTTTFVQRQLGDVLLAWEN
FT                   EAYLSVAEFGEDAFDIVVPPQSILAEPPVAVVDKNAEENGTTKLAQAYLEYLYSPEGQA
FT                   LAAKHFYRPSKPDIIPADKQRKFPDLTLVTIDDPIFGGWAKAQPYHFGDGGTFDQLYKP
FT                   GK"
FT   sig_peptide     123093..123179
FT                   /locus_tag="Oant_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.717 at
FT                   residue 29"
FT   gene            124179..125045
FT                   /locus_tag="Oant_0121"
FT   CDS_pept        124179..125045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0121"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bme:BMEI1840 sulfate
FT                   transport system permease protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12852"
FT                   /db_xref="GOA:A6WV48"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV48"
FT                   /protein_id="ABS12852.1"
FT                   /translation="MSSLPARARAGSHFRKPSVIPGFGLTFGFSVAYLTLLILIPLAAL
FT                   VLRSTEVGFSGFWRLVTDARTLKALETSFGTAFIAALVNVVFGVILAWVLVRYRFPGRR
FT                   FVDAIVDIPFALPTAVAGIALAAIYAPNGWIGSLLAPFGIRIAFSRAGIIIALIFIGLP
FT                   FVVRTVQPIMEEISREVEEAAATLGASRFQTIWRVLLPSLQPAILTGFALAFARGVGEY
FT                   GSVIFIAGNTPYVSEIAPLLIVIKLEEYDYAGATALATVMLALSFAMLLFINLIQSWTR
FT                   RKYGHGE"
FT   gene            125029..125913
FT                   /locus_tag="Oant_0122"
FT   CDS_pept        125029..125913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0122"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysW; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bmb:BruAb1_0106 CysW-1,
FT                   sulfate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12853"
FT                   /db_xref="GOA:A6WV49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV49"
FT                   /protein_id="ABS12853.1"
FT                   /translation="MVMANEPVSAAPRNSRSAVTESPATRITLIALALAFLALFLILPV
FT                   IAVFVEAFRKGAGEYLAALVEPDAWAAIRLTLMVAAIAVPLNLVFGIAAAWAIAKFEFK
FT                   GKALLTTLIDLPFSVSPVISGLVFVLLFSSHSLLGPWLSRHGIEILFAVPGIVLATVFV
FT                   TFPFVARELIPLMQEQGTGDEEAAISLGANGWQTFRYVTLPNIKWGLLYGVLLCNARAM
FT                   GEFGAVSVVSGHIRGLTNTMPLHVEILYNEYNFVGAFAVASLLAFLALLTLAIKTALEL
FT                   RYGDELAGSGNGH"
FT   gene            125989..127053
FT                   /locus_tag="Oant_0123"
FT   CDS_pept        125989..127053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0123"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: sulfate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   bmb:BruAb1_0107 hypothetical sulfate ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12854"
FT                   /db_xref="GOA:A6WV50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV50"
FT                   /protein_id="ABS12854.1"
FT                   /translation="MEVRVAGVRKEFARFPALHNVSLDIRSGELIALLGPSGSGKTTLL
FT                   RLIAGLETPTEGTIFFGDEDASQKSVQERNVGFVFQHYALFRHMTVADNIGFGLKVRPS
FT                   ATRPSSDDIRNRALELLDLVQLQGLEKRYPAQLSGGQRQRVALARAMAIEPKVLLLDEP
FT                   FGALDALVRKELRRWLREIHDKTGHTTVFVTHDQDEALELADRVVVMSQGRIEQVGTPD
FT                   EVYDNPNSPGVYGFIGESSTLPVRVEKGEIWLVDRNIGLTAQDVADGDAQLFFRPHDVE
FT                   LLDGCGGCIAGTVVASRRSGGKRRVELEVGGARERVEIEIPAEHPAAEKSRIAFRPRYW
FT                   KLFPASETGSGTGS"
FT   gene            127458..136124
FT                   /locus_tag="Oant_0124"
FT   CDS_pept        127458..136124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0124"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: putative carbohydrate binding;
FT                   glycosyltransferase 36; glycosyltransferase 36 associated;
FT                   KEGG: bmb:BruAb1_0108 cyclic beta 1-2 glucan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12855"
FT                   /db_xref="GOA:A6WV51"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037820"
FT                   /db_xref="InterPro:IPR037824"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV51"
FT                   /protein_id="ABS12855.1"
FT                   /translation="MSSSLSNSTSTENKSPMQKPSMEPKSSEPDASGRIPPEQPSPIRA
FT                   LYKTEEELGALAAAVARGEDIPLPGYIAFPFDQRLSENGKLILHAYRASDAASRAGETI
FT                   TPAAQWLLDNHYQIDKNVQQARRDLPRRFIRQLPLYKAPVEKYEGMPRIFALAWLYVAH
FT                   TDSNFSLKTLTAIVKGFQTVEPLKIGELWALPSAVRYFLIENARRLALRVDRARIMRNL
FT                   ANTAADRIVVATDGAELDSVLAQYADAARDSTFATHLLYRLRSSSTDTTAAASWLERIL
FT                   EQEGSNPEDAIVEEHARQSTGGVTMGNVIRSLKSIDDVDWETWFETVNEVDAILRDHSD
FT                   FELLDFRSRNAYRVTIEKLARYSDMSEIDITWAALKLAEDGHRAEKAGHPEAEGKGAIA
FT                   YYLSGEGRKELEKVCGYKAPFGVKALRFYRGLGLWGLFIPTAIFTILILLLVNYCMIRA
FT                   GLSTDLRTLFTLLAIFPAMDASYSLFNALVPWFVQPTRLIGFEYKEGLPEEARTLVAVP
FT                   TFITSRDSIDEQIRNLEVHYLTNPRGEIYFALVSDWTDAKQEITPADMEIYEYAREEIA
FT                   KLNEHYTGDDQPRFFLMHRRRLFNEKQNCWMGWERKRGKLHELNLLLRGDQDTSFFPPD
FT                   ERLPKEIKYVMTLDADTRLTPESVTHLAGKLSHPLNRPIIDEKTGKVVRGYGILQPRVT
FT                   PSLTTGDEASFLQRVFSVNRGIDPYVFAVSDTYQDLLGEGTFTGKGLYDIDAFEAALKG
FT                   RVPENTLLSHDLLEGGYSRAALVSDVEVVEDYPTGYNVDVSRHHRWARGDWQLLPWLFS
FT                   TSRGVSHITRWKMVDNLRRSLNPILWLIAAVVGWSVLPIGPAAVWQGFLILSMFVAPTF
FT                   GIVTNLIPSNMDYSLKGHAQSVLTDIALGTADVALRTTFIAHSAFLMADAIVRTVYRLF
FT                   VSHRNLLEWRTAAQARTSPDTLLFYFQLMWPAIAIAGLAIFIPLAAQSHAAMIAAPFAV
FT                   IWFASPLIAWLVSRSAKPQDTLEVLSSDKSDLRRYARRTWRYFAEFANEENHHLPPDNF
FT                   QEDPAPIVAQRTSPTNIGVYLLSVVAARDFGWIGFGETLDRVQATVDTLEKMEKYQGHL
FT                   YNWYETNTLTPMRPLYVSAVDSGNLAGHLVTLSSALEEWAEAPSVYMQGDLDGILDVND
FT                   ILEETIARIPDDRRILRPLRRRLEERIANFRRAVISIKDEPETASFRTINLSLFATDIV
FT                   RLMDELDGEIETPASAEAVEWARILVDTCKAHTEDSIGEHDTDALRERLRYLATRSRQL
FT                   AFDMQFGFLERKERRLLSIGFRVQENELDESCYDLLASEARLASLFAIAKGDVPVEHWF
FT                   KLGRLLVPVGWKGALLSWSGSMFEYLMPPLVMSEPLGSLLDQTNKLVVQRQIDYATSRG
FT                   LPWGISEAAFNARDAHMNYQYSNFGVPNLGLQRGLSRNAVIAPYASLLAAQYQPAAAVA
FT                   NLKRLAKLGALGRYGFHDSVDFTPSRVREGELCAVVKNYYAHHHGMAIIAVNNVIFEGR
FT                   MRERFHSDPVIEAAELLLQEKAPREIPMIYAKTENPMRVDSGGFDDAPMRIVDKPFKAP
FT                   RTTHMMSNGQYALMVTANGSGYSRWHNWDITRFHADASEDLQGTFLFLRDMESGYWWSA
FT                   TGEPVRNPEEETKTVFTEDKAEFYKTAGDIKTVMEVIVSSESDGEGRRLDIINTSARDR
FT                   MIEVTSYAELVLTDSDSDAAHPAFAKMFVETEISDNGSTIYAKRRKRAPSDPDIHVAHF
FT                   VTDLSGSIRETEVETDRRAFVGRGRSLRDAAAFDQGAKFNGSQGCVLDPIASVRTRVRV
FT                   PAHKKVSLVFWTFAGGSRDAVEHAVALHRHPETFAREYSLSWTSSQVQLYHIGIKPAEA
FT                   ADYQKVAAYLLYPERTLRQPPETIASGLGKQSDLWPMSISGDYPIFALRIDNEADLDVL
FT                   RGVLRAQEYWRSKGLTVDVVAVNERAFSYAQDTQRAIDWIVEGFRARGGGQPHIFAVRR
FT                   DQMSDESYNTLLASARIVMHAQNGSLAEQLRRSEEITVDLAARDAKTAIGGQASAQMSA
FT                   QGLGAAGLAPVAIERGTEERRPVVKPVVNRPAPSGDDLRFWNGYGGFAEDGGYVVRVNN
FT                   RTNTPHPWINVIANPNFGFHVSAEGSAFTWAGNSRDYQLTPWANDPVTNRPGEAIYILD
FT                   RETGRTFAPTASVLRDEAVTYEARHGHGYSSFGAQHGELALDLTHIVDADKPVRLSRLT
FT                   VTNNGRSKRKLRVYGYVEWVLGNARSKNVPFIVPSQDEELGALFAGNPYHPDKSGQIAF
FT                   FAATEKPQSVTADRSEFIGTTGSVDKPEVVLAGKALSGTVEAGRDPCAALALDIEVGPG
FT                   EAREIVFLLGNAADQRQAKALIAETRKVSFGDKLAAARQQWEGLFDRVQVKTPDPAFDL
FT                   LVNGWLPYQAIACRIWARAAFYQASGAFGFRDQLQDTLSLLLIDPTLARAQILNAASRQ
FT                   FPEGDVQHWWLPATGAGVRTLISDDVVWLGYGASLYVETTGDRSILDEKLPFLEGRKLE
FT                   EGEHDAFYQPEISEQTASLYEHCALALDLAVERTGKHGLPLILGGDWNDGMNLVGVKGE
FT                   GESVWLGWFLAYTLGKFIPIAEARKDKKRVDIWKAHLESLTEALDRDGWDGQWYRRGFY
FT                   DNGAPLGSKDSDECQIDAIAQSWSVLSGVADPKRAEQAMASLEKYLLDDEGELLRLFTP
FT                   PFDRTIQEPGYIKGYPPGVRENGGQYTHGATWAILALARMGKTAEAWRLFSLISPVSHG
FT                   RNPDIYRVEPYVIAADIYSVEPRRGQGGWTWYTGSAGWFYRVATEGILGVTKRGDRLHL
FT                   DPALPPEWDGYEAELRFGEALYRVKVVVGAPSAKDKVVKLNGRKVGKPEEGVPIKPDGE
FT                   HEIVVELPKQK"
FT   gene            136225..137529
FT                   /locus_tag="Oant_0125"
FT   CDS_pept        136225..137529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0125"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="TIGRFAM: nicotinate phosphoribosyltransferase; PFAM:
FT                   Nicotinate phosphoribosyltransferase and related; KEGG:
FT                   bmb:BruAb1_0109 PncB, nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12856"
FT                   /db_xref="GOA:A6WV52"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV52"
FT                   /protein_id="ABS12856.1"
FT                   /translation="MAKTDIARRVYNHAWKLDPIVRSLLDTDFYKLLMLQMIWGLYPKV
FT                   DATFSLINRTTSVRLADEIDEGELRAQLDHARTLRFSKKEMIWLAGNSFYGRKQIFQPE
FT                   FLNWLHDFQLPEYDLRRKDGQYELHFHGPWSHTTMWEIPALAIINELRSRAAMKNLGPF
FT                   SLDVLYARAKAKMWSKVERLRQLPGLKISDFGTRRRHSFLWQRWCVEALKEGIGDAFTG
FT                   TSNVLLAMDTDLEALGTNAHELPMVLAALAKNDEELRSAPYRVLQDWNRYYGGNLLIVL
FT                   PDAFGTAAFLRNAPDWVADWTGFRPDSAPPIEGGERIIEWWKSRGKDPREKLLIFSDAL
FT                   DVDTIEETYRHFEGRVRMSFGWGTNLTNDFAGCAPKEIEGLNAISLVCKVTDANGHPAV
FT                   KLSDNPQKATGDPKEVARYLKFFGNEERVEQLVRV"
FT   gene            complement(137648..138478)
FT                   /locus_tag="Oant_0126"
FT   CDS_pept        complement(137648..138478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0126"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   bms:BR0113 phenazine biosynthesis protein, PhzF family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12857"
FT                   /db_xref="GOA:A6WV53"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV53"
FT                   /protein_id="ABS12857.1"
FT                   /translation="MDVLRIAAFSQGNQGGNPAGVLIADRLPSPQDMQKIAKDVGFSET
FT                   AFAAPEDDSWRVRYFAPEMEVPFCGHATIALGAALAMRMGDGRFALKLNNGDISVEGRK
FT                   EGELFAASLQSPPTRQRAANDAEVEQALALFSFEQDDLAPGLAPALIHAGADHIVLPLR
FT                   SREKLASMHYDMARGRILMKRQGWTTILLIYSETPKRFHSRNPFASGGVYEDPATGAAT
FT                   AAFAAYLRDSGWPHGGEIEVFQGEDMGSPSHLRAQIGNERGGSIRVSGTARLME"
FT   gene            complement(138544..139281)
FT                   /locus_tag="Oant_0127"
FT   CDS_pept        complement(138544..139281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0127"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bms:BR0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12858"
FT                   /db_xref="GOA:A6WV54"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV54"
FT                   /protein_id="ABS12858.1"
FT                   /translation="MAQNIYDRDDFFAAYSQLPRSVHGLEGAPEWPIVRSLLPDLTGRD
FT                   VADLGCGFGWFCRFAREQGAASLTGYDLSENMLERARHDTQDDAVRYIQADMEGLELPE
FT                   ASFDLVYSSLAFHYIRDFPRLLKAIHAALRPEGRFVFTIEHPIFMAPLTPGWIEEGNGQ
FT                   KRWPVDHYAVEGERRTDWLTEGVIKYHRRLSTSVNALIEAGFAINRLEEWHPSPEQIAA
FT                   WPALSDEMERPMLLIVSASRQTA"
FT   gene            complement(139285..139896)
FT                   /locus_tag="Oant_0128"
FT   CDS_pept        complement(139285..139896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0128"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mlo:mlr8191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12859"
FT                   /db_xref="GOA:A6WV55"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV55"
FT                   /protein_id="ABS12859.1"
FT                   /translation="MSIEFLLTSFIIVASPGTGVLVTLAAGLSRGARASVIAALGCTLG
FT                   IVPHMLAAVTGLAALLHTSALAFEVIKYAGVAYLLYMAWMTLKEHGTLKIETNDAPRSD
FT                   REVIWSAILVNLLNPKLSIFFFAFLPQFVNTQQGGTVARMVELSLVFMAMTFVVFAFYG
FT                   VFAAAVRNQIISRPAVLAWMRRSFAAAFVALGAKLALTER"
FT   sig_peptide     complement(139819..139896)
FT                   /locus_tag="Oant_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.463 at
FT                   residue 26"
FT   gene            complement(139977..140903)
FT                   /locus_tag="Oant_0129"
FT   CDS_pept        complement(139977..140903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0129"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bmb:BruAb1_0112
FT                   CscK, fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12860"
FT                   /db_xref="GOA:A6WV56"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV56"
FT                   /protein_id="ABS12860.1"
FT                   /translation="MILCCGESLIDMLPRETATGETAFQPFAGGSVFNTAIALGRLEVP
FT                   TGFFSGISSDFFGEVLRDNLARSNVDYSFAAISDRPTTLAFVRLVDGQARYAFYDENTA
FT                   GRMLAESDMPYVDDAIDAMLFGCISLISEPCGSVYEALMTREAPRRVMFLDPNIRAGFI
FT                   TNREKHLARMKRMIALADIVKLSDEDLAWFGEKGSHDEIAAEWLKLGPKLVVITKGAHG
FT                   ADAYTTKATVRVPGVKVDVIDTVGAGDTVNAGILASLHNQGLLDKDALAELTEDQIHSA
FT                   VALGVRAAAVTVSRAGANPPWAHEMKD"
FT   gene            complement(140991..141782)
FT                   /locus_tag="Oant_0130"
FT   CDS_pept        complement(140991..141782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0130"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bmb:BruAb1_0113 oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12861"
FT                   /db_xref="GOA:A6WV57"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV57"
FT                   /protein_id="ABS12861.1"
FT                   /translation="MSQVTKTDVAGSDTPKADTERKTLVLTGASRGIGHATVKRFSRAG
FT                   WRVITCSRQDFSDNCPWPAGPEDHIKVDLADQEDVGKAIAEIRRRLEADGSKLHALVNN
FT                   AGISPKAEGGRRMNSIETPMAVWRDVFQVNFLASIMLARGLFKELEAAHGSVVNVTSIA
FT                   GSRVHPFAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAILSPGTDKLVE
FT                   QLPMRRLGKTSEVAETIYFLCSEASSYVTGSEIHINGGQHV"
FT   gene            complement(142011..144323)
FT                   /locus_tag="Oant_0131"
FT   CDS_pept        complement(142011..144323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0131"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: bms:BR0117 penicillin-binding
FT                   protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12862"
FT                   /db_xref="GOA:A6WV58"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV58"
FT                   /protein_id="ABS12862.1"
FT                   /translation="MTSRDDKNRRIEPSFGGEEKKDDEVFRVDEEDRMARSQQRRRRQS
FT                   EEPEPRASRRGKKKPRGFFGFLRRSIYWCLVLGLWGGIAFAGMLVYFAAKMPPTTDWAI
FT                   PDRPPNVRIVDVNGNLIANRGTTGGEAVGLHEMSPFIPKAVIAIEDRRFYSHFGIDPIG
FT                   LARAVVTNVVSGRAVQGGSTLTQQLAKNLFLSPDRTLERKVQEVMLALWLEHKYTKDQI
FT                   LEMYLNRVYLGSGAFGVDAASRRYFSKPAKDVNLMEAATLAGLLKAPSRLSPARDPEAA
FT                   AARAKLVLGAMREEGMIDDSQMAIAESEPMTRAPSYWQGSENYVADKVVAELPELIGEA
FT                   KEDITVQTTIDLNLQRAGEEAIKDQISQSGTKMNASQGALVSIDSTGAVRAMVGGVDYA
FT                   TSQFDRVTDAHRQPASSFKPFVYLTALEQGRTPDSVRNDAPVRIGKWTPSNDNGKYMGQ
FT                   VTLATALSHSLNSVAAQLVMEVGPQTVIDTAHRLGVQSKLEANASLALGTSEVTLLELT
FT                   DAYVPFANGGYRAPVYFITKVTDSDGKVLYQKEDGVGPRVIDERNVGMMNAMLRRTVED
FT                   GTAKRAAFGWPAAGKTGTSQNFRDAWFVGYTANLTTGVWFGNDDGKGMKRVFGSTLPVA
FT                   AWKNFMKEAHKGVPVAELPGHYDIQNVVPGGSDGIDPNAPYDPGMMPQDSYGNQPMAAN
FT                   GDDGYWPPAPDSTARNSIQQSNETGRPLAEQPGATTYPANANDNYRPMPPGDVGGGQPQ
FT                   QPGKSTTLLDIIMGNSQ"
FT   gene            complement(144649..145338)
FT                   /locus_tag="Oant_0132"
FT   CDS_pept        complement(144649..145338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0132"
FT                   /product="porin"
FT                   /note="PFAM: porin; KEGG: bmb:BruAb1_0115 outer membrane
FT                   protein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12863"
FT                   /db_xref="GOA:A6WV59"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV59"
FT                   /protein_id="ABS12863.1"
FT                   /translation="MKFRILLGASLLAVVASTGAYAADAIVSQEPAPMAAPAFSWGGAY
FT                   IGGEIGWGWGRAKLDDKSTDQSNEFKPNGFIGGVYAGYNFDMGNNVILGVDGNFDYNDL
FT                   KKSHDYISNSNAVQTSAETKLQWSGAVRARAGYAVDRFMPYIAGGVAFGGVKNSLNVGG
FT                   SDYNNDKTLTGWTVGTGVDYAATDNVLLRLEYRYTDFGNKDFDLGNTATRGSFKTNDIR
FT                   LGVAYKF"
FT   sig_peptide     complement(145270..145338)
FT                   /locus_tag="Oant_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(145616..146305)
FT                   /locus_tag="Oant_0133"
FT   CDS_pept        complement(145616..146305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0133"
FT                   /product="porin"
FT                   /note="PFAM: porin; KEGG: bmb:BruAb1_0116 outer membrane
FT                   protein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12864"
FT                   /db_xref="GOA:A6WV60"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV60"
FT                   /protein_id="ABS12864.1"
FT                   /translation="MKLKALLLASTVALVAATGAKAADAVIEQEPVPVVVAPTFTWSGA
FT                   YIGGQIGYGWGKSDFSGDVYSFGNVKPDGFLGGIYAGYNFDLGNSIVLGIDGDVTYNDV
FT                   SKDIDVYSGDLAVGDFETKLRWSGAVRARVGYAVDRFMPYLAGGVAFGNIKNSGSIDGI
FT                   GSFSESKTLTGWTAGAGVDYAATDNLIVRLEYRYTDYGDKDIEFGGLNVNQDFKTNEVR
FT                   LGVAYKF"
FT   sig_peptide     complement(146237..146305)
FT                   /locus_tag="Oant_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            146557..147672
FT                   /locus_tag="Oant_0134"
FT   CDS_pept        146557..147672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0134"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rpe:RPE_4819
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12865"
FT                   /db_xref="GOA:A6WV61"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV61"
FT                   /protein_id="ABS12865.1"
FT                   /translation="MHDAKGMNGRVDWVDIAKGICIIFVVMMHSTLGVEKAAGAQGWMH
FT                   YVVAFAKPFRMPDFFMISGLFLSLVIDRPWRRYLDRKVVHFLYFYILWLTIQFTFKAPG
FT                   IASEAGVSGVVNAYLMAFIEPFGTLWFIYILPVFFIATRLLKHVPVGVTFTALAFLEIL
FT                   PIHTGWIMVDEFCSRFVYFYAGYAFAPAIFRAADWLRQRPLIGVAGLLVWGLIEYKLVF
FT                   MPVPESLAALISPASDLLDRRGAISDLPVVSLLLGLVGALAIISISSLLSLLSARNWLH
FT                   RGLSWLGAHSIVVYLAFFLPMAIARTALLKLGIGDIGTVSLLTTASGVIGPVILYGFIQ
FT                   WSGYGQFLFRRPGWAYIDQAPQKKTAATAAV"
FT   gene            complement(147678..148295)
FT                   /locus_tag="Oant_0135"
FT   CDS_pept        complement(147678..148295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0135"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: 3'-5' exonuclease; KEGG: bmb:BruAb1_0117 3-5
FT                   exonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12866"
FT                   /db_xref="GOA:A6WV62"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV62"
FT                   /protein_id="ABS12866.1"
FT                   /translation="MTIRFHKNDLPNLDNYQVDAVAIDTETLGLNPHRDRLCVVQISPG
FT                   DGTADVIQIEAGQKKAPNLVKLLKDRSITKIFHFGRFDLAVLAQAFGTMPQPVFCTKIA
FT                   SKLTRTYTDRHGLKELCNELLDVSISKQQQSSDWAAETLSAAQLEYAASDVLYLHRLKA
FT                   VLEQRLERDGRAKQAEACFKFLPTRSELDLMGWPEDDIFAHS"
FT   gene            complement(148306..149715)
FT                   /locus_tag="Oant_0136"
FT   CDS_pept        complement(148306..149715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0136"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bms:BR0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12867"
FT                   /db_xref="GOA:A6WV63"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV63"
FT                   /protein_id="ABS12867.1"
FT                   /translation="MSQQSSAQSLDKVLSHLDANLDQSLDRLFDLLRIKSISTDPAYKA
FT                   DCRKAAEWLVEDLKTIGFDASVRDTPGHPMVVAHHEGATPDAPHVLFYGHYDVQPVDPL
FT                   NLWENDPFDPAIKDVGNGRKILTGRGTSDDKGQLMTFVEACRAYKAINGNLPVKVTLLF
FT                   EGEEESGSPSLKPFLDANKQELKADVALVCDTAMWDAETPAISVGLRGLVGEEIVIKAA
FT                   DRDLHSGFFGGAAANPIHILTKILADLHDETGRVTVPDFYEGVEETPTQILKSWESLGR
FT                   TAENFLGPIGLSIPSGEKGRSVLELTWARPTAEVNGITGGYTGEGFKTVIAAEASAKVS
FT                   FRLVHKQDPVKIREAFRTFVKERLPADCSVEFHPHGGSPAIQLPYDSPLVSKAKNALSD
FT                   EWPKPAVLIAMGGSIPIVGDFDKFLGMESLLVGFGLEDDRIHSPNEKYELNSFHKGQRS
FT                   WARIMAAIAAK"
FT   gene            150127..153057
FT                   /locus_tag="Oant_0137"
FT   CDS_pept        150127..153057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0137"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bme:BMEI1825 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Exonuclease;
FT                   Helix-hairpin-helix domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12868"
FT                   /db_xref="GOA:A6WV64"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV64"
FT                   /protein_id="ABS12868.1"
FT                   /translation="MKKGDHLFLVDGSGYIFRAYHALPPLTRKTDGLPVGAVSGFCNML
FT                   WKLLKDARNTDVGVVPTHFAVIFDYSSKTFRNEIYPEYKANRTAPPEDLIPQFGLIRQA
FT                   TRAFNLPCIEKEGFEADDLIATYARIAEQAGGDVTIVSSDKDLMQLVTPSVSMYDSMKD
FT                   KQISIPEVIEKWGVPPEKMIDLQSLTGDSTDNVPGIPGIGPKTAAQLLEEFGDLDTLLA
FT                   RASEIKQNKRRENILAFADQTKISRELVTLKTDVPLDVDLDSLVLEPQNGPKLIGFLKA
FT                   MEFTSLTRRVAEATDTDASAVEPCHVETDWGADAHGPDVDVPAKADNAASQPTSAVAAS
FT                   DQGYTPKALAEKRATEAAAQTIDTSAYTCIRDIATLKLWLAEAVETGVLAFDTETTSLD
FT                   PMQAELVGFSLALAPGRAAYIPLQHKSGAGDLLGGGMVEGQIPLDEALAALKIVLEDAS
FT                   VLKIAQNMKYDWLVMRRHGINTVSFDDTMLISYVLDAGTGSHGMDPLSERWLGHTPIPY
FT                   KDVAGSGKSAVSFDMVDLDRATAYAAEDADVTLRLWQVLKPRLAAEGLMSVYERLERPL
FT                   VDVLACMEERGIAVDRQVLSRLSGDLAQAAAAYEDEIYELAGERFNIGSPKQLGDILFG
FT                   KMSLSGASKTKTGQWSTSAQVLEDLAAEGHPLPRKIVDWRQLTKLKSTYTDALPGFINP
FT                   ETKRVHTSYAMASTSTGRLSSSDPNLQNIPVRTAEGRKIRTAFIAEPGNKLVSADYSQI
FT                   ELRVLAHVADIAQLKQAFADGIDIHAMTASEMFGVPVEGMPSEVRRRAKAINFGIIYGI
FT                   SAFGLANQLSIPREEAGQYIRTYFERFPGIKDYMEATKAFARENGYVETIFGRRAHYPD
FT                   IRASNPQVRAFNERAAINAPIQGSAADIIRRAMIRMEDALAEQNLAARMLLQVHDELIF
FT                   EVPDNEVEKTIPVVRHIMENAAMPAVSLAVPLHVDARAAHNWDEAH"
FT   gene            153300..155234
FT                   /locus_tag="Oant_0138"
FT   CDS_pept        153300..155234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0138"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bmb:BruAb1_0121
FT                   ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12869"
FT                   /db_xref="GOA:A6WV65"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV65"
FT                   /protein_id="ABS12869.1"
FT                   /translation="MSLPETIAPALSGALAARGYNTLTAVQNAVLAPETLDADLLVSAQ
FT                   TGSGKTVAFGLAMANTILEGELRFSDAGAPLAMIIAPTRELALQVRRELEWLYADTGAR
FT                   IASCVGGMDIRTERRALERGAHIVVGTPGRLRDHITRDALDMSELRAVVLDEADEMLDM
FT                   GFREDLEFILGEAPKDRRTLMFSATVPKPIAQLAKRFQNDALRLTVQSETSQHADIDYV
FT                   AMPVPPHERDHAIINTLLYYDSQNSIIFCSTREAVKHMASRLSNRGFAVVALSGELSQA
FT                   ERNNALQAMRDGRARVCVATDVAARGIDLPNLDLVIHADLPNNPETMLHRSGRTGRAGR
FT                   KGTCVLVVPFSRRRTAERLLHMAKLDAQTVPAPSIAAVQAKTNERILNAEVFNQPVEEE
FT                   YQDLLKALTERYTPEQIAAAFLNREVASYPAAEEVSDAPVHPVGGKKPRDRFEKGERSD
FT                   RGDRFERGERRERGEPGERFDRNASFDGVWFSVSAGRKHRADPKWLLPLICKAGDVSKR
FT                   DVGSIKIFDNETRFEITASKADEFRRSVEERGTGEKGLVIRTAVAGAGGDAAPREGKGG
FT                   FKPRGDKSKEGGFRDGYKSDGYKGDRSKGDKWDKPRDFSRGDDFKKDGFKKGGKKPEGG
FT                   GYSKKRRGE"
FT   gene            complement(155332..157755)
FT                   /locus_tag="Oant_0139"
FT   CDS_pept        complement(155332..157755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0139"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bmb:BruAb1_0122 GyrB, DNA gyrase, B subunit;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12870"
FT                   /db_xref="GOA:A6WV66"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV66"
FT                   /protein_id="ABS12870.1"
FT                   /translation="MNSEAPAEYGADSIRVLKGLDAVRKRPGMYIGDTDDGSGLHHMVY
FT                   EVVDNAIDEALAGHATLVTVALNPDGSCTVTDNGRGIPTDIHKEEGVSAAEVIMTQLHA
FT                   GGKFDQNSYKVSGGLHGVGVSVVNALSIWLKLKIRRAGKIHEMSFTHGVADAPLVVTGD
FT                   AGAETGTEVSFLPSPDTFSMVEFDFDTLERRLRELAFLNSGVRIKLTDRRHADVVEHEL
FT                   HYDGGLVEFVKYIDQSKKSLLDEPIYIRSEKDGMTVEVAMWWNDSYHEKVLCFTNNIPQ
FT                   RDGGTHLAGFRGALTRQVTGYADASGMTKKEKVTLTGDDCREGLTAVLSVKVPDPKFSS
FT                   QTKDKLVSSEVRPVVESLVNEALSTWLEEHPAGGKIVVEKVIQAAAAREAARKARDITR
FT                   KSNLSVTSLPGKLADCQERDPAKSEIFIVEGDSAGGSAKSGRSRQNQAILPLRGKILNV
FT                   ERVRFDRMISSDQVGTLITALGTSIGKDETHGFNPDKLRYHKIIIMTDADVDGAHIRTL
FT                   LLTFFFRQMPELIERGHIYIAQPPLYKVSRGKSSQYIKNEAAFEDFLIETGLEEATLEM
FT                   ASGEVRAGTDLRSVVEDARTMRQLLAGLHTRYDRRVVEQAAIAGLLHPDASRDNATAQR
FT                   SADTVAKRLDMISEETERGWEAHVTEDGGYRFERMVRGVKDIAILDMALLGSADARQID
FT                   RVASRLSEVFAEPPVLRRKDKVETLSGPMGLLDAIFATGRKGLTLQRYKGLGEMNAEQL
FT                   WETTLDPNVRSLLQVKVTDATDADSLFSRLMGDDVEPRREFIQENALSVANLDV"
FT   gene            158026..159420
FT                   /locus_tag="Oant_0140"
FT   CDS_pept        158026..159420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0140"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mlo:mlr5192 similar to
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12871"
FT                   /db_xref="GOA:A6WV67"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV67"
FT                   /protein_id="ABS12871.1"
FT                   /translation="MEIANVMSERPVPFVPPAPRPREKPVGRFEMMRVVYKNPLELWGE
FT                   PSYNERWISVSWFGMKTIIANDPGLIRHVLVDNAANYPMSAIRQRVLRPLLRDGLLTAE
FT                   GQVWKRSRKAMAPVFTPRHIGGFAEAMRDRSLQFVERYKTPGTITDVAHDMTLLTYDIL
FT                   AETLFSGEIAGDPNDFAHQIDKLFETMGRVDPFDLLGLPDWLPRLTRLRGQQSLGFFRE
FT                   LVSNTIELRKTRMDRQEDVPSDFLTLLLRAEGPDGLSRSEIEDNIITFIGAGHETTARA
FT                   LGWTLYLLAKAPQERELIELEIDGFFAKGGRDLPPQEWLASLPFARAAFEEAMRLYPPA
FT                   PSINREAATDDTYDDLKIPKGATVLVMPWVIHRHRLYWDQPDAFMPERFWPENRDKLDR
FT                   FQYLPFGAGPRVCIGASFALQEAVIALAILLDGRRFEVLETTKPWPVQKLTTQPQGGLP
FT                   MKVMKR"
FT   gene            complement(159421..160302)
FT                   /locus_tag="Oant_0141"
FT   CDS_pept        complement(159421..160302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0141"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="TIGRFAM: S-formylglutathione hydrolase; PFAM:
FT                   putative esterase; KEGG: bmb:BruAb1_0124 esterase,
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12872"
FT                   /db_xref="GOA:A6WV68"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV68"
FT                   /protein_id="ABS12872.1"
FT                   /translation="MLRWCSEAEQNWKFSMKTISTAKCFDGTQGVYRHKSETNQCDMTF
FT                   AVFLPPQAKDGPVPVLWYLSGLTCTHQNVMDKGEYRQMAAELGIAVICPDTSPRGDDIP
FT                   DEPDNWQFGKGAGFYVNATQEPFAKNYQMYSYITKELTDLVGREFPLDMSRQAITGHSM
FT                   GGHGALTIALKNPDRFKSASAFAPIVQSSTADWSRPALEKYLGPEERAWRAYDATLLIE
FT                   DGYRFPEFLVDQGTADGFLDDGLRPWLLEEACKKAGIPLTLNMREGYDHSYFFISTFMD
FT                   DHLKWHAERLKS"
FT   gene            complement(160277..160933)
FT                   /locus_tag="Oant_0142"
FT   CDS_pept        complement(160277..160933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0142"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345; KEGG:
FT                   bms:BR0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12873"
FT                   /db_xref="GOA:A6WV69"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV69"
FT                   /protein_id="ABS12873.1"
FT                   /translation="MFLLRRHMSFYLGALGGVATFIIAWLFKSPLAPVIGANCFFVLYL
FT                   GLAASALPKLTTSFLKKHAASADEPIWIIFLVTFATVLVAIVSLFILINGEKKADTFSL
FT                   VMTLASVPLGWFTIHMMTAIHYAHMYWQPGEPAGDDTSHASRYRGGFEFPGTPEPSGWD
FT                   FAYFAYVIGMTAQTSDTSVTTPAMRKVTLLHSIVSFFFNTVLVAASVNVAVVLGS"
FT   gene            complement(160933..161406)
FT                   /locus_tag="Oant_0143"
FT   CDS_pept        complement(160933..161406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0143"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bms:BR0129 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12874"
FT                   /db_xref="GOA:A6WV70"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV70"
FT                   /protein_id="ABS12874.1"
FT                   /translation="MSEKLLVSQWDELDNLSPRALYAMLKLRVDVFVVEQKCPYPEIDG
FT                   KDFEAFHLRILDGEELAASLRVLPPEQAGKPVKIGRVVVAPDYRGYKLGQRLMKEAIDF
FT                   AHARFPGIAIELGGQSHLQKFYGSFGFVAISEEYLEDGIPHVDMRLEPREKVA"
FT   gene            complement(161406..162518)
FT                   /locus_tag="Oant_0144"
FT   CDS_pept        complement(161406..162518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0144"
FT                   /product="Alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase"
FT                   /note="TIGRFAM: Alcohol dehydrogenase class
FT                   III/S-(hydroxymethyl)glutathione dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: bme:BMEI1819
FT                   alcohol dehydrogenase class III"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12875"
FT                   /db_xref="GOA:A6WV71"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV71"
FT                   /protein_id="ABS12875.1"
FT                   /translation="MKSRAAVAWEAKKPLTIETVEIGGPRAGEVLVEIMATGVCHTDAY
FT                   TLSGLDSEGKFPAILGHEGAGIVREVGAGVTSVKPGDHVIPLYTPECRQCKTCLSQRSN
FT                   LCTSIRATQGQGLMPDKTTRFSCDGGEVFHYMGCSTFSNFTVLPEIAVAKVREDAPFDK
FT                   ICYIGCGVTTGIGAVIYTAKVRPGSNVVVFGLGGIGLNVIQGARMVGADKIIGVDINPS
FT                   KVEMAKKFGMTDFINPREVGNDKVVQAIQDLTDGGADYSFDATGNTDVMRQALECCHRG
FT                   WGESIIIGVAEAGKEIATRPFQLVTGRVWKGTAFGGARGRTDVPKIVDWYMDGKINIDD
FT                   LITHTMPLDEINTAFDLMHEGKSIRSVIVY"
FT   gene            complement(162560..162829)
FT                   /locus_tag="Oant_0145"
FT   CDS_pept        complement(162560..162829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0145"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bms:BR0131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12876"
FT                   /db_xref="GOA:A6WV72"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV72"
FT                   /protein_id="ABS12876.1"
FT                   /translation="MPHSPEDKKRALTRLRRIRGQAEALERAVEAGTECAALLQQIAAL
FT                   RGAANGLMAEVLESHFRETFGQETKADPDTQIDEIMRILRTYLK"
FT   gene            complement(162876..163319)
FT                   /locus_tag="Oant_0146"
FT   CDS_pept        complement(162876..163319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0146"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pau:PA14_45980 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12877"
FT                   /db_xref="GOA:A6WV73"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV73"
FT                   /protein_id="ABS12877.1"
FT                   /translation="MIHIRKSNRADAPALTEIWRASVLATHDFLSRDDFLEIEKLVAEQ
FT                   YLPNVEVWLIEDAGKPVGFMGMSEHHIDSLFIAPDQRGKGIGKQMIAHAKTLGSPLTVD
FT                   VNEQNLQGVGFYRHMGFVETGHSETDDQGRPYPLLHLRLATNN"
FT   gene            163376..165832
FT                   /locus_tag="Oant_0147"
FT   CDS_pept        163376..165832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0147"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="TIGRFAM: ATP-dependent helicase HrpB; PFAM: helicase
FT                   domain protein; helicase-associated domain protein;
FT                   DEAD/DEAH box helicase domain protein; Helicase
FT                   ATP-dependent domain protein; SMART: DEAD-like helicases;
FT                   KEGG: mlo:mlr5306 ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12878"
FT                   /db_xref="GOA:A6WV74"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV74"
FT                   /protein_id="ABS12878.1"
FT                   /translation="MTSLPDLPVTRILPQLDEALAHHASAVLVAPPGAGKTTLVPIHML
FT                   NADWRKDGTIVLLEPRRLAARAAARRMAQLLGEEPGETVGYRMRLESKVSGKTKILVVT
FT                   EGVFARMILDDPDLKGVAAVLFDEFHERSLDADFGLALALDVQAALRDDLKIIVMSATL
FT                   DGARVAQLLGDAPVIESEGRAYPVDIRYRDRKADERVEDAMVRTIRDALANETGSILAF
FT                   LPGQGEIERTAGILEKLLPANIILAPLYGAMEGRDQDAAIKPLPTGHRKVVLATSIAET
FT                   SITIDGVRVVIDSGLARQPKYEPATGLTRLETVRTSRASADQRAGRAGRTEPGIAIRLW
FT                   HQGQTASLPAFSPPEILEADLSGLVLDAAAWGVTDPAILSLLDKPPAPALKEAKALLMR
FT                   LGALDEAGRLTPDGEAMRSLALPARLAHMVAEAGKRGEVQKAAELAVLLTERGLGGNET
FT                   DLDTRMSRFRNDRSDRAQRAKGLARRLAANVPNKGEVAGSSVGRMLIDAYPDRIAKARG
FT                   QMGQFLLANGRGGEVDPAISLSRAPWLVVADMSGRAGRARILSAAEVSETEIRAALGNR
FT                   IESGRQVVYDAEKNALRAREAVRIGAIALSEKPLAAPSGAAADEGVIAAVREHGLDILP
FT                   WGKETDILRRRLGWLHRGLGDPWPSMDSDHLIERLDDWLLPFLTGEAQLDRIPGHVLKN
FT                   GLMSLVPFDLQRSVDQLAPTHFEVPTGSNIPIRYDAEEPVIAVRVQELFGLGVHPAIAN
FT                   GKVPLLLELLSPAHRPIQITRDLPGFWKGSWADVRADMRGRYPKHVWPEDPANAEATRR
FT                   AKPRGT"
FT   gene            165913..167205
FT                   /locus_tag="Oant_0148"
FT   CDS_pept        165913..167205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0148"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bmb:BruAb1_0130
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12879"
FT                   /db_xref="GOA:A6WV75"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV75"
FT                   /protein_id="ABS12879.1"
FT                   /translation="MHAEFENRASNLSRRPRLTTLIRVRWLAIAGQTAAVMFVALYLQF
FT                   PFAVGICFALIACSAWLNLYLAFRFPTNHRLNPAAASLVLAFDVLQLAGLLYLTGGLQN
FT                   PFIILMIVPVIISATSLSARHTLVLALLVVACTSVLTIRHEPLPWYPGETLDLPFLFVI
FT                   GIWCAIISALGFTGVYAYRIAEEARQLGDALSAAELILQREQHLSALDGLAAAAAHELG
FT                   TPLATIALVVKEMQRARTTDPGLAEDIALLHSQTQRCREILQRLTSLSSEGEEHMSRLP
FT                   LSSLIEEVIAPHRNFGITIDVQKTEGPKPEPVTRRNPGLLYGLGNLVENAVDFARGTVN
FT                   VTWGWTDGNVSVTIQDDGEGFKPEILDRIGEPYMTSRDNTRNGGGLGLGLFIAKTLLER
FT                   SGAHITFRNRNNPGQGAEVKVVWPRSAFTSG"
FT   gene            167219..167638
FT                   /locus_tag="Oant_0149"
FT   CDS_pept        167219..167638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12880"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV76"
FT                   /protein_id="ABS12880.1"
FT                   /translation="MTIPLEIQRATEEFDKFLHMARDEAGLATRNQAYTMVEAVLLTFR
FT                   HRLEVDQAIRFATILPTVLRAVFVANWDIGEAKQPFLSRQALTCEVQSLRKDHNFAPDS
FT                   AIYDVAKALRAHIDQVELDSFLAGLSAEARQYWAI"
FT   gene            167836..168399
FT                   /locus_tag="Oant_0150"
FT   CDS_pept        167836..168399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0150"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bmb:BruAb1_0134 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12881"
FT                   /db_xref="GOA:A6WV77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV77"
FT                   /protein_id="ABS12881.1"
FT                   /translation="MDDLKQEDTEAIGNDPTLLLVDDDKPFLQRLARAMESRGFQVTTA
FT                   ESVEEGIAAAKAAAPAYAVVDMRLGDGNGLDIIEAIRSRRADTRAIVLTGYGNIATAVN
FT                   AVKLGAIDYLSKPADADEVFAALTRRPGEKVAPPENPMSADRVRWEHIQRVYEMCERNV
FT                   SETARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(168414..168908)
FT                   /locus_tag="Oant_0151"
FT   CDS_pept        complement(168414..168908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0151"
FT                   /product="protein of unknown function DUF1052"
FT                   /note="PFAM: protein of unknown function DUF1052; KEGG:
FT                   bms:BR0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12882"
FT                   /db_xref="GOA:A6WV78"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV78"
FT                   /protein_id="ABS12882.1"
FT                   /translation="MPIVIPNQTHPLSDGRQSENAMLVRRGVQRLFLEMGLATLPELPL
FT                   ASGRRADLMAVNRKGEIWIVEIKSSIEDWKADHKWPEYRAYCDRLFFATHPAVPREIFP
FT                   QECGFILSDGYGAEIMRDAPEHKLPGATRKALMLRFARAGAARLTIAELAGLDVPETEI
FT                   D"
FT   gene            169144..169764
FT                   /locus_tag="Oant_0152"
FT   CDS_pept        169144..169764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0152"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bmb:BruAb1_0136 lipoprotein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12883"
FT                   /db_xref="GOA:A6WV79"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV79"
FT                   /protein_id="ABS12883.1"
FT                   /translation="MNSRVLKLTTALFLTGALAGCSTVGGTFYTASYSSVTDAGYVVPA
FT                   IPSEKIQAQYRRQIVKYPTDEAPGTIIVDTREKFLYLIMPEGKAMRYGIGVGREGFEWS
FT                   GTARVAMKREWPTWTPPSAMIKRQPELAKYRNGMDPGLRNPLGARALYLYNKGGDTGYR
FT                   LHGTPEWWSIGKAMSSGCIRLMNQDIMDLYDRTEQGAKVIVKQ"
FT   sig_peptide     169144..169221
FT                   /locus_tag="Oant_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.281 at
FT                   residue 26"
FT   gene            complement(169833..170405)
FT                   /locus_tag="Oant_0153"
FT   CDS_pept        complement(169833..170405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0153"
FT                   /product="Scaffold protein Nfu/NifU"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; Scaffold
FT                   protein Nfu/NifU; KEGG: bmb:BruAb1_0137 NifU-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12884"
FT                   /db_xref="GOA:A6WV80"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV80"
FT                   /protein_id="ABS12884.1"
FT                   /translation="MFIQTETTPNPATLKFLPGKVVMPEGTADFRDASTAGNTSPLAAK
FT                   LFSVPGVTGVFFGYDFITVTKEDGEWQHLKPAILGTIMEHFMSGAPAMAGNSNADAAAA
FT                   HGEEEFFDEADAETVEIIKELIETRVRPAVAQDGGDITFRGFENGTVFLNMKGACSGCP
FT                   SSTATLKHGIQNLLRHFVPEVQQVEQI"
FT   gene            complement(170516..171004)
FT                   /locus_tag="Oant_0154"
FT   CDS_pept        complement(170516..171004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0154"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bmb:BruAb1_0138
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12885"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV81"
FT                   /protein_id="ABS12885.1"
FT                   /translation="MVSKRLSREAGHRRKFLAVIDETPECGRAVAYAARRAKNTGGSLI
FT                   LLFVIDDSDFQQILGVGEIMRSEAQERARAALEKFAATVRAAQGIEPEINIREGETASE
FT                   LISLIEEDQDIAILVLAAGSGKEGPGPLVQSLASRSQFPIPVTVIPAGMSDDDIDAVT"
FT   gene            complement(171136..172203)
FT                   /locus_tag="Oant_0155"
FT   CDS_pept        complement(171136..172203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0155"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; KEGG: bms:BR0142
FT                   tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12886"
FT                   /db_xref="GOA:A6WV82"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV82"
FT                   /protein_id="ABS12886.1"
FT                   /translation="MSTFKPLVFSGVQPTGNLHLGNYLGAIKRWVEVQETQECIYCVVD
FT                   MHALTISPDPAELMQSTREVTAAFLAAGIDPKRSIVFNQSRVMQHAELAWVFNCIARIG
FT                   WMSRMTQFKDKAGKDRENASLGLFAYPSLMAADILLYRATAVPVGEDQKQHLELTRDIA
FT                   QKFNNDYSDRIASLGVGVDMQVGDEQVSGFFPMTEPMISGPAMRIMSLRDGTKKMSKSD
FT                   PSDLSRINLIDDEETITKKIRKAKTDSDGLPTELDGLAGRPEADNLVGIYAALSSQSKE
FT                   DVLNEFGGRQFSEFKASLADLAVAKLSPITHEMRRLVADPAYIDSVLRDGGERAGVIAE
FT                   QTMRHVRDIVGWLQN"
FT   gene            complement(172298..173887)
FT                   /locus_tag="Oant_0156"
FT   CDS_pept        complement(172298..173887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0156"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: bmb:BruAb1_0140 MviN, virulence
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12887"
FT                   /db_xref="GOA:A6WV83"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV83"
FT                   /protein_id="ABS12887.1"
FT                   /translation="MSLVKKFATVASGTLMSRIFGFTREMFMAAALGTGPVADAFNAAF
FT                   RFPNTFRRLFAEGAFNSAFVPLFAKEIEKNGMDGARRFSEEVFGVLFTVLLFLTIVMEL
FT                   SMPFIVRTIIAPGFTDDPVKFDNTVRLAVIMFPYLACMSLAAMMGGMLNSLHRYFAAAI
FT                   APVFLNIILIGVLAFAWWRGYDALSVGYGLSWGVMAAGLVQLAIVWIAVRNAGIKIGFR
FT                   RPRLTSNVKRLLVLALPAAITGGITQINLLINTNIASGMEGAVSSLVYADRIYQLPLGV
FT                   VGIAVATVLLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLF
FT                   ERGKFSPDSTLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVAVNVS
FT                   LAITLFPHFGPTGIATAEIVAGWVNAILLFAMLVKRGHWGRDIPLLTRIPRLLIAAAIM
FT                   AFGIHYAIGHFAYELSSAAPLALRAGTVTAIVVAAMVVYFGLAFGLGGANTGMIRRNIK
FT                   RGAAKKAPESEQ"
FT   sig_peptide     complement(173822..173887)
FT                   /locus_tag="Oant_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.625) with cleavage site probability 0.259 at
FT                   residue 22"
FT   gene            complement(173900..176704)
FT                   /locus_tag="Oant_0157"
FT   CDS_pept        complement(173900..176704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0157"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: bmb:BruAb1_0141 [protein-pII]
FT                   uridylyltransferase, hypothetical; TIGRFAM: protein-P-II
FT                   uridylyltransferase; PFAM: amino acid-binding ACT domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain;
FT                   GlnD PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12888"
FT                   /db_xref="GOA:A6WV84"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV84"
FT                   /protein_id="ABS12888.1"
FT                   /translation="MSAHDLKLEEIVNPETLRRKLNELADSTDENYTSPTVRKVVLQAL
FT                   KDALVRGRANAEGMLMKDGGGTLCAKRLSFLMDTLIEALFEFATTKAYPMINPSKAENM
FT                   AIVAVGGYGRGGLAPGSDIDLLFLLPYKQTPWGEQVVEYMLYMLWDMGLKVGHSTRNID
FT                   ECIRLSREDMTIRTAILDARFLTGNRELFKTLVTRFDEEIVKDTGPEFIQAKLAERDQR
FT                   HRKAGETRYLVEPNVKEGKGGQRDLHTLFWITKYFYRVKTKEELVKLGVLSRAELKLFN
FT                   KAEDFLWAVRCHMHFATLKAEERLSFDIQPEIAQRLGYTAHPGQNYVERFMKHYFLVAK
FT                   DVGDLTRIISAALEEQQAKHVPGFNRIFLTFSRRKRKLSADGDFVSENHRINIARPEVF
FT                   KEDPVNIIRLFHLADKHGLEFHPEAMQSLTRSLKLINSDLRENPEANKLFLEILTSPRN
FT                   PELILRRMNESGVLGKFIPDFGKIVAMMQFNMYHHYTVDEHLLRCIAVLSEIEHGELEN
FT                   EHPLSNHLITTVKRDRNLLYVALLLHDIAKGRPEDHSVAGARIARRLGPRLGLTPTETE
FT                   TVEWLVREHLTMSMVAQSRDLNDRKTIIDFADTVQTMERLKLLLILTVCDIKAVGPGVW
FT                   NGWKGQLLRTLFYETELVLTGGFSELSRADRDHQAREALADRLSDWPKDKRDAYLALHY
FT                   TNYFLTVSLEDQVRHAHFIREADRNERALATMAKPHTFEAVTEITVLAPDHPRLLSIIT
FT                   GACAAAGANIVDAQIFTTGDGRALDTILISREFDTDDDERRRAERVGKVIEDVLSGKAH
FT                   LPDVLAKRTKPKRAAKAFKVEPRVEINNTLSNKFTVIEVEGLDRPGLLSELTGLISDLS
FT                   LDIASAHITTFGEKVIDSFYVTDLVGHKISNATRQGNIRRKLLGVLSGENGSKTNGRSS
FT                   QAAA"
FT   gene            complement(176838..179132)
FT                   /locus_tag="Oant_0158"
FT   CDS_pept        complement(176838..179132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0158"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   rle:RL0407 putative NADP-dependent malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12889"
FT                   /db_xref="GOA:A6WV85"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV85"
FT                   /protein_id="ABS12889.1"
FT                   /translation="MPASTPKGNTSERAPTASEKEALDFHAHGRPGKLEINPTKPMTTQ
FT                   RDLSLAYSPGVAVPVKAIAEDAARAYDYTAKGNLVAVISNGTAILGLGNLGALASKPVM
FT                   EGKAVLFKRFADVDSIDLEVDTTDIDAFINAVRYLGPSFGGINLEDIKAPDCFIIEQRL
FT                   RELMDIPVFHDDQHGTAIIAAAGLINALHLTGRDMKTTKLVCNGAGSAGIACIELIKAM
FT                   GFASENVILCDTKGVVYQGREEGMNQWKSAHAVKTDKRSLADAMNGADVVFGLSAKGAF
FT                   TEDMVRSMAPNPIIFAMANPDPEVTPEEVARIRDDAIVATGRSDYPNQVNNVLGFPYIF
FT                   RGALDVRATTINDAMKIAAVNALAELAREDVPDDVVAAYQGSRPRFGSSYIIPVPFDPR
FT                   LLASVSAAVARAAMETGVAGRAIADIEGYKRELSARRDPIASTLRGIYERVRRQPKRIV
FT                   FAEGEEEQVMRAAVSYVNQGLGTAILVGREERVRDTAKAAGLDLDRPGIEIINARLSSR
FT                   NAAYADYLYEKLQRKGYLTRDCHRLINNDRNHFAACMVALGDADGMVTGVTRNYATGLD
FT                   DVRRVIDSKPGHRMVGVSIALCRGRTVFIADTAVHEMPTAAELADIAVEAAGMARRMGY
FT                   VPRVALTAFSTFGHMGGERSARIQEAVRILATRHVDFEFDGEMSADVALNPKLMEQYPF
FT                   IRLSGPANVIVTPDNHSASIAADMLQELGGATIIGPLLVGLDKPAQIVTIGAKDSDIVN
FT                   MAAITAYNATN"
FT   gene            179288..182020
FT                   /locus_tag="Oant_0159"
FT   CDS_pept        179288..182020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0159"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein; KEGG: bme:BMEI1801 DNA mismatch repair protein
FT                   MutS"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12890"
FT                   /db_xref="GOA:A6WV86"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV86"
FT                   /protein_id="ABS12890.1"
FT                   /translation="METTANEHGSEAEENTAEAAPVRLTPMMEQYIEIKAANVDSLLFY
FT                   RMGDFYELFFDDAVEASAALGITLTKRGKHLGEDIPMCGVPVHAADDYLQKLIAKGYRV
FT                   AVCEQVEDPAEAKKRGSKSVVKRDVIRLVTPGTLTEEKLLDPSEANFLMAMGRTRGDGA
FT                   LALAWIDISTGTFRVAETTPDRLFADVMRVDPRELVVADSAFHDEELRPVFDLVGKAVT
FT                   PQPATLFDSAAAETRIQRYFNVATLDGFGQFSRPELSAISGAIAYIEKTQISERPPLMR
FT                   PEREHEGGTLFIDPATRASLELARTMSGNRDGSLLKAVDRTVTGGGARLLAERLTAPLT
FT                   NPKEIALRLDSVSWFLSEQSLCEAMRAELKGVPDMPRGLSRLAVGRGGPRDLGSLARGF
FT                   EAAHVIASLLESALLPDELAHARDAVSAMPAIFTAHLDRALADELPLLKRDGGFVRGGY
FT                   NSELDEMRALRDQSRRVIAGLQANYIEETGIKSLKIKHNNVLGYFIEVTANNAGAMTDT
FT                   DEAKSRFIHRQTMANAMRFTTTELAELESKIANAADRALSIELAVFEELTAEAVSHADS
FT                   IRAAASALAVFDVSASLAVLAEEQGYCRPQVDDSLSFNIVAGRHPVVEQALRRQAANPF
FT                   VANDCDLSPQADGGNGAIWLLTGPNMGGKSTFLRQNALIAIMAQMGSFVPAGSAKIGVV
FT                   DRLFSRVGASDDLARGRSTFMVEMVETAAILNQAGERSLVILDEIGRGTATFDGLSIAW
FT                   AAVEYLHEKNRCRALFATHFHEMTALSEKLERLSNVTMRVKEWDNDVVFLHEVAKGAAD
FT                   RSYGVQVARLAGLPEAVVNRARDVLHQLEAGETSGKADKLIDDLPLFSVVLQQEKPKLQ
FT                   VQGKDSDLTKAVSAISPDELTPREALDLIYKLKELAGRA"
FT   gene            complement(182187..183080)
FT                   /locus_tag="Oant_0160"
FT   CDS_pept        complement(182187..183080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12891"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV87"
FT                   /protein_id="ABS12891.1"
FT                   /translation="MTVLLGMDQQIIDDTVMSGLEAQQALFASNGDPIVLGRIGSLEVR
FT                   LANSREAVEAAQELRFRVFFDEMGARRESIEAVELRDADRFDAICDHLLVYDTALPVPE
FT                   HQQIVGTYRLMRSDQAEQALGFYSADEYDVQRLALSRPNLRLLELGRSCVKAEYRSKRT
FT                   VELLWQGAWAYCRRHSIDVMFGCASFHGAVPAAHALGLSFLHHNCRATDDWDVRALPNR
FT                   YQAMDLMPKEAINNKVALFSMPPLVKGYLSLGAMIGDGAVIDEAFGTTDVFIILPIERI
FT                   SSRYITYYGAEANRFV"
FT   gene            complement(183355..183837)
FT                   /locus_tag="Oant_0161"
FT   CDS_pept        complement(183355..183837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0161"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: bmb:BruAb1_0145
FT                   LspA, lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12892"
FT                   /db_xref="GOA:A6WV88"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV88"
FT                   /protein_id="ABS12892.1"
FT                   /translation="MKRHAVWSSLFVVVLTILIDQGVKHLVETRMGYGQQIDLLPFLAL
FT                   FRTHNEGIAFSMLAWLHDWGLVAITAAVILFVLYLWWTNAPDRIFARYGFALVVGGAIG
FT                   NLIDRVMHGYVVDYILFHLPTWSFAVFNLADTFITIGAGLIILEEFLGWRRERAAR"
FT   gene            complement(183834..184718)
FT                   /locus_tag="Oant_0162"
FT   CDS_pept        complement(183834..184718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0162"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   bms:BR0150 RNA methyltransferase, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12893"
FT                   /db_xref="GOA:A6WV89"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV89"
FT                   /protein_id="ABS12893.1"
FT                   /translation="MSRDDDFSKGGSRAEYSKVGQVKEVTSLTNPIVKDLRSLALKKFR
FT                   DQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKMVEQVAARTFAKGGLVLEVTEK
FT                   IMAAITRRDNPQMVVGVFEQQYRPLANLKPKNNDVYIALDRVRDPGNLGTVIRTADAVG
FT                   AKGIILIGDTTDPYSLETVRATMGSVFSMPLYKVTEADFLNWRKDISGLVVGTHLKGAV
FT                   DYRTIPYANKPVVLMMGNEQQGLPDSLADTCDKLARIPQAGRADSLNLAIATGVMLYEI
FT                   RRDALTLDERVSG"
FT   gene            complement(184715..185875)
FT                   /locus_tag="Oant_0163"
FT   CDS_pept        complement(184715..185875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0163"
FT                   /product="conserved hypothetical protein 95"
FT                   /note="PFAM: conserved hypothetical protein 95; KEGG:
FT                   bmf:BAB1_0150 SAM dependent methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12894"
FT                   /db_xref="GOA:A6WV90"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV90"
FT                   /protein_id="ABS12894.1"
FT                   /translation="MKAPKGKGKKPSGGKQDRRFERARHDAPRSESKFEGRFDGKSDNK
FT                   GSSFKKPRPQFAKAAPKPVDDKPATPLREIKPYAGARPGERLPLILETEPSPDYALLDS
FT                   GNGLKLEQYGPYRIVRPEGQAIWLPSLPQREWDQADAVFTGNTDEEGMGRWAFPKVPLG
FT                   ETWPMQHDGISFHGRFTSFRHVGVFPEQAAHWSYMDGLIRDGVKSGRSVKVLNLFGYTG
FT                   VASLVAARAGAEVTHVDASKKAILWARENQEMAGLSDKPIRWICEDAMKFVQREERRGS
FT                   FYDIILLDPPAYGRGPSGEVWQLFEHLPAMVDTCRSILTPKPLAVILTAYSIRASFFAI
FT                   HELMRDRFTGLGGTVESGELILRERSADQSGGRALSTSMFSRWVAK"
FT   gene            complement(186012..186335)
FT                   /locus_tag="Oant_0164"
FT   CDS_pept        complement(186012..186335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12895"
FT                   /db_xref="GOA:A6WV91"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV91"
FT                   /protein_id="ABS12895.1"
FT                   /translation="MAAKRIIAIIVLVPLAVALIALSVANRASVQFTIDPFNPGNPALS
FT                   YNAPLFLWLFGALLLGVVIGSLVTWLTQGKHRRKERMYKQEAARLLERSTAAEKRNMPV
FT                   VNS"
FT   sig_peptide     complement(186249..186335)
FT                   /locus_tag="Oant_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.365 at
FT                   residue 29"
FT   gene            complement(186344..186628)
FT                   /locus_tag="Oant_0165"
FT   CDS_pept        complement(186344..186628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0165"
FT                   /product="integration host factor, beta subunit"
FT                   /note="TIGRFAM: integration host factor, beta subunit;
FT                   PFAM: histone family protein DNA-binding protein; KEGG:
FT                   bms:BR0153 integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12896"
FT                   /db_xref="GOA:A6WV92"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WV92"
FT                   /protein_id="ABS12896.1"
FT                   /translation="MIKSELVQIIASRNPHLFQRDVENIVGAVFDEITNALAEGNRVEL
FT                   RGFGAFSVKNRPARSGRNPRTGETVDVEEKWVPFFKTGKELRDRLNGAV"
FT   gene            complement(186703..187674)
FT                   /locus_tag="Oant_0166"
FT   CDS_pept        complement(186703..187674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0166"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: bmb:BruAb1_0150 SppA, signal
FT                   peptide peptidase SppA"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12897"
FT                   /db_xref="GOA:A6WV93"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV93"
FT                   /protein_id="ABS12897.1"
FT                   /translation="MAQDAEAIIERRKLRRKLTIWRGAFLLLIAALIAVFASWSMRGTN
FT                   FNQPHIAKVRIEGTIFENEELLKRLDKIAKDDAVKGVILVLDSPGGTTVGGEAIFEAVR
FT                   KIAEKKPVVTQVGTLAASAGYMIASASDHIVARQTSIVGSIGVLFQYPDVSKLLDTIGV
FT                   KVETIKSSPLKAEPNYFSPASEEAKGMIRNMIMDSYAWFVDIVEKRRSFTHEQALALAN
FT                   GAVFTGRQALDKKLIDGLGGEEEAVAWLASKGLSKDLPRLEWKPVSSETGFSLRDLIIH
FT                   AGARLLRVPQEADGMLKQIAKERIFLDGLLSVWHVDGTPEAN"
FT   sig_peptide     complement(187561..187674)
FT                   /locus_tag="Oant_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.532 at
FT                   residue 38"
FT   gene            188133..188846
FT                   /locus_tag="Oant_0167"
FT   CDS_pept        188133..188846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0167"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bmb:BruAb1_0151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12898"
FT                   /db_xref="GOA:A6WV94"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV94"
FT                   /protein_id="ABS12898.1"
FT                   /translation="MTADTTDSHAPQNATAQGRGTGGMRFGASEKAETLFHAAQRHSIR
FT                   VRVLKTALPVAAIIVGAVFSWYTFLATPNAPVKVEVNNGGESGKLVMTSPHLNGYTKDN
FT                   RPYSMTASKATQDAKNSGAISLEGISAELPVGDKGTAKVEATSGVYDNANGRLQLDKDF
FT                   TVTTDDGLRAVLRSADVNLKSGQITTDKPVDIRSGSTHILADSMQVKDNGKVLIFENKV
FT                   RMTVDGSVVSPNKAP"
FT   gene            189128..189778
FT                   /locus_tag="Oant_0168"
FT   CDS_pept        189128..189778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0168"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: bmb:BruAb1_0152
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12899"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV95"
FT                   /protein_id="ABS12899.1"
FT                   /translation="MERETGKMNKGTMARTLRMGFAVLALGIVAAPTVSLAQEGAAVNG
FT                   LKLSNSKAPVKIDADKLEMRDKEGIAIFTGNVAVSQGDALLKAGQMTVYYNKAKKDGEA
FT                   PAPEPTSAGVGGLDSSSIDHIDISGKVYLKSGTQVATGDTGRYDAKNQVMVLQGQKVVL
FT                   TDGDNVVTGCKLTAHLDTGRANVESCKGQTKGRVSIIMAPKDQQQGGAAPKQN"
FT   sig_peptide     189128..189241
FT                   /locus_tag="Oant_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 38"
FT   gene            189790..190629
FT                   /locus_tag="Oant_0169"
FT   CDS_pept        189790..190629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0169"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bmb:BruAb1_0153 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12900"
FT                   /db_xref="GOA:A6WV96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV96"
FT                   /protein_id="ABS12900.1"
FT                   /translation="MGLFWNKKADGPQDASQNVNAPSDVAGAMPGQPGKSTRLKGTLVA
FT                   RGLCKSYRGRQVVNGVSFGVRAGEAVGILGPNGAGKTTCFYMVTGLVPADAGSIEIDGF
FT                   DVTSMPMYRRSRLGIGYLPQEASIFRGLSVENNIKAVLEVVEKDRSKRASELDALLEEF
FT                   HIAHLRKAPAISLSGGERRRLEIARALASRPNFMLLDEPFAGVDPIAVSDIQQLVRHLT
FT                   SRGIGVLITDHNVRETLGLIDRAYIIHAGQVLTHGRPAEIVANPDVRRLYLGDQFTL"
FT   gene            190992..192533
FT                   /locus_tag="Oant_0170"
FT   CDS_pept        190992..192533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0170"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: bmb:BruAb1_0154
FT                   RpoN, RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12901"
FT                   /db_xref="GOA:A6WV97"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV97"
FT                   /protein_id="ABS12901.1"
FT                   /translation="MALSPKLDFRQSQSLVMTPQLMQSIKLLQMTHMELEQFLDIEIEK
FT                   NPLLDRIEAANDDFSGAESARDGAETGGEDAASDDLSDGDWFKTGASDNAENLSSTFDS
FT                   SLENIFPDDPGRFDEIGPDLAAQWKSSVGDGYVSGGSYDIDQVTASRISLSEHVAEQIT
FT                   LTFSKAADRFIATALADALDESGYLRVDIVGLAQNLGVETVEIEHVLGVMQDFDPAGLF
FT                   ARDLRECLAIQLRLKDRFDPAMEVLIDNLDLLARRDFATLKKLCGVDQADILDMLTEIR
FT                   MLDPKPGALFEISVADAIVPDALVTPSRDGGWTIELNAAAMPRLIVNNEYYAEVSTSVK
FT                   AEEKAFLSDCMQTANWLVRSLDQRARTILKVTQEIVRQQDGFLRHGVTHLKPLNLRTVA
FT                   DAVGMHESTISRVTANKFMATPRGVFELRYFFTASIASSEGGDAHSSESVRHRIRQMID
FT                   AEKSDDVLSDDAIVDALKKDGVDIARRTVAKYRESMNIASSVQRRREKKARLSAS"
FT   gene            193491..194084
FT                   /locus_tag="Oant_0171"
FT   CDS_pept        193491..194084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0171"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   bms:BR0160 ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12902"
FT                   /db_xref="GOA:A6WV98"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV98"
FT                   /protein_id="ABS12902.1"
FT                   /translation="MTLRVSGKHMDVGEAFTTRIIDRVNEAVGKYFDHGFSGQVTVTKS
FT                   GSRYSADCTLHLDSGATLQSTGDAQDPQLAFEAAADKIETRLRRYKRRLKSRPATQPDA
FT                   IYDDVAYRVMAPLSEEEEDLPADYAPTIVAESSVALRTMSVASAVVELDLIENPVLVFR
FT                   NAGNDEVNIVYRRADGNIGWVDPSMVTRQAAPRA"
FT   gene            194184..194648
FT                   /locus_tag="Oant_0172"
FT   CDS_pept        194184..194648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0172"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: bmb:BruAb1_0157
FT                   PtsN, PTS system, nitrogen regulatory IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12903"
FT                   /db_xref="GOA:A6WV99"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A6WV99"
FT                   /protein_id="ABS12903.1"
FT                   /translation="MDLSDLIQPGAIIPALKASSKKQLLQILSEKAAELTGLPEREVFE
FT                   TILQRERLGSTGVGNGVAIPHGKLANINKIAGIFARLETPVDFEALDDQPVDLVFLLLA
FT                   PENAGADHLKALSRIARMLRDADTVAKLRGTHDAQALYSFLTAQPASNAA"
FT   gene            complement(194869..195114)
FT                   /locus_tag="Oant_0173"
FT   CDS_pept        complement(194869..195114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0173"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   bmb:BruAb1_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12904"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA0"
FT                   /protein_id="ABS12904.1"
FT                   /translation="MNRHIFTENEFAHLGEGEVAYVRKIRSDDLARSFPALPPIEPGLE
FT                   LWALFGASGEPIVLSDVRATALQGAQDHELRTVMLH"
FT   gene            complement(195218..195640)
FT                   /locus_tag="Oant_0174"
FT   CDS_pept        complement(195218..195640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0174"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: bms:BR0163
FT                   heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12905"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA1"
FT                   /protein_id="ABS12905.1"
FT                   /translation="MTRMTPFSSPLLLGFDTMEKTLERIAKSGDGYPPYNIERLRGETG
FT                   SERLRITLAVAGFASEDLEVMTEDNQLVIRGRQTDDTEREFLHRGIAARQFQRVFVLAD
FT                   GMRVLGCDLKNGLLAIDLDRPEPERLVKRISIAVKD"
FT   gene            complement(196078..196575)
FT                   /locus_tag="Oant_0175"
FT   CDS_pept        complement(196078..196575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12906"
FT                   /db_xref="GOA:A6WVA2"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA2"
FT                   /protein_id="ABS12906.1"
FT                   /translation="MHHPDGAEPDRFDKPIFEALLTPYRSLGRTGFTILMSALIGCWMF
FT                   VGILFWSIGAWPIFGFFGLDVLLIYLAFRWNYRSARAREEISVSRSALHIRKYAASGKM
FT                   TAHRFNPFWIRFKVARKPDIGITGMSVESREASVAIGNFLSQDDRESFATAFGAALSEA
FT                   RR"
FT   gene            196671..197420
FT                   /locus_tag="Oant_0176"
FT   CDS_pept        196671..197420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0176"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: endonuclease III; PFAM: helix-hairpin-helix
FT                   motif; HhH-GPD family protein; KEGG: bme:BMEI1782
FT                   endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12907"
FT                   /db_xref="GOA:A6WVA3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA3"
FT                   /protein_id="ABS12907.1"
FT                   /translation="MEKAKIKSPVNVSAATRPQRRVRGALYTADEIHEIFRRFSIQRPE
FT                   PKGELEHVNAFTLLVAVVLSAQATDAGVNKATRGLFAIADTPQKMLALGEEKVGDHIRT
FT                   IGLWRNKAKNVILLSEALIRDHDGEVPGDRDELVKLPGVGRKTANVVLNMAFGQPTMAV
FT                   DTHILRIGNRIGLAPGKTPEAVEAILVRVIPAEYMLHAHHWLILHGRYVCKARKPECEK
FT                   CVIADICKYPAKTCDIPAPLIPLPPQA"
FT   gene            complement(197395..198123)
FT                   /locus_tag="Oant_0177"
FT   CDS_pept        complement(197395..198123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0177"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   bmb:BruAb1_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12908"
FT                   /db_xref="GOA:A6WVA4"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA4"
FT                   /protein_id="ABS12908.1"
FT                   /translation="MILDAALKALKRLTTPELRAVFWKTLGLTLLLLIGLWAAVRQIFF
FT                   TFAWPWMEQILPGMPEWAGWFGIVAAIVAGLGLALVLALMIAPVTALVAGLFLDDVAEV
FT                   VEREDYPNDPPGTPLPTGRSIVVSLKFLGIVILGNIVALFMLFIPGVNLIAFFVINAYL
FT                   LGREFFEFAAMRYHSEAEAKALRSHYSVTVFLAGLLIAGFMAIPIVNLLTPLFAATMMV
FT                   HLHKAVSQREARLTPAAARG"
FT   gene            198372..199367
FT                   /locus_tag="Oant_0178"
FT   CDS_pept        198372..199367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0178"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bmb:BruAb1_0165
FT                   carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12909"
FT                   /db_xref="GOA:A6WVA5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA5"
FT                   /protein_id="ABS12909.1"
FT                   /translation="MATFDVLCIGNAIVDILSRTDDSFLETNGIVKGAMNLIDAERAEL
FT                   LYGRIAGPATEMSGGSAGNTAAGVASLGGRSAYFGKVATDHLGRVFAHDIRAQGVAFDT
FT                   RPLEKGSPTARSMIFVTPDGERSMNTYLGACVELGPEDVETSKVSDAKVTYFEGYLWDP
FT                   PRAKEAIVMASKIAHEKKRQMAMTLSDPFCVDRYREEFLELMRSRTVDIVFANEDEAKS
FT                   LYKTKSLETAIASMRMDCALSIITRSEKGAVVVTPDQTLTVPAIEIDALVDTTGAGDLY
FT                   AAGFLYGYTNERSLEDCARLGSLAAGLIIQQMGPRPQLSLQAAAGQAGLV"
FT   gene            complement(199371..200027)
FT                   /locus_tag="Oant_0179"
FT   CDS_pept        complement(199371..200027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0179"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   bme:BMEI1778 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12910"
FT                   /db_xref="GOA:A6WVA6"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA6"
FT                   /protein_id="ABS12910.1"
FT                   /translation="MTIPEFLNFAGVFVFAATGALAASRRQLDIIGFLFLANITGIGGG
FT                   TFRDLVLGAPVFWVVEPTYLLAGTLAAIFVYFTAHMVESRYRVLLWLDAIGMAAYTVIG
FT                   AAKGLALGFGPSVAIVTGISTATLGGILRDMVAGEPSVLMRREIYVTASLAGACLYVLL
FT                   AWLQVEPAICAIAAALTAFLIRGGALYFGWTLPVYKSRPGRTEEELQRDRIIRPE"
FT   sig_peptide     complement(199959..200027)
FT                   /locus_tag="Oant_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.952 at
FT                   residue 23"
FT   gene            complement(200279..200965)
FT                   /locus_tag="Oant_0180"
FT   CDS_pept        complement(200279..200965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0180"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: GrpE protein; KEGG: bms:BR0171 heat shock
FT                   protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12911"
FT                   /db_xref="GOA:A6WVA7"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVA7"
FT                   /protein_id="ABS12911.1"
FT                   /translation="MADEKNKSQNPDLEQRDINNPRDREALNRAADDFLKARKAEARAE
FT                   VAEDEAEAAVDETANRIAMLEADNGELKDQLLRAAAEMENLRKRTQRDVQDARTYAVTN
FT                   FARDMLSVSDNLRRALDAIPADALATDASLKSLADGVEMTERAMLQALERHGVKKLEPE
FT                   GEKFDPNFHQAMFEVPNPDLPNNTVVQVVQDGYAIGDRVLRPAMVGVSKGGPKATADNG
FT                   ASEGNG"
FT   gene            complement(201072..202190)
FT                   /locus_tag="Oant_0181"
FT   CDS_pept        complement(201072..202190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0181"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: bmb:BruAb1_0168 HrcA, heat-inducible
FT                   transcription repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12912"
FT                   /db_xref="GOA:A6WVA8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVA8"
FT                   /protein_id="ABS12912.1"
FT                   /translation="MNEFRIQSHTRVRDHIMMKTPEHQLLSSLDQRSRDIFRLIVETYL
FT                   NDGDPLGSRNLSRLLPHTLSPATIRNVMSDLEHLGLIYAPHVSAGRLPTQIGLRFFVDA
FT                   FLEVGDLPPEERSSIEAQVRSAGMNNSVESVLTEASQVLSGLSRGAGLVLATKAEGALK
FT                   HIEFVRLEPTRALAVLVMQNGDVENRVVNLPVGISNSQLVEASNFLNAHIHGHTLSEAK
FT                   AELKKLTEETRQELDQLSQELVAQGLAVWSGAGTDQPARLIVRGRANLLENIHAQEDIE
FT                   RLRHLFDDLETKDGMVQLLDLAEAGSGVRIFIGSENKLFSLSGSSLVVAPYRDSEQRVI
FT                   GALGVIGPTRLNYARIVPMVDYTAQIVSRLLR"
FT   gene            202401..203117
FT                   /locus_tag="Oant_0182"
FT   CDS_pept        202401..203117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0182"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   KEGG: bmb:BruAb1_0169 Rph, ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12913"
FT                   /db_xref="GOA:A6WVA9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVA9"
FT                   /protein_id="ABS12913.1"
FT                   /translation="MRPSKRAADEMRAVSFERGISKHAEGSCLVKFGDTHVLCTASLEE
FT                   KVPGWMRNTGKGWVTAEYGMLPRSTGDRMRREAAAGKQGGRTQEIQRLIGRSLRAVVDM
FT                   QALGEVQITVDCDVIQADGGTRTAAITGGWVALHECLRWMEARQMVRVEKVLKDHIAAI
FT                   SCGIYEGEPVLDLDYAEDSVAETDSNFVMTGKGGIVEIQGTAEGAPFSEEEFANLMKLA
FT                   RGGIDRLVSLQKMAVA"
FT   gene            203159..203563
FT                   /locus_tag="Oant_0183"
FT   CDS_pept        203159..203563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0183"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bms:BR0174 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12914"
FT                   /db_xref="GOA:A6WVB0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB0"
FT                   /protein_id="ABS12914.1"
FT                   /translation="MRAARILETALYVRDVAEAIEFYHGIMGLEPVGKVSERNAFFRCG
FT                   DGILLLFKAEETLKPPLPEHLPVPSHGTSGPGHVCFAASREEMERWRNHLAKHGIAIEA
FT                   EFDWPNGAHSIYFRDPSGNSLEIAEPKLWN"
FT   gene            203566..204228
FT                   /locus_tag="Oant_0184"
FT   CDS_pept        203566..204228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0184"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   bmb:BruAb1_0171 ham1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12915"
FT                   /db_xref="GOA:A6WVB1"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB1"
FT                   /protein_id="ABS12915.1"
FT                   /translation="MRKLEQGKLIVASHNAGKLKEFDGLIGPFGFEVSSVAALGLPEPD
FT                   ETGTTFEENAYIKALAAAEATGLPALSDDSGMMVDALDGDPGVYTANWAETEDGTRDFD
FT                   MAMQKVENLLQEKAAVAPQQRKARFVSVICLAWPDGEAEYFRGEVEGAIVWPPRGTTGF
FT                   GFDPIFLPDGYEKTFGEMTADEKHGWKPGDASALSHRARAFKLFAEKALNVEPASAK"
FT   gene            204225..205454
FT                   /locus_tag="Oant_0185"
FT   CDS_pept        204225..205454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0185"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: bme:BMEI1771 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: putative
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12916"
FT                   /db_xref="GOA:A6WVB2"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB2"
FT                   /protein_id="ABS12916.1"
FT                   /translation="MNKLFPPLQAVDAARANAAGSIPIARANGENAFGVYLHWPFCLAK
FT                   CPYCDFNSHVRHKPVDQARFSEAFLREMETLRERTGPRTITSIFLGGGTPSLMQPETVG
FT                   ALLNGIASHWSVAPDIEVTLEANPTSVEADRFRGYRAAGVNRVSLGIQALNDPDLRRLG
FT                   RMHSVEEAKAAIRLAREIFPRLSFDLIYARPNQTIEAWREELKEAIGLAADHLSLYQLT
FT                   IEEGTQFYNLWKAGKLTTPEPDHAAALYEETQRVTAEHGLPAYEISNHAVPGRESQHNL
FT                   VYWRYGQYVGIGPGAHGRFVENDIRTVTMTEKHPETWLDKVERNGHGIIEEEYLDGGQE
FT                   GDEFLMMGLRLREGIDLARYERLSGHAVDEKRLAKLIAEGMIEPMSGSIIRATPDGALV
FT                   LDALVADLAA"
FT   gene            205465..206376
FT                   /locus_tag="Oant_0186"
FT   CDS_pept        205465..206376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0186"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bmb:BruAb1_0173
FT                   tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12917"
FT                   /db_xref="GOA:A6WVB3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB3"
FT                   /protein_id="ABS12917.1"
FT                   /translation="MTDEAGEGRREYVVGGTTMRARPLEPALYIVSTPIGNLGDMTLRG
FT                   IETLASVDILACEDTRVTRVLLDRYGIARRPISYHEHNAAEAGEKLIAALSAGKSVALV
FT                   SDAGTPLVSDPGFRLVGEAREAGIRVVPIPGASAVLAALAASGLPTDAFMFCGFLPSKH
FT                   GQKQSKLESLKGIDATLVFYESPNRTAATLAEMAEVFGPDRLGALCRELTKAYETIRTA
FT                   PLGELAAEFDGEDRIRGEVVLLVGPPTGNAVPQSEEDIDKLLLSLAAELPPSKAAGEAA
FT                   RMTGGQKSVLYQRLMQLKSDQR"
FT   gene            206373..206750
FT                   /locus_tag="Oant_0187"
FT   CDS_pept        206373..206750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0187"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   bmb:BruAb1_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12918"
FT                   /db_xref="GOA:A6WVB4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVB4"
FT                   /protein_id="ABS12918.1"
FT                   /translation="MTDLREKKRTAFFRGHSAERFASVLLLLKGFRIVARRYRTRLGEI
FT                   DLIARRGNLILIVEVKARSSLEAAHLAVTPQAMRRIEAAADLWLQRQPDHARLSLRFDL
FT                   IAVLPRRWPKHVPAFFTSGNY"
FT   gene            206987..208414
FT                   /locus_tag="Oant_0188"
FT   CDS_pept        206987..208414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0188"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase;
FT                   siroheme synthase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bmb:BruAb1_0175
FT                   CysG, siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12919"
FT                   /db_xref="GOA:A6WVB5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB5"
FT                   /protein_id="ABS12919.1"
FT                   /translation="MSLSQKRLLADFPAFFRVSEEVVVVVGGGEEALNKARLVAQTSAR
FT                   LRIVAEETEHHLADFIANHGAEHVAVPFAPEHVEGAKLVFVATGDEAQDRAIAAVVKAQ
FT                   KIPVNVVDRPALCDFLTPAIVNRAPLTIAIGSEGTAPVLAQMVRARIDAAFSPRLGELA
FT                   HFAESWRPLVERALPKGLARRSFWRGFFSGRVAHAIENGDREEAQKAASDLIKQRDNAA
FT                   GYVWLVGAGPGAEDLLTLRAHRALMEADVIVHDALVPEGVIAMGRRDAERLAVGKRKGC
FT                   HSKSQEEINRLLVTLGREGKRVVRLKSGDPLVFGRAGEEMAALRAAGIGFEIVPGITSA
FT                   FAAAADMELPLTLRGVASSLVFTTGHDMTGDVLPGWTKLAVSGATIAVYMGSTVAASVA
FT                   ARLIGAGLHEDTAVAVVENASRQDKRLFHGTLKDLPDLESRKELSGPVMVIIGDAVAGA
FT                   AIDKAEALALRPVSVAA"
FT   gene            208456..208773
FT                   /locus_tag="Oant_0189"
FT   CDS_pept        208456..208773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12920"
FT                   /db_xref="InterPro:IPR021270"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB6"
FT                   /protein_id="ABS12920.1"
FT                   /translation="MVVKVLTANRLIDGQAVWLGADGSWQETIDGALVARHVEAVEALE
FT                   DAGKVAAKANLVVDVNVIDVEEREEGLYPIRLRERIRLSGPTIVTFGDLPLEKPELKRA
FT                   S"
FT   gene            208795..210465
FT                   /locus_tag="Oant_0190"
FT   CDS_pept        208795..210465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0190"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /EC_number="1.8.7.1"
FT                   /note="PFAM: nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; KEGG: bms:BR0181 sulfite
FT                   reductase (NADPH) hemoprotein beta-component"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12921"
FT                   /db_xref="GOA:A6WVB7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB7"
FT                   /protein_id="ABS12921.1"
FT                   /translation="MYRYDEFDRDFVAARVAQFKDQVERRLTGELTEDQFKPLRLMNGL
FT                   YLQLHAYMLRVAIPYGTLSSRQLRKLGHIARVYDRGFGHFTTRQNIQYNWPALKDVPRI
FT                   LEELAEVEMHAIQTSGNCIRNVTADHFAGAAADEVADPRPFAEILRQWSSLHPEFSYLP
FT                   RKFKIAIVGSDHDRAAIQVHDIGLQLKKNEAGDLGLAVYIGGGQGRTPMVAKKIRDFLP
FT                   IEDMLTYVTAIVRVYNLHGRRDNKYKARIKILVHETGVEELTREIDAEWDEIRNGELKL
FT                   PQRDIDAIESYFRMPNLPQRPEGWEVLAVTQKADAEFASWVARNVTPHKNPDYAVVTIS
FT                   LKPIGGIPGDASAEQMELVADIAETYSFDEIRVSHEQNLVLPHVAKADLAAVYDLLQSD
FT                   GLVTPNAGLITDIIACPGLDYCALANARSIPVAQRISERFGDQQRQLEIGDLKIKISGC
FT                   INACGHHHVGHIGILGVEKKGEELYQITLGGSADEYSTIGDITGRGFSSEEVVDAIETV
FT                   VDTYLSLRESPEETFLAAYRRVGMEPFKQALYGEISRAA"
FT   gene            210455..211204
FT                   /locus_tag="Oant_0191"
FT   CDS_pept        210455..211204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0191"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: bmb:BruAb1_0178 CysH, phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12922"
FT                   /db_xref="GOA:A6WVB8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB8"
FT                   /protein_id="ABS12922.1"
FT                   /translation="MQLDAEESAAAEARLLEASHGASSPQDVIALVTRELYEGQIAVVS
FT                   SFGAESAVLLHMISEIDPATPVLFLDTGKHFRATLDYRHDLVDRLGLTDVQDILPLEDS
FT                   LKADDPFGALSMTDKDRCCFIRKVEPMARAVAPYRAWMTGRKQFQASTRESLPVFESVG
FT                   SRIRINPLARLQAADLKAYAEKHDLPPHPLIAQGYRSIGCMPCTRPVSEGEDQRAGRWA
FT                   GSEKTECGIHLSGLSDSLKNLGAGDRK"
FT   gene            211201..211725
FT                   /locus_tag="Oant_0192"
FT   CDS_pept        211201..211725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0192"
FT                   /product="uncharacterised conserved protein UCP030820"
FT                   /note="PFAM: uncharacterised conserved protein UCP030820;
FT                   KEGG: bmb:BruAb1_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12923"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVB9"
FT                   /protein_id="ABS12923.1"
FT                   /translation="MSDINETKLWSAEGFREDDYVFADDLETAGDAPAIIIPLAVWLGL
FT                   DEERRRASNRRIGVSVAPGEAIDPLRDDLGSVPLIALQFPAFNDGRSYSKAEILRREGF
FT                   AGELRAVGDVLIDQAALMLRTGFDSLQVSNKVAQGRLGENRLVDTPGYYQPGRGSVPEE
FT                   AGFAWRRVKAS"
FT   gene            211804..212097
FT                   /locus_tag="Oant_0193"
FT   CDS_pept        211804..212097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0193"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: bmb:BruAb1_0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12924"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC0"
FT                   /protein_id="ABS12924.1"
FT                   /translation="MIRHIVFFSVKEGQDIETVKKGLEQLGTIPHADLFEVLPNSRVDP
FT                   MCDRIDLVVYAEFKDEEALFAFKKHPTYDATTQLVRPMRELRFSADVMTDKR"
FT   gene            complement(212152..212739)
FT                   /locus_tag="Oant_0194"
FT   CDS_pept        complement(212152..212739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0194"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: bmb:BruAb1_0181 Ogt,
FT                   methylated-DNA--protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12925"
FT                   /db_xref="GOA:A6WVC1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC1"
FT                   /protein_id="ABS12925.1"
FT                   /translation="MTSMESSGVTIFETEIGPCGIAWRGQKIVGVEIGDADEKETRYRL
FT                   SERFPGAEDIDMPSFVSDAIQGVRALLAGADVDFSTTPLALDAQPDLNRQVYEIILELK
FT                   PGETTTYGAIARRIGDVSLSQAVGYALGKNPFPIIVPCHRVLGANGKVGGFSAAGGTAT
FT                   KLKLLNIERAKTSSEPDLFGGLPLQERPQADW"
FT   gene            212962..213207
FT                   /locus_tag="Oant_0195"
FT   CDS_pept        212962..213207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12926"
FT                   /db_xref="GOA:A6WVC2"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC2"
FT                   /protein_id="ABS12926.1"
FT                   /translation="MDDYERYATGLMIVFGALIIGGLMAANLYHGDKPGFLFALGAAVV
FT                   SWFAAFAVLFDKPRVYGVMIAVAIGLVAASIGAYVT"
FT   sig_peptide     212962..213039
FT                   /locus_tag="Oant_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.607 at
FT                   residue 26"
FT   gene            complement(213261..213680)
FT                   /locus_tag="Oant_0196"
FT   CDS_pept        complement(213261..213680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0196"
FT                   /product="BA14K family protein"
FT                   /note="PFAM: BA14K family protein; KEGG: bmb:BruAb1_0183
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12927"
FT                   /db_xref="GOA:A6WVC3"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC3"
FT                   /protein_id="ABS12927.1"
FT                   /translation="MKRFAYSLFAACLSLGMGLSAAAGTANAAQPSLMATPSAQAPAPN
FT                   VQNVQYYDYRGDRRYWRDHRRHWRHDRPRYRPYYRYDRRYWGPPPAYRYRPAPVYRGGN
FT                   PHVRWCYNRYRSYRAYDNTFQPNYGPRRQCYSPYL"
FT   sig_peptide     complement(213594..213680)
FT                   /locus_tag="Oant_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 29"
FT   gene            214007..217798
FT                   /locus_tag="Oant_0197"
FT   CDS_pept        214007..217798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0197"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: bme:BMEI1759
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12928"
FT                   /db_xref="GOA:A6WVC4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC4"
FT                   /protein_id="ABS12928.1"
FT                   /translation="MASSLDGLFGATAAQPDGSEVLAALTKAARERILILDGAMGTQIQ
FT                   GLGFHEEHFRGERFGACDCQLQGNNDLLTLTQPKAIEEIHYAYAIAGADILETNTFSST
FT                   TIAQADYGMEEQVYELNRDGARLARRAALRAEQKDGRRRFVAGALGPTNRTASLSPDVN
FT                   NPGYRAVTFDDLRIAYAEQIRGLIDGGSDIILIETIFDTLNAKAAVFASEQVFEEKGIF
FT                   LPVMISGTITDLSGRTLSGQTPTAFWHSLRHAKPFTIGLNCALGANAMRAHLDELSTIA
FT                   DTFICAYPNAGLPNEFGQYDETPEAMAAQIEGFARDGMVNVVGGCCGSTPEHIRAIAEA
FT                   VAKHPPRKPAKVAPLMRLSGLEPFTLTEDIPFVNVGERTNVTGSARFRKLIKAGDFAAA
FT                   LDVARDQVVNGAQIIDINMDEGLIDSEKAMVEFLNLIAAEPDIARVPIMIDSSKWEVIE
FT                   AGLKCVQGKAVVNSISMKEGEEAFIHHAKLVRAYGAAVVVMAFDETGQADTEARKIEIC
FT                   TRAYKILTEQVGFAPEDIIFDPNIFAVATGIEEHNNYGVDFIEATRKIMATLPHVHVSG
FT                   GVSNLSFSFRGNEPVREAMHAVFLYHAIQAGMDMGIVNAGQLAVYDAIDPELREACEDV
FT                   VLNRRSDATERLLEIAERFRDSGSKEAKVQDLTWREWPVAKRLEHALVNGITEYIEADT
FT                   EEARQSAERPLHVIEGPLMAGMNVVGDLFGAGKMFLPQVVKSARVMKQAVAVLLPYMEE
FT                   EKRLNAEKGIGGGERQSAGKVLMATVKGDVHDIGKNIVGVVLACNNYEIIDLGVMVPSQ
FT                   KILQVARDEKVDIIGLSGLITPSLDEMAHVAAEMEREGFDIPLLIGGATTSRVHTAVKI
FT                   HPRYERGQAVYVIDASRAVGVVSSLLSPEGKQAYVDGLRGEYAKVAAAHARNEAEKQRL
FT                   PIARARANAHKLDWDNFVPAKPTFTGTKTFDDYDLAEIARYIDWTPFFQTWELKGRYPA
FT                   ILEDEKQGEAARQLWDDAQAMLKKIIDEKWFTPKAVVGFWPANAVGDDIRLFTDESRNE
FT                   ELATFFTLRQQLSKRDGRPNVAMSDFVAPAESGKQDYVGGFVVTAGIGEVAIAERFERA
FT                   NDDYSAILVKALADRFAEAFAELMHERVRKEFWAYAANETYSPEELIGEPYQGIRPAPG
FT                   YPAQPDHTEKTTLFRLLDATANTGVELTESYAMWPGSSVSGLYIGHPESYYFGVAKVER
FT                   DQVEDYASRKGMTIEEVERWLAPILNYTPGAAPEEAAA"
FT   gene            218175..218882
FT                   /locus_tag="Oant_0198"
FT   CDS_pept        218175..218882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0198"
FT                   /product="Autoinducer-binding domain protein"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; Bacterio-opsin activator HTH domain
FT                   protein; KEGG: bmb:BruAb1_0185 transcriptional regulator,
FT                   LuxR autoinducer regulated family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12929"
FT                   /db_xref="GOA:A6WVC5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC5"
FT                   /protein_id="ABS12929.1"
FT                   /translation="MKWEQIYESMQSADDAGQLLEYIGTYARQCGFAHTAYVMRVPLLN
FT                   GVVKWLSFGSLPQEWTDHYTARKYADVDPLVRKALNSIEPLVWSSKLFAEAPQIWADAQ
FT                   RFGIKVGISQPCWAAQGVFGMLSFLRTGPALSSGEISMLRRQMQIAANLLHLSMYEHLD
FT                   VPTMNCVSEVNLTMREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNK
FT                   VQAVAKARTFGLL"
FT   gene            218998..220368
FT                   /locus_tag="Oant_0199"
FT   CDS_pept        218998..220368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0199"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bmb:BruAb1_0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12930"
FT                   /db_xref="GOA:A6WVC6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:5GHF"
FT                   /db_xref="PDB:5GHG"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC6"
FT                   /protein_id="ABS12930.1"
FT                   /translation="MTAQPNSLEARDIRYHLHSYTDAVRLEAEGPLVIERGDGIYVEDV
FT                   SGKRYIEAMSGLWSVGVGFSEPRLAEAAARQMKKLPFYHTFSYRSHGPVIDLAEKLVSM
FT                   APVPMSKAYFTNSGSEANDTVVKLIWYRSNALGEPERKKIISRKRGYHGVTIASASLTG
FT                   LPNNHRSFDLPIDRILHTGCPHFYREGQAGESEEQFATRLADELEQLIIAEGPHTIAAF
FT                   IGEPVMGAGGVVVPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNLFGSQTFDMKPD
FT                   ILVMSKQLSSSYLPISAFLINERVYAPIAEESHKIGTLGTGFTASGHPVAAAVALENLA
FT                   IIEERDLVANARDRGTYMQKRLRELQDHPLVGEVRGVGLIAGVELVTDKQAKTGLEPTG
FT                   ALGAKANAVLQERGVISRAMGDTLAFCPPLIINDQQVDTMVSALEATLNDVQASLTR"
FT   gene            220691..221611
FT                   /locus_tag="Oant_0200"
FT   CDS_pept        220691..221611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0200"
FT                   /product="sulfate adenylyltransferase, small subunit"
FT                   /note="TIGRFAM: sulfate adenylyltransferase, small subunit;
FT                   PFAM: phosphoadenosine phosphosulfate reductase; KEGG:
FT                   bme:BMEI1755 sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12931"
FT                   /db_xref="GOA:A6WVC7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVC7"
FT                   /protein_id="ABS12931.1"
FT                   /translation="MHHASLTKNLTHLQRLEAEAIHIFREVAASFSNPVMLYSVGKDSS
FT                   VMLHLAMKAFYPAPPPFPFLHVDTTWKFREMIEFRDAQAREKGFELLVHINEDGVREGV
FT                   GPFSHGSNVHTHVMKTVALRQALDKYKFDAAFGGARRDEEKSRAKERIFSFRSAQHGWD
FT                   PKNQRPEMWKIYNTRVSAGESIRVFPLSNWTELDIWQYILQENIPIVPLYFAAHRPVVE
FT                   RDGMLIMLDDDRMKLRPGETVENRLVRFRTLGCYPLTGAIESSAADLSDIVEEMLIART
FT                   SERQGRAIDRDEAGSMEKKKREGYF"
FT   gene            221611..223545
FT                   /locus_tag="Oant_0201"
FT   CDS_pept        221611..223545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0201"
FT                   /product="sulfate adenylyltransferase, large subunit"
FT                   /EC_number="2.7.7.4"
FT                   /EC_number="2.7.1.25"
FT                   /note="TIGRFAM: sulfate adenylyltransferase, large subunit;
FT                   PFAM: protein synthesis factor GTP-binding; adenylylsulfate
FT                   kinase; elongation factor Tu domain 2 protein; KEGG:
FT                   bmb:BruAb1_0189 CysNC, sulfate adenylate transferase,
FT                   subunit 1/adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12932"
FT                   /db_xref="GOA:A6WVC8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC8"
FT                   /protein_id="ABS12932.1"
FT                   /translation="MNAIIKPVATNAVVSDFLADQERKTLLRFLTCGSVDDGKSTLIGR
FT                   LLYDTKLIFEDQLASLKNDSRKFGTTDDDFDFALLVDGLEAEREQGITIDVAYRFFSTP
FT                   RRKFIVADTPGHAQYTRNMATGASTADLAIVLIDARQGVLTQTRRHSFIAAALGIRHIV
FT                   LAVNKIDLVDFSQEAFERIVADYMSFANELGFVSIQPIPLSARFGDNVTLPSPRMDWYE
FT                   GPHLLEHLETVRIDTEAAAKPFRFPVQYVNRPNLDFRGFSGTVASGSISAGDAVVVAKS
FT                   GKTSRVKRIATYDGDLPRASEGQAVTLVLEDEIEVSRGNMLVGTEARPEVADRLSANIV
FT                   WFGEEALHPGRSYILRTETDQTPVTINEIVYRTDIDSFTRQEASRLDLNEIGLCHLQTV
FT                   DQIAFDPYADNRVTGAFVLIDRLTNATVGAGMIDSALRQATNVHLQSFDLDKQTRAAQK
FT                   FQKPAVLWFTGLSGSGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSDLGFSDEDRA
FT                   ENIRRVGEVARLMTDAGLVVLVSFISPFQAERDRIRARLPEGEFVEIFVDTPIEECIAR
FT                   DPKGLYAQALRGEIKAFTGIDSPYEAPVSPELRLSTTGRDVDELVAEVEKYLAERGIIG
FT                   SYGSDSWSI"
FT   gene            223549..224394
FT                   /locus_tag="Oant_0202"
FT   CDS_pept        223549..224394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0202"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: bme:BMEI1753 cysQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12933"
FT                   /db_xref="GOA:A6WVC9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVC9"
FT                   /protein_id="ABS12933.1"
FT                   /translation="MKISASPKADPNDEAMLAVLQEAALEAGRVIMKHYANGCAVQSKK
FT                   DSSPVTEADRDAEAIILAALASVVPDIPVVAEEEVAAGRLPSHLGRRFLLVDPLDGTRE
FT                   FLLRNGDFTVNIGLIEDGAPVLGIVYAPVRNRLFIGNSNGAEEITTTKDHAIGTRRGIA
FT                   VRVHGPERVAVCSRSHKNPETEKFLNDNRINSCVSIGSSLKFCLIASGEADIYPRFGPT
FT                   MEWDTAAGDAVLRAAGGLTTTFEGTPLSYGQRANEGVAGFANPNFVAFGGGTKPVFAML
FT                   "
FT   gene            224559..224635
FT                   /locus_tag="Oant_R0003"
FT                   /note="tRNA-Pro1"
FT   tRNA            224559..224635
FT                   /locus_tag="Oant_R0003"
FT                   /product="tRNA-Pro"
FT   gene            complement(224745..225806)
FT                   /locus_tag="Oant_0203"
FT   CDS_pept        complement(224745..225806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0203"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   nha:Nham_3311 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12934"
FT                   /db_xref="GOA:A6WVD0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD0"
FT                   /protein_id="ABS12934.1"
FT                   /translation="MSRKRSPARLWFRSDTGTWFIKDGEKRISTGCAKDETERAEQVLR
FT                   EYVTSKYEPVRGGSSAAITIGDVLLVYLDEKAIRTSRPRETEAAVNRLNDFFGADAINE
FT                   IRGKRCREFADHRKTESGARRDLEVLRAAINHYHKEYGLDVVPAVTLPDKSLPRERWLT
FT                   RNEVAALIKAARRLQKCDHIIRLVLIGTYTGTRLSPILGLQWMPNTTGGYVDLDKGVIY
FT                   RKAMGERVAHNKRKPPAKIPPRLLRFLRYWKAKDEAWSAEQAKTVSLRHIVHFNGEKIT
FT                   KPHKAFRSVRAEAGLGEDVTPHVLRHTRATWLAQAGVDAHQAAASLGMTVEEFERTYSH
FT                   VSPLFQKDAANAF"
FT   gene            complement(226725..227006)
FT                   /locus_tag="Oant_0204"
FT   CDS_pept        complement(226725..227006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12935"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD1"
FT                   /protein_id="ABS12935.1"
FT                   /translation="MPSKEHEALVEKVARVICFETGSMGDPMPIELQRVDRDWQEHVTA
FT                   AKAAIFAIREALQEPTEVMTANGYVHCYNPDRTWSAMLAASALGEQSK"
FT   gene            complement(226996..227415)
FT                   /locus_tag="Oant_0205"
FT   CDS_pept        complement(226996..227415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12936"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD2"
FT                   /protein_id="ABS12936.1"
FT                   /translation="MTSDLITRLSKLDAPDREVDGLIAETFGFPQEVFGESFGTYDVDG
FT                   PEMHYDAATWSGNGKSWSAPFFTASVDAAIALAKRVCDPAWIRIDEWYMGEEKPAVAAI
FT                   LLKPTPNETFGGKGANQSIALLIALLRAKEASNAE"
FT   gene            complement(227412..227555)
FT                   /locus_tag="Oant_0206"
FT   CDS_pept        complement(227412..227555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12937"
FT                   /db_xref="GOA:A6WVD3"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD3"
FT                   /protein_id="ABS12937.1"
FT                   /translation="MSRYPDPTPLIWLSFVGLATLFALAGGALFYLSYHLIRAVLFYVG
FT                   AL"
FT   sig_peptide     complement(227478..227555)
FT                   /locus_tag="Oant_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.953 at
FT                   residue 26"
FT   gene            complement(227552..228244)
FT                   /locus_tag="Oant_0207"
FT   CDS_pept        complement(227552..228244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12938"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD4"
FT                   /protein_id="ABS12938.1"
FT                   /translation="MANNGTRSQAEELLAAERAENARLRDSTLPMACDPDEWTAAEEVL
FT                   AHLLINVIGAPDDVPYTPNQAQEVIERQLKRIRELDDIEEMLMDGQGDDDGAQIMPEFE
FT                   AGWSTTAKVEECLHLLEKRRDVIEGFEADNAALTARIKELEQINADLCRSHGVLNVTGA
FT                   KLEGQVEALEAKLAAAEKALSFYADPSKWNDGYFKSEDDGTVLRAYPPSIENDQGDKAR
FT                   AALGGKPS"
FT   gene            complement(228244..228792)
FT                   /locus_tag="Oant_0208"
FT   CDS_pept        complement(228244..228792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0208"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; KEGG: ngo:NGO1102
FT                   hypothetical protein, putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12939"
FT                   /db_xref="GOA:A6WVD5"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD5"
FT                   /protein_id="ABS12939.1"
FT                   /translation="MASELSAEQIRELMHYDPKTGICLWKIRDSKWFEGNSRDAEWCCN
FT                   AWNKRYAGTKIGRLSKGYIEARILGKMYGMHRVIWLYMTGKWPLLVDHINGNPSDNRWK
FT                   NLRETDQATNNKNLRQRSDNKSGATGVYFQKSTGKWQSKIKSSGVDYHLGAYQKREDAI
FT                   LARKVAEKCLGFHANHGRK"
FT   gene            complement(228782..229150)
FT                   /locus_tag="Oant_0209"
FT   CDS_pept        complement(228782..229150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12940"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD6"
FT                   /protein_id="ABS12940.1"
FT                   /translation="MAETKYTKGPWDWETPLGDDCYSIVQAGLKSYEWQFIAHVHVGIP
FT                   AEGMMPRQEALANARLIAAAPELYEAANVALSRLQLTGGKDGEYLGNHEKKMIEVLSKA
FT                   LAKARGETHPSGGDRHGE"
FT   gene            complement(229143..229478)
FT                   /locus_tag="Oant_0210"
FT   CDS_pept        complement(229143..229478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12941"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD7"
FT                   /protein_id="ABS12941.1"
FT                   /translation="MGKLNATQGITISGDSCGTDIELTMKVKFSVSKYRPATAIDPAEE
FT                   ATVEIDEVKLFDGEQELNLTYWLEDRLSESDSLKAWLMSEANEQIKQAEEDHADHMREM
FT                   RRENANG"
FT   gene            complement(229478..230479)
FT                   /locus_tag="Oant_0211"
FT   CDS_pept        complement(229478..230479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12942"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD8"
FT                   /protein_id="ABS12942.1"
FT                   /translation="MTIPEQAVQAAANAAHEELLSMAKQMNVPMEYTQSISVNNYRVMR
FT                   TALTAAFPHLAAVRVKKLNEILRELITEQSEGEWDEATIENDVQNFSARILSALETSVA
FT                   QPDPWVDTRLIRFDDTIVFGRGGFDFDRWESLRWEMHTRHGSFAVWKSDSKTWSMYGGK
FT                   YGFLMLDRFSSEEEAKAEAEQIVVSLDAEPSAAPELAVSSGDIVDALFKDLRGRRFLKW
FT                   LFSDRGDDCLIDVFRGGDELRGLDHEVQQEIRKAWEAIIERALHPVADKPDEAGREGEV
FT                   RQQYPAAWMVRENDYEVWDFIRLKKAADDLTARGFEVIPLYTLHTPPSSEVA"
FT   gene            complement(230476..230871)
FT                   /locus_tag="Oant_0212"
FT   CDS_pept        complement(230476..230871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12943"
FT                   /db_xref="InterPro:IPR010373"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVD9"
FT                   /protein_id="ABS12943.1"
FT                   /translation="MAAFAVRREPTAFSTSPSKGQKRPRRENGKHLAWIRTLPCVITGQ
FT                   YGVEAAHIRYAAPEYGKRDTGKAEKPDDDWVIPLAPELHREQHSMNEVKFWAKYGIDPC
FT                   RVALALSRITGDDEAALVIIRNAKVRP"
FT   gene            complement(230871..232199)
FT                   /locus_tag="Oant_0213"
FT   CDS_pept        complement(230871..232199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC1366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE0"
FT                   /protein_id="ABS12944.1"
FT                   /translation="MRIERAVREKTFTLTSIAGPSGSGKTYSALLYARGLVGPEGKIGF
FT                   IDTENKRSRFYADVAGGFDVIDLDPPFTSARYIEAIKAFEKAGYTAIIIDSISHEWEGT
FT                   GGVLEQAEAIEQSSKRPGLHCWAKPKAGHKKLMNELLQTRAHLIFCCRVKEKVVQAKGA
FT                   NGKNEIVNEGFVVVQEKMFIYEMTVSLMLAEGNHIPTILKCPGDLLHAFPEGSKITPKI
FT                   GEAVRSWSDTGKDIDEAFEMSKRAGMQAANGGMKSLSTWWGSLDKADQHRLANLKDTLK
FT                   SVAEASDQMRSDQMEAGGGDVGERLAHAKSISKGAESGEGFNREFVTNQLKTLSSEPDT
FT                   GEQGASEPPFTDADADAWVLNSVNMLIASAMIGGDMEIMRNQYRVVKQTAPEWVDLPTM
FT                   GRVNTVSMFLAKVMDGEEEFDKARIANLSKLNAEQINDLPEVN"
FT   gene            complement(232202..233125)
FT                   /locus_tag="Oant_0214"
FT   CDS_pept        complement(232202..233125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_1188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12945"
FT                   /db_xref="InterPro:IPR024432"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE1"
FT                   /protein_id="ABS12945.1"
FT                   /translation="MTDTLHQDELTWDVGKISQQGIYAKIPMSVYHSDCCVGPSISSSG
FT                   LREIAPPDGCPLKFWDNSYLNPDRAPQQEKHHFSLGRAIHTLLLGEDGFRDEYVVRPAE
FT                   FDSWRTTASKTWRSQKLKDGKTVLEPNDLVIIEGIADRVANDRSFIEHLDGRVERTIIV
FT                   RDPTTGIFVKARPDALPADQVIADLKTTSDASERGCLTSIKKFNYHMQMALAGSALELL
FT                   TRRRVTDHVLLFVETKRPYAYNIKPVDAQYVWLGARQNRAALDILAECLSTGVWPTYYG
FT                   SGLTASPSDFFEKQIENEPSIPAEAA"
FT   gene            complement(233118..233393)
FT                   /locus_tag="Oant_0215"
FT   CDS_pept        complement(233118..233393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12946"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE2"
FT                   /protein_id="ABS12946.1"
FT                   /translation="MSKIETGGPAFPRPFHETVDGNFSIAQTGMSLRDFIATHALAGML
FT                   ASDHIWEHIRGMTEIAPNDKAKRLGAARTAYAYADAMLAARGGDRD"
FT   gene            complement(234693..234956)
FT                   /locus_tag="Oant_0216"
FT   CDS_pept        complement(234693..234956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12947"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE3"
FT                   /protein_id="ABS12947.1"
FT                   /translation="MFSALMISTALSVMPATRPHDPHVGFVLIENRVVEQIGPFWDRED
FT                   CEFVGKGIVNHANDLIHRPYQTGPYEALRLMTTEVVCQRRVK"
FT   gene            complement(234956..235294)
FT                   /locus_tag="Oant_0217"
FT   CDS_pept        complement(234956..235294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12948"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE4"
FT                   /protein_id="ABS12948.1"
FT                   /translation="MSTKAEIEAILKNDIAQLEALVGQLGSISLTCFTLKDQGDSGLEV
FT                   RRLLGKYVEQRCDTEMRLIDLYRGFGDLPAMSPLERSQYRANRADDLLDMTSDAFERIN
FT                   DYVHGRAA"
FT   gene            complement(236090..236443)
FT                   /locus_tag="Oant_0218"
FT   CDS_pept        complement(236090..236443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12949"
FT                   /db_xref="GOA:A6WVE5"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE5"
FT                   /protein_id="ABS12949.1"
FT                   /translation="MLGTVLAILGIAVPVIGASFTVAYKWPQFYEQASRATMKVAVCIS
FT                   FLAAAYYVGAQHALIEAKRLISENQSLPENVADFRSQYHWFFIVFPMSVIVFGFLIESV
FT                   ASMIRDEENQKNK"
FT   sig_peptide     complement(236372..236443)
FT                   /locus_tag="Oant_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.609 at
FT                   residue 24"
FT   gene            complement(236506..237213)
FT                   /locus_tag="Oant_0219"
FT   CDS_pept        complement(236506..237213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0219"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase S24
FT                   S26A and S26B; bacteriophage CI repressor; KEGG:
FT                   sme:SMc04198 putative phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12950"
FT                   /db_xref="GOA:A6WVE6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE6"
FT                   /protein_id="ABS12950.1"
FT                   /translation="METIGDRIRRARTQKGFTQQQLADHFGIARVSVTQWENNTTQPGS
FT                   DKLIGLTELLGGDAEWYITGHGMPPISDGVRIAVKQSGHPKREMTDAPNATIGEKVTGA
FT                   GVMVPVYGQAVGGIDGQFLMNGTILYEVMAPPQIAEIAGAYGVQISGDSMFPRYEDGEV
FT                   AFVDPRRRVKKGDYVVAQIQFDEHEPPHAYVKRFVRHNAEELVLSQFNPPKELTFDHDQ
FT                   VVSVHFIALAGVA"
FT   gene            237255..237494
FT                   /locus_tag="Oant_0220"
FT   CDS_pept        237255..237494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3124 cytoplasmic chaperone TorD"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12951"
FT                   /db_xref="GOA:A6WVE7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031856"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE7"
FT                   /protein_id="ABS12951.1"
FT                   /translation="MTLDKVGRYILQLPTMIEIVAKAAEEVGGVVALARALNIKHTAMY
FT                   SWKRVPAERVLEIERVSGISRHELRPDLYGEKAS"
FT   gene            237500..238366
FT                   /locus_tag="Oant_0221"
FT   CDS_pept        237500..238366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12952"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE8"
FT                   /protein_id="ABS12952.1"
FT                   /translation="MPLQTDIEDIANVEQQIEQHAQNVERIQGNAILEIGRELKFAQDL
FT                   FRFNRNEGGFTGWLATRLPHINQRAAYRAIQRYEGVEEFDEFVKLSGAALDEVVKAEPD
FT                   IQAIIAERVEAGEVFTAAQVKELKQKAAQEAVDRLNSEADQARKDLEELKKSATDRDIR
FT                   SASEVRDLQQKISDLTAKIGELEKSAKDYQKSLPTPTKAKEQAKATGVATLASDGKYYS
FT                   GASEDEKRASDAFLSVFSAAASLSDRKHSPGVVAIGCPAESKAQFASYCDKAIAYLNEI
FT                   KDVINGQ"
FT   gene            238356..238865
FT                   /locus_tag="Oant_0222"
FT   CDS_pept        238356..238865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12953"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVE9"
FT                   /protein_id="ABS12953.1"
FT                   /translation="MVSKLDLKRLNTAIDKEISDAVEKDGEAKHSLIKSKVTAEFSEVI
FT                   KRISDELADRKIGDMVTSHLRNWTFIKKDGSRQLSLPGIPPTILERMPVLITVPPEEEG
FT                   EETRHVSLKSATVGELRRFEKFIADMRDNINKTADAAGFIKRSVEGVDDDIRLIDALRH
FT                   RGKYAA"
FT   gene            239210..239608
FT                   /locus_tag="Oant_0223"
FT   CDS_pept        239210..239608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12954"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF0"
FT                   /protein_id="ABS12954.1"
FT                   /translation="MLETSSKNVDFSPKRISQDRTSMSDAELAADLLDELIGYRGVREP
FT                   IKAMLDRAYDKLSKKSQKWTRRRVRAIFNKEANRIDNREIAEMEAVIAERKRHAEYKEE
FT                   TARIAQMAVAAQTNASRRYAPKQGRELI"
FT   gene            239684..240187
FT                   /locus_tag="Oant_0224"
FT   CDS_pept        239684..240187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_1198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12955"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF1"
FT                   /protein_id="ABS12955.1"
FT                   /translation="MNAGHNVDQEKLDEQRFLNGFREIKELKSDIGGTMGTINGVYKTL
FT                   KAAGFTKADVKWAFELEEKDSGEVIETMKRRLRIAAMLGHGLARQIDLFDEDRTPLSER
FT                   AYLEGMAAGRLRKEMTNPHDLSTEAGQEWQRGFNDGTSLANIDLSSALDEAHGDTDFPD
FT                   EEAA"
FT   gene            240187..240432
FT                   /locus_tag="Oant_0225"
FT   CDS_pept        240187..240432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0225"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: gka:GK1191 acyl carrier
FT                   protein (ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12956"
FT                   /db_xref="GOA:A6WVF2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF2"
FT                   /protein_id="ABS12956.1"
FT                   /translation="MATVFERIRNVLVELLGVETSAVTPESTFVGDLGCDSLDLVELVI
FT                   VIEDEFNVEICDDEAELIVTVSDAVREVERLVGEVA"
FT   gene            240432..240755
FT                   /locus_tag="Oant_0226"
FT   CDS_pept        240432..240755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0226"
FT                   /product="transcriptional repressor, LexA family"
FT                   /note="PFAM: LexA DNA-binding domain protein; KEGG:
FT                   aba:Acid345_0581 SOS-response transcriptional repressor,
FT                   LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12957"
FT                   /db_xref="GOA:A6WVF3"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF3"
FT                   /protein_id="ABS12957.1"
FT                   /translation="MLSMTPRQKEAYDFIRSFIDQKGYGPSYEEIQEALGLHSKSGVHR
FT                   IIEGLEERDLIVRRPGIRRSIALKPAFNADYHLRRVLSALDGTQVSDHEHVLEAARFLQ
FT                   EAA"
FT   gene            240755..241210
FT                   /locus_tag="Oant_0227"
FT   CDS_pept        240755..241210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0227"
FT                   /product="Myb DNA-binding"
FT                   /note="PFAM: Myb DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12958"
FT                   /db_xref="GOA:A6WVF4"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF4"
FT                   /protein_id="ABS12958.1"
FT                   /translation="MSREDKELEAKIVQMVKDGVNQNEIRHQLKIGSKKLQEIVRRNGL
FT                   NTGKFSAAWSEEELEIVERLHRKEGLSPGKIFKTGLLPGRSKASIATRCYNTTSLLRKQ
FT                   ERAAPSISKEHEALMRQSIPDDTRSKTARIMGDPLPGRSALDMRRAA"
FT   gene            241309..241998
FT                   /locus_tag="Oant_0228"
FT   CDS_pept        241309..241998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12959"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF5"
FT                   /protein_id="ABS12959.1"
FT                   /translation="MQSERPTHKLCIDPSTNAGYCLLVHDEDKPESERRTQRERLFYGS
FT                   WDLTRDRDGNKCSRHGDYYLNLWDNVVKLLRKHDIFDSKDVEIILEAEAYGAARSEASA
FT                   RLSGGWIATVSMIAARRGFPLPRTVNTVSWRSFFIGVTQAPKCVTDGLEGPKKTEKARQ
FT                   WLKDQAVAACKARGFETIDDNAAEAIGILFWALNGGIIRQEKARAAKKAKTKAKRDQTK
FT                   MNLQVAA"
FT   gene            241995..243497
FT                   /locus_tag="Oant_0229"
FT   CDS_pept        241995..243497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0229"
FT                   /product="DnaB domain protein helicase domain protein"
FT                   /note="PFAM: DnaB domain protein helicase domain protein;
FT                   KEGG: mlo:mll7836 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12960"
FT                   /db_xref="GOA:A6WVF6"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF6"
FT                   /protein_id="ABS12960.1"
FT                   /translation="MSAVRKMDYEQPAQAICNYEAEGAVIGTLLLNNDAFPLIAGILQP
FT                   VHFYDKFLAEIFGVITDVIKQGKVAQPVTIKPFLPWDRNIDSETTVGRLVARCCAQHAL
FT                   PPAMLPQVAQMLVDLSKRRQIIAIAQDVIAEAQNVSTESDPAQIGERAISEISSALSDG
FT                   DDIYGAVSFGTALDDALEDTNRAYSGKRGTGIGYRFRPVEELIGPMCGGQLIILGGATK
FT                   QGKSALAGQLAMGAAAEGFPVWFYSGEMSAKELAMRESSRETKVTVNRQKRGKVNETDF
FT                   ERLMNFRNANREKQIYIQQKRLTLDQIEERIRYFVSKKGKGLAVIDHMGLIDKSKDEKK
FT                   LADWEFGQIVTARLKQIARETDIPIIGCAQLKKNTFTDYRPTINEKFFHQLLSKKPRYS
FT                   DLIGAIERDADHVLIPFRPVVFLKEYEPSTHSDLHELWQDLVDQNEDKAKIFLALSRES
FT                   QWPRDVECGWHGPTTTFVDLGGMNEPELIKREVIDNPMGLGF"
FT   gene            243799..244650
FT                   /locus_tag="Oant_0230"
FT   CDS_pept        243799..244650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0230"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   bcl:ABC2849 site-specific DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12961"
FT                   /db_xref="GOA:A6WVF7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF7"
FT                   /protein_id="ABS12961.1"
FT                   /translation="MRKLRVLDLFSGIGGFSLGLERTGGFETVAFCEIEEFPRRVLAKH
FT                   WPEVPCYHDVRELTAAKLASDGIAIDVICGGFPCQDISTAGHGAGLEGERSGLWSEYAR
FT                   LIGELRPKFVIVENVAALLGRGMGRVLGDLAAIRYDAEWHCIPASAIGAHHRRDRLWIV
FT                   GYPYGLWELQPQRGKQDERRRSGNASQEMADTKRWRLQSGDVECTRPATIIPAAFSRYS
FT                   GGSEFGEAWRTEPNVGRVAYGLPNGMDRIKGLGNAVVPQIPELIGYAIIDAIREAQQGE
FT                   AA"
FT   gene            244864..245307
FT                   /locus_tag="Oant_0231"
FT   CDS_pept        244864..245307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12962"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF8"
FT                   /protein_id="ABS12962.1"
FT                   /translation="MARHHCDIYKVARQCGVTLRASCDHSPTSRKPRECFCKPTLREIG
FT                   REHGEEHLRLVLQLMVGTVANSRELFADMIKAVSSVLVRNPELVRRRTLLDDFDAIDLG
FT                   SLRRKAKAMNCGLPTSHVLRVLITVKFYQPIQGDLLDWIGEAA"
FT   gene            245576..246148
FT                   /locus_tag="Oant_0232"
FT   CDS_pept        245576..246148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12963"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVF9"
FT                   /protein_id="ABS12963.1"
FT                   /translation="MNYQAWTYEAVRDRVVEAAQTLLASPADLGPRAKQGAFSDLVAAV
FT                   IQTEYDRAPSYRRILSAGSLSRMEETWKWINDYLEEEDRKLVYDYGFIKSRKGLYLDRY
FT                   LEKNDMVRRTFERRIKRCCQLIADNLNRLYSVRFTERLDDVSQIEVDIVTTKVSSESCV
FT                   RGANHFMTPDAKPKNIPSLHEKMKPAA"
FT   gene            246152..246478
FT                   /locus_tag="Oant_0233"
FT   CDS_pept        246152..246478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12964"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG0"
FT                   /protein_id="ABS12964.1"
FT                   /translation="MGTNMRVQVAGDRMSNRLQGGANPPTATDMVKVMIAKRARRIADK
FT                   LRMKAKAKRVYPRDEKARNADHLKCCSCFMCGNPRKWWKQKTISENMADDWQRLQRDWS
FT                   KVYG"
FT   gene            247004..247360
FT                   /locus_tag="Oant_0234"
FT   CDS_pept        247004..247360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12965"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG1"
FT                   /protein_id="ABS12965.1"
FT                   /translation="MAFTRGCRTQHWSLRGEISAYSGVKWAGPEDTNRGTDMRQSEIDR
FT                   ALVLLYRSNNAHDYVNFVRPIDAMDKLPMVGLEEYSVMLERLREDVEAEIARRREAGQT
FT                   VYSVEYYESLKEKA"
FT   gene            247774..248118
FT                   /locus_tag="Oant_0235"
FT   CDS_pept        247774..248118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_0985 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12966"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG2"
FT                   /protein_id="ABS12966.1"
FT                   /translation="MAKIKTLKPLVSTMKPRLGYAKGNERERSQYRDRTQAWRSWYKTN
FT                   RWQKLRWSVLTRDLFTCSMCGKIETDTSQLVCDHVDQHHGDERAFWSGPFQTLCKPCHD
FT                   RDKQRMERRG"
FT   gene            248115..248381
FT                   /locus_tag="Oant_0236"
FT   CDS_pept        248115..248381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12967"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG3"
FT                   /protein_id="ABS12967.1"
FT                   /translation="MSGIEFTATIQADPDSWASFMEWIEEAQRKQLDRIKKTSLLSGME
FT                   VTVSMEEFGYAWSPVYWHEYDEPIAWVHNETGARVNGSKMPDQ"
FT   gene            248487..248903
FT                   /locus_tag="Oant_0237"
FT   CDS_pept        248487..248903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr8520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12968"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG4"
FT                   /protein_id="ABS12968.1"
FT                   /translation="MAGNKNSGRPEFAPTDEDREKVRVLKAGGMTNEAIAEVIGVSEPT
FT                   LRKHFSYELDIATAKVRADLLMARYRAAMGGNVQAQNKMIEQVSANAAQRKIAPEKEEK
FT                   KPKLGKKEEQKLAAQSIGGKFAPPTPPKLTVVSG"
FT   gene            248904..250625
FT                   /locus_tag="Oant_0238"
FT   CDS_pept        248904..250625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0238"
FT                   /product="phage Terminase"
FT                   /note="PFAM: phage Terminase; KEGG: mlo:mlr8521
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12969"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG5"
FT                   /protein_id="ABS12969.1"
FT                   /translation="MNANPVWSTACPDWERRIVARQSLITFDPLFPDEAEAALEVFKAL
FT                   RVVDLPKVYIEATDSYEHPTFGEVSEEWVFDFVRAVFGAYDASNAKRLIEEFFLLVSKK
FT                   NGKSTIVAGIMLTALIRNWRHSAELLILAPTREVADNSFKPAADMARADNDLVDLLHVQ
FT                   DNLKQITHRLTNATLKVISADASTSAGKKAAFVLIEELWLFGKKNGASAMLQEATGGLI
FT                   SRPEGFVIYISTQSDAPPAGVFKEKLEYFRNVRDGLIDDPRSLPVLYEYPEKMVKAKDY
FT                   LKPEHFYVTNPNIGKSVRLDWLSRKLANVMSGQDEEGDTIQTFLAKHLNVEIGMNLRAN
FT                   RWPGADFWAKRGDQAITLEYLYDHCDVIVPGLDGGGLDDLYGFAALGRHKATRDWLLWT
FT                   HAWCHKGVLDRRKTIADRLRDFAKAGELTIVEDELDDISAIVEIIAEIKQRGLLAAVAV
FT                   DPAGLGEMIEALDEIGVTQEEGLLVGAPQGYAMMNAIKTAERKLTNGTLKHSGSKLMSW
FT                   CVSNLKIEPTATAIRATKQNAGDAKIDPVMALFDAVTVMSRNPEVKREKTYQMMFV"
FT   gene            250659..251279
FT                   /locus_tag="Oant_0239"
FT   CDS_pept        250659..251279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0239"
FT                   /product="peptidase U35 phage prohead HK97"
FT                   /note="PFAM: peptidase U35 phage prohead HK97; KEGG:
FT                   bpm:BURPS1710b_1641 Caudovirus prohead protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12970"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG6"
FT                   /protein_id="ABS12970.1"
FT                   /translation="MEMTRRAYSCIEVKAVNEERRIIRGVATSPAVDRVGDIVDPMGVK
FT                   FQNPLPLLWQHKHDKPIGTVKFDAPTEKGINFEAELPVVSEAGTLRDRIEEAWQSIKLG
FT                   LVRAVSIGFRPIEYSFMEEGGIRFIESEVFELSAVTIPANEQAVISSVGKSLDADAIAH
FT                   IKKFEFPTEEKQAPAQMGKKVHVARLAAAAHDRVQFTINKINR"
FT   gene            251291..252700
FT                   /locus_tag="Oant_0240"
FT   CDS_pept        251291..252700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0240"
FT                   /product="putative major head protein/prohead protease"
FT                   /note="KEGG: ecs:ECs2250 putative major head
FT                   protein/prohead protease"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12971"
FT                   /db_xref="GOA:A6WVG7"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG7"
FT                   /protein_id="ABS12971.1"
FT                   /translation="MATYAEQIAAYENKRAANLKAMEDIMAKSADKGETLDAAQQEEFD
FT                   GLQADNDAIDSHLKRLRTLEKAAAEKAVPAAGGRETDGAQARSGVVVVPRTEKLDKGIA
FT                   FARIAKVKALAKLDGESVRTVAKELYGETSSVFGFFAKAAVPAATTTHATWAGPLVGDE
FT                   TSAFADFVEYLRPQTILGRFGANGIPSLRRVPFRVPLIGQTSGGEGYWVGEGKAKPLTK
FT                   FDFERKTLEPLKVANIAVATEEVLRDSSPSAEAIIRDQLVAALRARLDTDFINPAKAAV
FT                   AGTSPASITNGVTAIPSAGGTADDVRADIQKLFGAFIAANNAPTSGVWIMSATVALALS
FT                   LMQNPLGQAEFPGISMNGGTLFGLPVIVSEYVPVVTGSTDPADDGAYVVLVNASDIYFA
FT                   DDGDVAVDLSREASLEMADNPAHNSGTPTPAQLVSMFQTNSVAFRAERTLNWMARRANA
FT                   VQVLSAVKWGQ"
FT   gene            252919..253137
FT                   /locus_tag="Oant_0241"
FT   CDS_pept        252919..253137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12972"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG8"
FT                   /protein_id="ABS12972.1"
FT                   /translation="MIGFIGAAEFIQFIGDGGGGSIDPAFLVTVNGETVTNSGAPVTYG
FT                   TDIDPALLVLNDGSVVTNSGAIVLNGE"
FT   gene            253141..253440
FT                   /locus_tag="Oant_0242"
FT   CDS_pept        253141..253440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12973"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVG9"
FT                   /protein_id="ABS12973.1"
FT                   /translation="MAELSTLGSVIKTAYEGEANTNAYTDAEKTKLAGVAAGATALTIG
FT                   TTATTAKAGNYQPTWAQVTSKPVGVAVPDAAEGTEVATINALLASLRTAGFIAT"
FT   gene            253453..254778
FT                   /locus_tag="Oant_0243"
FT   CDS_pept        253453..254778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0243"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   phage portal protein; KEGG: ecs:ECs1544 putative portal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12974"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH0"
FT                   /protein_id="ABS12974.1"
FT                   /translation="MKIFGWEIGRAKSLSQPTANRGGWLPVIRESFSGAWQQNVEINRD
FT                   LALTYFAVFSCMTLIASDISKLRVKLMQRGDGGIWQETQNPAYDPVLRKPNSIQTRIQF
FT                   FENWLLSKLSNGNAYILKRRDGRGVVTALYVLDPQRVQPLVSESGDVFYRLSTDNISGI
FT                   EQDVVVPAREIIHDRYNCLFHPLIGLSPLTAAGLAAMQGITIQSDSANFFANKGVPSGV
FT                   LTAPGEISQTTADRLKEEWNKNYSGKNAGKVAVLGDGLDFKNMAFNATDSQLIEQLKWT
FT                   AEMVCSTFHVPPYKIGIGQMPTYNNIQALNIEYYSQGLQKLIEDAEICLDEGLGMKDGI
FT                   GTEFDLDGLWRMDSKTQMEVLEQAKSVMTLDERRRRIDLPKMKTGGDTVYLQQQDHSLE
FT                   AIAARDKQLIQQADNPQQPANDNPVQAEADKAMIEILKGFNR"
FT   gene            254775..255578
FT                   /locus_tag="Oant_0244"
FT   CDS_pept        254775..255578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecs:ECs1975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12975"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH1"
FT                   /protein_id="ABS12975.1"
FT                   /translation="MTFDGKAFGKEIVAVVKGFVADELKPLVKRLDDLEQQLKSLPTPK
FT                   DGKDADPETVAELVKCHVQSELADIRATIEAWSAPEPDREVMRGMVETAVSEAISAIPV
FT                   PKDGKDGRDGIDGKDGLPGERGEKGECGVGVAGAFIERDGSLAVTLSNGEVKNLGPVCG
FT                   KDGAPGQDGKDGIGFDDLDLVEDASGLSLKFVKGDTVKSFPLPVVIDRGVFRDGQTYQK
FT                   GSGVTWGGRYWIAQETTSDKPDGGKSWRLAVNKGRDGKDAKKVGE"
FT   gene            255578..255892
FT                   /locus_tag="Oant_0245"
FT   CDS_pept        255578..255892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0245"
FT                   /product="uncharacterized phage protein"
FT                   /note="TIGRFAM: uncharacterized phage protein (possible DNA
FT                   packaging); KEGG: ecs:ECs1545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12976"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH2"
FT                   /protein_id="ABS12976.1"
FT                   /translation="MADLVSLQEVKNGLRIDTDDDDAHLNLLISAASGRVKAYLDVRAN
FT                   EVIDDDGATTDARVKAAAIMLVGYYYRNPDQDPDQDFAVGMLPKPVSSMLYQLRDPIAR
FT                   "
FT   gene            255896..256246
FT                   /locus_tag="Oant_0246"
FT   CDS_pept        255896..256246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0246"
FT                   /product="phage head-tail adaptor, putative"
FT                   /note="TIGRFAM: phage head-tail adaptor, putative; KEGG:
FT                   sit:TM1040_1666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12977"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH3"
FT                   /protein_id="ABS12977.1"
FT                   /translation="MADNRSAGSLYYKVALYKREMVSDGMGNEVGQWVEQFQTRAEFIH
FT                   LRGGESVLAARLQGKHTQVIRVRNSSNTRLISTDWMLRDVRTGKSFNIRDIEHEVNRQF
FT                   ISLTCESGVATG"
FT   gene            256251..256691
FT                   /locus_tag="Oant_0247"
FT   CDS_pept        256251..256691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0247"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="TIGRFAM: phage protein, HK97 gp10 family; KEGG:
FT                   pde:Pden_0997 phage protein, HK97 GP10 family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12978"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH4"
FT                   /protein_id="ABS12978.1"
FT                   /translation="MVDGIKALEKRLTKTIPEAIRKAASDAMEKGAQEVVDMMKRRVPR
FT                   DTGELASTIGWTWGDAPKGSMVIGEVQNRKYNTMRIVIFAGSEKTRVGSRNQFQLARLL
FT                   EFGTQEMGPKPFFFGSWRANKKRVRSRVTRAIREAIKRENGA"
FT   gene            256688..257089
FT                   /locus_tag="Oant_0248"
FT   CDS_pept        256688..257089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_0367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12979"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH5"
FT                   /protein_id="ABS12979.1"
FT                   /translation="MNISEELQRYLYAKLRTVPEVLTLAGGRVYDRVPDNATFPYVSFG
FT                   PSDIVDDGAECIEAETHTIQLDVWSRAVGKGECKNITDGVKKALIRDTPALSDNAIVEM
FT                   TVPYCQVVTDPDGLTSHGIIQVEIKVEIA"
FT   gene            257371..257826
FT                   /locus_tag="Oant_0249"
FT   CDS_pept        257371..257826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12980"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH6"
FT                   /protein_id="ABS12980.1"
FT                   /translation="MATKPITAAFPDFILEVETETAGTFTKVCGLTQRGINRQHNMQTT
FT                   EVPQDCDDESLPSAIERAVQSSEVTISANGIWAAQSHEMMMDWWYNGQVKNIRIQHVKA
FT                   AVGDTEYETGPAYLVNLNNAVEKGQKVSADIEIQFDGVPTRTAKVAP"
FT   gene            257826..258221
FT                   /locus_tag="Oant_0250"
FT   CDS_pept        257826..258221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12981"
FT                   /db_xref="InterPro:IPR021791"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH7"
FT                   /protein_id="ABS12981.1"
FT                   /translation="MRPARSFVWPAGEHDFCLGIGELRALEQRSDAGCFVILTRLLTSQ
FT                   WKIDDVLQPIRLGLIGGGMDEREAQRTIDRALEIASPYSLAVPAATILHSFLMWDEEAD
FT                   QPGELKAGTEKAARRSRTEKQDGPSST"
FT   gene            258406..260757
FT                   /locus_tag="Oant_0251"
FT   CDS_pept        258406..260757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_3770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12982"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH8"
FT                   /protein_id="ABS12982.1"
FT                   /translation="MADDAAALLIRIEASQANVEKQMAYIARRAAKEAQSVEDRFKKAN
FT                   DNVAKSFKDGSDKAVMSIGATRAATANLSFQLNDIATSLSGGASPFTVMMQQGGQVAQV
FT                   FQGSGGVINAVKLLGGAFASVLNPVSLASFAIIGLTGAAYQYFSSLGSDTKDAEEVLKG
FT                   HSELIRRIKDAYGEAAAGADEYNAKSRQILAFDIQERIREYKDTIASVASDLNEQLSSI
FT                   PAGEFEGATYTIQELQGALSNLREGIKNGDPDIRKFINRLIDIENQTGTPESIKAIIRE
FT                   IINSGKAGEEVQSKLETLTGVITGVGTAAKRQADNVSAFTKSVRELANIAIPALSEMEK
FT                   AEKAYSDALRNATTREERDDAYRAFQAAQERIRVAQTIPTPGQRPNPESFAPERERRAG
FT                   GTRSKKVKDSFDELDDIVAKYVRDVVKAESGGRANAKNPLSSATGLGQFIESTWLDLFK
FT                   KNFPDRAKNMSDQTILALRNDAEISKKLIEAYARENAAILRQAGVSVNEAALQLAHFLG
FT                   PKGAISVLTAKSGTLVSQVLPQSAISANQSILGGGKTVDDVIAYAQSRVSAYDQMKEAA
FT                   RAYKLEQKELNREAKEFANLGKDLLGGFIDDLRNGASASEALANALQKVASKLIDIALN
FT                   NIFSGGGLFGGGKGGLFGGAIIPGILHSGGVAGTHGYGHGRAVSPSVFAGAKRYHTGGV
FT                   AGLQPGEIPAILQRGEVVLPRGAGMVNKARSTETINVVLRDDSGRMAQIADQRIQTASG
FT                   AIVQVSVQQSAKAVQSNFPTMLADAQARKM"
FT   gene            261102..261779
FT                   /locus_tag="Oant_0252"
FT   CDS_pept        261102..261779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12983"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVH9"
FT                   /protein_id="ABS12983.1"
FT                   /translation="MTILWPRSVLKPKRDPFNIAPRTLAGPSSVSGVTQVTASDAGIWK
FT                   ATFSDIIIRRGSPSVLAFRAIANLLEGRLRPILVPRCCAYQPFDPGGNGAADKVPHSDT
FT                   SPFSDGGLYRSRSIDIRLTSNIPLRGTTANISLVTAGQLQPSMDFSIGERMYRIRTVQM
FT                   TGANTATITFRPPAREAAPAGSELEFDYPVCRMRLASDSEMDLDLDLISQWSFPSVNFV
FT                   EDV"
FT   sig_peptide     261102..261218
FT                   /locus_tag="Oant_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.714 at
FT                   residue 39"
FT   gene            261779..262444
FT                   /locus_tag="Oant_0253"
FT   CDS_pept        261779..262444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pde:Pden_3598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12984"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI0"
FT                   /protein_id="ABS12984.1"
FT                   /translation="MAFFDPTQLAEFAKHEVRLDFLVEFRFASETMRVWNGNTALETGG
FT                   NRYEPMYGYGSIDGIGMASTTAAQNVTFQLSGLPDATLNFLAMALDANDEVDQRIVVIS
FT                   IQLFDEEWQPLGGPAPIWWGFMQPPRISRTEMQGTEGAIQSISMTAENAFFNRSRPAYG
FT                   RYTDRDQQRRSPGDKFCQFIGSLLFKSFKYPDYVFLFGIGLSTMLALSGVDGLVQRVV"
FT   gene            complement(262479..263123)
FT                   /locus_tag="Oant_0254"
FT   CDS_pept        complement(262479..263123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12985"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI1"
FT                   /protein_id="ABS12985.1"
FT                   /translation="MDYTGRKFHRYTVLKSAGYQGKSPMLLCRCDCGTERLVQKGNLIR
FT                   GRSRSCGCLQREELVARNIKHGLAPRGKKSSEFIAWRSMMQRCVNPKNHNFPNYGARGI
FT                   TVCAQWSENYANFLEDMGPKPSHVHSLERIDNNGNYEPGNCKWALPREQNRNRRNVLTI
FT                   LVEGNHVTLKEACDYYGAYYPTVRRRIYKGITIEEAIGTPIRGRIHKRKSR"
FT   gene            263164..263562
FT                   /locus_tag="Oant_0255"
FT   CDS_pept        263164..263562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr8543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12986"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI2"
FT                   /protein_id="ABS12986.1"
FT                   /translation="MSDMLKNFLSDEANRPFSWGFSDCVSTVDRWIRTCTGLSPLAWVD
FT                   REYSDADGAASVLSDRGGLAVLVNRAMRSQGFVKTDAPTTGDVGLIFHNEKLCMAIHAG
FT                   DCWFSHDEHGFIGAPLNAVWKAWRIKCQ"
FT   gene            263553..265325
FT                   /locus_tag="Oant_0256"
FT   CDS_pept        263553..265325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0256"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; KEGG:
FT                   bme:BMEI1000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12987"
FT                   /db_xref="GOA:A6WVI3"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI3"
FT                   /protein_id="ABS12987.1"
FT                   /translation="MPVALSGIIASVVGAGALGAALQTGLALITLAAGTTLGSLAIGLG
FT                   ISYLASSLFRPKQPKPEDVQQQVRQPTPPRIRHYGRVKTSGAWIFAETQSGGFFKVLAL
FT                   GQGPFDAIEEYWLDDQKIDLLPDGSPTPPSKWREGTTGNPLLRIQSRLGAPIETAYGEL
FT                   TSRFPQWTAAHRGDGIASLLASQYAVGDEYYLSLFPNGVNTNYRVVARTSLVKNPVTGA
FT                   VAWNDNAAAVIRDYMTHKDGMRLPESLVSTPLAQAGWVASYNRAAEAIPIAAGGTEPRY
FT                   RLWGSYSLDERPADVLGRMLGCSDGRLVPTPDGGLTLDIGAWSEPTVILTADAITGFSD
FT                   VGRGRDVMTTANTIRATFLDPNQDYQASDADPWADEADVSERGEEARDVQFNMAPSHSQ
FT                   ARRLMKLEWFRANPNWVGTFNTNLMGLAAFGERLIRIQYPLFGINSVFEVLDFKFILGE
FT                   GGILQGATIQVQSMPQTAYQWDTSQEGTAPVSDETTSDDDLPIPDAPDVTIISGPAAEL
FT                   SFPPTGNILLNYMVRWKKTADTEWRVAGPLENDAESFETPTLSALTEYEFQLAVRTQKG
FT                   RVGAYSASTIKTTP"
FT   sig_peptide     263553..263615
FT                   /locus_tag="Oant_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.568 at
FT                   residue 21"
FT   gene            265391..267469
FT                   /locus_tag="Oant_0257"
FT   CDS_pept        265391..267469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BR0980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12988"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI4"
FT                   /protein_id="ABS12988.1"
FT                   /translation="MTVRTIDEIFRDFVTDGVPASGPFNPHKPDIRDTLKALTEGGDNF
FT                   PDNRVIRLNNADEGTANNIVVTASVAIPAAAYQVLYILNVTQENTGPVTVSGAINRDLV
FT                   TNLNQPIEPSYLVPGMALLCIDTGTELRLLSYGADEAILAAAEAAADRAEEAAAAAEAA
FT                   AGGLLSSFASRTDVQTANIPNLVSYVRTAGYAASADGGEGLYKRSSSEPTHAGKVQSAD
FT                   GAWWELDMRNGVNVLQFGAKGDGVTDDYQAIQNAINALSTIGGIVRCPRGTYNLSDGLS
FT                   ILQNTANWHDTKRVSFVGDGAGLTRFYYTGAAADKAVIDWSTSNALDTDGTYGNSWARI
FT                   GGFSVEPRSAANYGVRITAKSWFEADDIKILGAVEKNFWFWSTVSWSGRSLRSYGSKIG
FT                   MHAELSDAPLAYSVPNNITLIDCTLGNATVWGMYARNCGPINLVGGSVEGCGAQGVDAS
FT                   GGIYIIRNDLGIGVEAVAMNIHGTYFEHNAGGADIYVSQQSNTYPVVVNDVGANFNRVD
FT                   SAKYTTNNIRIEVLGTSYGRINVMGGGFNYGGSYAPNASRRCLAITGNTGNVGNSINYD
FT                   KATVFRSATDGPSDLNGNWDIPQARVFAACRVNDTGAIVRKHNVASVTKGTAGSGRYTI
FT                   NFNYPASSGSPQVVGAVVGGAGSVAVVAEAAASVTIEVRNATGTVTDQSFSVAVYDA"
FT   gene            complement(267477..267758)
FT                   /locus_tag="Oant_0258"
FT   CDS_pept        complement(267477..267758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12989"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI5"
FT                   /protein_id="ABS12989.1"
FT                   /translation="MLLVFAFILGAIVATVAFYVFRELDPENDVEEADISASGLLASQQ
FT                   YPFTWSRHSPKPAKFVVLGVVDGNDVDSENGELNLSIRRPGVVTPKIA"
FT   gene            complement(267758..269734)
FT                   /locus_tag="Oant_0259"
FT   CDS_pept        complement(267758..269734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0259"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   noc:Noc_2178 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12990"
FT                   /db_xref="GOA:A6WVI6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI6"
FT                   /protein_id="ABS12990.1"
FT                   /translation="MSKITVLIPVYNAPKAVDFLLKSLRDNTNRSFVDQIVIGNDNSDA
FT                   MTTALIDDLTEGDELFHHIKREKNLGFLGNVNDLFKRATGDVVVLLNSDTILPAGWAER
FT                   VLAAFESDPTIGLACPLTTNATNLVLKPAPGQHWIDVDRAISTIPPVYPNCSPVVGFFL
FT                   CIRRAFFNDAELLDPIYGNGYWEDTDLHFRSLKRGYRNIVIDNLFVFHSNHSPSFSIDN
FT                   DLKQINDTNQKTFYRRWRKQYLQMVKTQADLSLSNRHAIPRTVQHRYIFTRKLEVLFVL
FT                   PAVHANSGGISVVMNFVDELNQRGIPAAVYTFGKCDLMYAHTHLQNVPFMDKQDLINQI
FT                   ASVKYVFATSYNSHDHAQALASHYGSKLACFVQGPEAAFANGVHAVAMLKRYNSYDVNV
FT                   AVSEYLAQYVEAMGAQAIKIPLGPSKLAFYASERAKRSPKALAACIREADLKGTGRLCA
FT                   NLAMAQKAGFEIHLFGETEGWDIMDKAKCHGNLTSAQLAKLFSQVSYYLDTSHMEGLGL
FT                   LPLEAAFSGCIPIVAQEMGLTGIIEDGKNAIVLPHEFPGILFYKSLLEGRDGIRTSAPG
FT                   LRDKVSLEAAVSSFIDQLSLVQSSEMPVHLLPAQDHHNPSIVDERDYYRAKLQQVYRSK
FT                   SWWLTKPVRFSGRLARRILKAER"
FT   gene            complement(269820..270644)
FT                   /locus_tag="Oant_0260"
FT   CDS_pept        complement(269820..270644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0260"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sus:Acid_2376 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12991"
FT                   /db_xref="GOA:A6WVI7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI7"
FT                   /protein_id="ABS12991.1"
FT                   /translation="MLDLTGRLRTFFHSNVDEIPDRLLKDVHRRMKPVITDNIELLQSF
FT                   SRKQREYFALKTGTMVLYIGDEVAEVMKAEEEGALRAAPKGYGLDQLVGLNIGCGARLI
FT                   SPYLLPVDIMRTNHYGTGAGEHAALTATALLSLSDDLPFKPNSVDYIVALHMLEHVANP
FT                   VETVNHWLDVIKPGGGIGIVVPDWRYTWDSRKDKGKFSHKWNPTPNFLQQLYRDYWQSK
FT                   CTLEHIATYDFRLSFDVVLRKHGTFEPFQLPNPDKIRSGHELHEAGEFLGDF"
FT   gene            270795..271514
FT                   /locus_tag="Oant_0261"
FT   CDS_pept        270795..271514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12992"
FT                   /db_xref="GOA:A6WVI8"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI8"
FT                   /protein_id="ABS12992.1"
FT                   /translation="MHLGDTRLLIEAGRKHGLLRNQMAYVLATAYHETAHTMKPIIEKG
FT                   GEKYLRSKKYWPFFGRGYVQITWRDNYERAGKILGVDFIRSPELLLKPEYAAPIIIAGM
FT                   VEGWFTGKKLSDYITLQKSDFKNARRIVNGTDKAELIAGYARDYDKALLAEGYGVEQVV
FT                   TAPAAEVVPVPVEEKPISKSSRFWTWFGSGGGAAVMPFVDWKVQMVIVAAIILIAGYAI
FT                   FTMPQARAKLEKLVDAI"
FT   gene            271659..271901
FT                   /locus_tag="Oant_0262"
FT   CDS_pept        271659..271901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMb20921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12993"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVI9"
FT                   /protein_id="ABS12993.1"
FT                   /translation="MKPQAKLWTLLALMMSALTLAGCGHSGPANVSGVRNVLGTDLLGA
FT                   RGATEADQRKIDRTIVRGCAGGVWSKDECAIHDKK"
FT   sig_peptide     271659..271754
FT                   /locus_tag="Oant_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.641 at
FT                   residue 32"
FT   gene            271919..272236
FT                   /locus_tag="Oant_0263"
FT   CDS_pept        271919..272236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12994"
FT                   /db_xref="GOA:A6WVJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ0"
FT                   /protein_id="ABS12994.1"
FT                   /translation="MDATNMPDTENDLRSRVVNLEHTAAANVQRLTSIESRLVKYDIDD
FT                   ARKDEQMKTIQNQITSLDKKFDDKVNGIASSLKSINMYIIGGIIAGIIGFMLKGGFHIP
FT                   G"
FT   gene            complement(272237..272431)
FT                   /locus_tag="Oant_0264"
FT   CDS_pept        complement(272237..272431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12995"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ1"
FT                   /protein_id="ABS12995.1"
FT                   /translation="MINPKREGDYPDRDMDLQEMIAAMLVEALDAAEAAGWDRTDAATA
FT                   MVEAAIAIHQGETGTAPDE"
FT   gene            273111..273716
FT                   /locus_tag="Oant_0265"
FT   CDS_pept        273111..273716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0265"
FT                   /product="protein of unknown function DUF1062"
FT                   /note="PFAM: protein of unknown function DUF1062; KEGG:
FT                   rle:RL2642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12996"
FT                   /db_xref="InterPro:IPR009412"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ2"
FT                   /protein_id="ABS12996.1"
FT                   /translation="MITPKTAPQPWIACSGCGKLKPFQSSGKVRLNANGRKLDAWLIYK
FT                   CLTCDKTWNRTIFERQNIREINPRILEAVHSNDPQWIWVEAFNMQALKRKSQRVDEFPE
FT                   YDVAKRIVCGAASCKAIEIELQIALPVSIRLDRLLAAELKLSRARLQALSDGGVIRIVP
FT                   DENDMLRRRLKTGVMISINPGEPGQETGWQSLLTAVTS"
FT   gene            complement(273789..274550)
FT                   /locus_tag="Oant_0266"
FT   CDS_pept        complement(273789..274550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0266"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bmb:BruAb1_0191 transcriptional regulator,
FT                   Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12997"
FT                   /db_xref="GOA:A6WVJ3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ3"
FT                   /protein_id="ABS12997.1"
FT                   /translation="MHSGKQITDPSIEALIGLLEAPPILAKLEARETDALSSLTVIEND
FT                   YAADATIIEQGARVRSIHLVRSGWGCVYRDLSSGERQIIDFPMRSDFLGLRTADGYSYN
FT                   TIAAITPMSAFEIPLASLEASIERAPRLSLILIELLARQRSMLIEHLTNIGCRAAFVRT
FT                   AHLFLELSDRVKSCGMGDPNSFYCPLTQYQLADALGLTPIHLNRMLRDLREEGLILFRS
FT                   NRVEILDRKRVVALAQYDGEFMRMSVFGKTD"
FT   gene            275054..275779
FT                   /locus_tag="Oant_0267"
FT   CDS_pept        275054..275779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0267"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: bmf:BAB1_0197
FT                   bacterial regulatory protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12998"
FT                   /db_xref="GOA:A6WVJ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ4"
FT                   /protein_id="ABS12998.1"
FT                   /translation="MLETRGDSLWAASESMGDRGNAASIEAARGRRLLLVCKSNLERQC
FT                   LYNGLVLNGLKLPVETQAAVELADPTDDIAVVLINIGSKRLADPFFSEKLQAVIELWRP
FT                   VPVVFLAEREEWSQVVRAMEIGARGYIPTSVDIKVCVEAIHLATAGGMYVPASMVFQTA
FT                   PTDIDDDVLGELLTAREIEVVHAIRIGKSNKIIAFELGMSEGTVKAHVHNIMKKIGAAN
FT                   RTEVACKLHRMYGEKFDFD"
FT   gene            276456..277247
FT                   /locus_tag="Oant_0268"
FT   CDS_pept        276456..277247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0268"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; regulatory protein DeoR; KEGG:
FT                   bmb:BruAb1_0194 GlpR, glycerol-3-phosphate transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABS12999"
FT                   /db_xref="GOA:A6WVJ5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ5"
FT                   /protein_id="ABS12999.1"
FT                   /translation="MQLTPRHNAILELARKQGQVLVDDLAAAFEVTPQTVRKDLNDLCR
FT                   ARMLRRIHGGALYPSGVENMEYEARRRIAAHEKESIGRAAAEIIPDGASLFINIGTTTE
FT                   AVSQALVDHNNLMVITNNINVANTLRVHPSIEVVVAGGVVRPSDGGIVGEAAVDFIRQF
FT                   KVDYAIIGASAMDEDGALLDFDFREVKVAQAIIANARHVILVTDATKLERTAPVRIGHI
FT                   SQINTFITDHCPSNQLRELCHESEVELIETLGESRAAEKQA"
FT   gene            277329..278840
FT                   /locus_tag="Oant_0269"
FT   CDS_pept        277329..278840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0269"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG: bms:BR0200
FT                   glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13000"
FT                   /db_xref="GOA:A6WVJ6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ6"
FT                   /protein_id="ABS13000.1"
FT                   /translation="MAQEKLFDIFVIGGGINGCGIARDAVGRGFSVGLAEMNDLASGTS
FT                   SRATKLIHGGLRYLEHYEFRLVREALMEREVLWANAPHIIHPMRFVLPYHKGGMRPAWL
FT                   LRLGLFLYDHLGGRKKLPATRTLDMRSDPAAQPLKPLFTKAFEYSDCWVDDARFVALTA
FT                   RDAADRGAIIQTRTKVVAARRDREYWTITLEDTGTHEREEVRARLLVNAAGPWADKVLQ
FT                   DVEGDRQLHNVRLVQGSHIVVRKKFSDPRSYFFQNNDGRIIFAIPYEDEFTLIGTTDQD
FT                   YQGDPAKVAITDGETDYLCAAASEYFKEPVRRADIVWTYSGVRPLYDDGASKAQEATRD
FT                   YVLKEDAPDGLAPLINVFGGKLTTARRLAEHMLEKIEHRLGQKGAPWTHAAPLPGGDFV
FT                   DVEFERELQKVKVAYPFLTPAHARRLFRQYGTRIRVLLGEATSLADLGQHFGADLYEAE
FT                   VRYLLENEWAVSAEDILWRRTKLGLRLNAADVSSLEEYLKPARVA"
FT   gene            278933..279904
FT                   /locus_tag="Oant_0270"
FT   CDS_pept        278933..279904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0270"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; GAF domain protein;
FT                   KEGG: bmb:BruAb1_0196 transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13001"
FT                   /db_xref="GOA:A6WVJ7"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ7"
FT                   /protein_id="ABS13001.1"
FT                   /translation="MGTPQDRTHADLIQSAIMTAGGAARSALVASWRRSSELHGLDPAE
FT                   LGSVRTLSDGEFRTAHQRIERLVSIAQASMDRLYLAVGGVGCCVLLADSEGVPVERRGA
FT                   PGDDDTFYRWGLWTGAVWSEQSEGTNGIGTCIVEQRPLTIHRDQHFHTRNIGLSCTVAP
FT                   IHDHQGRLMAALDVSSCRADLTEAFAQLISVAVIDAARRIEAENFRQAFPEARIMLAPS
FT                   PDRTGGALIAVDKDDLVIGATRAARLAMGLDDAAIAVPLPAADLLGWHADPREDMAESE
FT                   RSVILRALARAEGNISAAAGLLGISRATLHRKLNRLKIIRPH"
FT   gene            280047..281564
FT                   /locus_tag="Oant_0271"
FT   CDS_pept        280047..281564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0271"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bme:BMEI1747
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13002"
FT                   /db_xref="GOA:A6WVJ8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ8"
FT                   /protein_id="ABS13002.1"
FT                   /translation="MNKVEFSRTVKPAFAKRYGNFIGGKWVEPKSGRYFENTSPVNGQV
FT                   LCEVARSDAADVEAALDAAHAAKDAWGKTSAAERALILNRIADRIEENLPALAAAETWD
FT                   NGKPIRETTAADLPLAIDHFRYFAGVIRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPW
FT                   NFPLLMATWKLAPALAAGNCVVLKPAEQTPASILVLMDLIGDLLPPGVINVVNGFGLEA
FT                   GKPLASSPRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDF
FT                   LDKAIEGFVMFALNQGEVCTCPSRALIHESIYDKFMEKALKRVNAIVQGDPLDPATMIG
FT                   AQASSEQLEKILSYLDIGRQEGAEVLAGGERNILPGDLAGGYYVKPTVFKGTNKMRIFQ
FT                   EEIFGPVVSVATFKDDAEALSIANDTLYGLGAGIWTRDGTRAYRFGRAIQAGRVWTNCY
FT                   HAYPAHAAFGGYKQSGIGRENHLKMLDHYQNTKNMLVSYSPKKLGFF"
FT   gene            281813..282847
FT                   /locus_tag="Oant_0272"
FT   CDS_pept        281813..282847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0272"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bmb:BruAb1_0198 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13003"
FT                   /db_xref="GOA:A6WVJ9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVJ9"
FT                   /protein_id="ABS13003.1"
FT                   /translation="MAKTMKAAVVRAFGKPLTIDEVPIPEPGPGQIQVAIHASGVCHTD
FT                   LHAAEGDWPVKPNPPFIPGHEGVGYVSAVGSGVKHVKEGDRVGVPWLYTACGHCRHCLG
FT                   GWETLCEEQLNTGYSVNGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKGLKV
FT                   TDTKPGDWVVISGVGGLGHMAVQYAKAMGLNVAAVDIDDRKLDLARKLGATITVNAKTH
FT                   NDPAAYIKKETDGGAQGVLVTAVSPIAFEQALGMVSRGGTVSLNGLPPGDFPLSIFNMV
FT                   LNGVTVRGSIVGTRLDLQESLDFAGDGKVRATIRTEKLEDINSIFDDMRQGNIEGRVVV
FT                   DLTQ"
FT   gene            282912..283271
FT                   /locus_tag="Oant_0273"
FT   CDS_pept        282912..283271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0273"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   bmb:BruAb1_0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13004"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK0"
FT                   /protein_id="ABS13004.1"
FT                   /translation="MVEVAPGDGKGQVSATAAALDLIRELQAEYGPIMFHQSGGCCDGS
FT                   SPMCYPQGEFIVGDTDVKLGEIGDAPVYISGPQYDVWKHTELIIDVVPGRGGMFSLDNG
FT                   REVRFLTRSRVCSVP"
FT   gene            283335..284357
FT                   /locus_tag="Oant_0274"
FT   CDS_pept        283335..284357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0274"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bmb:BruAb1_0200 transcriptional regulator LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13005"
FT                   /db_xref="GOA:A6WVK1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK1"
FT                   /protein_id="ABS13005.1"
FT                   /translation="MAAAGKRATIHDVARLAGVSIKTVSRVYNDEPNVREAIREKVRQA
FT                   GSELRYRPNAAARNLVERRSHLIGLFFENPSASYVTELQMGALERLRDTRYRLLIFPVE
FT                   NREDIRGALIETAHASGLDGIIVTPPMSDDPEILAELTASAMPFARVAGDANVHPTDSV
FT                   TIDDEAAGVDLMEYLLKLGHRRIAIVIGDPTHRSAELRLAGYRRALEEAGIKRNPDYEV
FT                   QGGFSFASGLAAGKKLLSLEEPPTAVFASNDDMAAAVMQVAYDRNIAIPDQLTVVGFDD
FT                   SAIASMVSPQITTVRQPIFEMTRDAADMLLNQIETGHLSASRRIEYKLIIRQSSGKAPV
FT                   "
FT   gene            complement(284364..286274)
FT                   /locus_tag="Oant_0275"
FT   CDS_pept        complement(284364..286274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0275"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: mlo:mll7848 putative cyclic
FT                   beta-1,2-glucan modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13006"
FT                   /db_xref="GOA:A6WVK2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK2"
FT                   /protein_id="ABS13006.1"
FT                   /translation="MPGVMENTAARRWSDAAIFGPARIAWPLRLAAIALASIVLSTLLV
FT                   FAVEWIVRGSFTDTMQFFRTPHKPAWTTVALFVVVLTASDAIFGRIHYGFFVVGPLALI
FT                   AATTAREKSLYLGDPLYPSDFLYARQIVDLLPLLVRDRPWSAVGIALLIIASAAVMITV
FT                   TLFWWRRFDPIPWKGRMLRIAFALPLLAWFAVISDYASFSLARDRLRILPIMWDQKENY
FT                   AHNGFTMAFILNVPMATVFAPEGYSSEAIAAIEPPAQLIPAAFDTSKPDVIMVMSESFW
FT                   DPTRLPGVAFSADPIPTVRAEQSGHVFSPEFGGMTANVEFEALTGFSKAFLPSGSIPYQ
FT                   QYIRRPLPSLASFFKDQGYATRAIHPYRQWFWNRGPVYESMGFDKFMSEENMPPLEKRG
FT                   SLASDAALTDEIIREADSMDAPFFFFAVSLQGHGPYEANRYPDSKLEVQTDASEHTRQS
FT                   IRSYSQGAMDADASLARLMEWASKRDRETILVFFGDHLPPLGPVYVETGLMANRVASRT
FT                   APAADMMLQHETPLVLWSNKRGAERGTGTISPAFLPLHILDMAGMQHPYYTGFLRQLHE
FT                   RYQVVDNHAVFDRSEKVEEGWQQRPPFPPLLRDYQMLQYDMIFGSNFARERFFPSRPAQ
FT                   S"
FT   gene            complement(286555..288360)
FT                   /locus_tag="Oant_0276"
FT   CDS_pept        complement(286555..288360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0276"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: mlo:mll0815
FT                   ATP-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13007"
FT                   /db_xref="GOA:A6WVK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK3"
FT                   /protein_id="ABS13007.1"
FT                   /translation="MTRFRIDFRGPAFRNVLGYTFGHWRSQPLRLTLMIIGMLLATAAD
FT                   VLTPLYSGRLVDALSLGGDSGWDAAIHALIILLALGALALITRQLTFYVITDFTLKIMS
FT                   DMAASSFRKLQRFSTDWHANAFAGSTVRKVSRAMWALDLLNDTLIVALLPSILMLVGSV
FT                   VLLSWYWPLMGLLVAIGSVLFIVCTIVISLGFVAPAATLANSWDTRMGGALADAISCNA
FT                   VVKAFGAESREDARLAKVVSKWRGRTRRTWLIGTLNGFIQGANLLVMRGVVIAFALYLW
FT                   SQGKATAGDITFVLTAFFMLQGYLRDVGMHIRNLQRSVNDMEELVDIEAQPYGIADKPG
FT                   APAIKIGNGEITFDHVTFHYGNHEAALYRDFSVKIEAGERVGLVGHSGSGKTTFVKLIQ
FT                   RLYDVSGGAIKIDGQNIAEVTQASLRSQIAIVQQEPILFHRTLAENIAYARPGATQAEI
FT                   EEAARLASAHDFISRLPKGYATLVGERGVKLSGGERQRVAIARAFLADAPILILDEATS
FT                   SLDSESEVLIQQAMERLMVGRTTLVIAHRLSTVRALDRLLVFDKGKILEEGDHDALIRK
FT                   PGGIYRRLFERQALELTKGLEDVFS"
FT   gene            288851..290284
FT                   /locus_tag="Oant_0277"
FT   CDS_pept        288851..290284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0277"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bms:BR0210
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13008"
FT                   /db_xref="GOA:A6WVK4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK4"
FT                   /protein_id="ABS13008.1"
FT                   /translation="MTVHQNLIAGEWVGGDGIANINPSDTNDVVGTYARATAEDTKAAI
FT                   AAAKAAFPAWSRSGILERHAILRKTADEILARKDELGRLLSREEGKTLAEGIGETIRAS
FT                   QIFDFFAGEALRLAGEVLPSARPGIGVEITREPIGVVGIITPWNFPIAIPAWKIAPALC
FT                   YGNTIVFKPADLVPGCSWAIVDILHRAGLPKGVLNLVMGKGSVVGQTILDSADVQAVTF
FT                   TGSTGTGKRVAAASIEHNRRFQLEMGGKNPVVVLDDADLDVAVESVVNSSFFSTGQRCT
FT                   ASSRIIVTEGIHDKFVAAAIEKLKSVVVDNALKQGTHIGPVVDESQLQQDMDYIEIGRK
FT                   EGAKLAFGGERLNRETPGFYLQPALFTEATNQMRISREEIFGPVASVIRVKNYEEALAT
FT                   ANDTSFGLSSGICTTSLKYATHFKRNSEAGMVMVNLPTAGVDFHVPFGGRKGSSYGPRE
FT                   QGRYAAEFYTTVKTAYTLA"
FT   gene            complement(290334..291110)
FT                   /locus_tag="Oant_0278"
FT   CDS_pept        complement(290334..291110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0278"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bmb:BruAb1_0206 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13009"
FT                   /db_xref="GOA:A6WVK5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK5"
FT                   /protein_id="ABS13009.1"
FT                   /translation="MNEALPNRSRKKRAADGLLSAAIALAIWQAVVSIGQMPRFILPGP
FT                   LDVVRSLIGNAGLIAENAAATIGEVLGGLALGCAVGIATAICLMMSPLAQRLVMPAMVF
FT                   SQAIPIFALAPILTLWLGYGPASKIAVTVLMIFFPVVSTFFDGMRRTDSSLIDAAEILG
FT                   AGRMAILFRIRIPSAFPSLASGLSLAAVYAPIGAVVGEWVGASKGLGYLMLLANGRAKV
FT                   DLMFACLFVLAAFTMLLHGTVSHFARKLAAWPKKAA"
FT   gene            complement(291110..291805)
FT                   /locus_tag="Oant_0279"
FT   CDS_pept        complement(291110..291805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0279"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: bms:BR0212
FT                   transcriptional regulator TenA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13010"
FT                   /db_xref="GOA:A6WVK6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK6"
FT                   /protein_id="ABS13010.1"
FT                   /translation="MSQPQPHYSSELFTRLRAATLDDWKPYIDHEFVRGLGDGTLPKAA
FT                   FLHYLRQDYVYLHHYARAFALGVVKANTLQETRLCAQIMHGLAVTELPLHVGICAREGI
FT                   SEDELYATREEPENLAYTRYVLDCGQAGDFLDLLTALVPCAHGYGEIGLNLAVTALPGT
FT                   PYQEWIDTYAGPDYQDMCHTVGKLFDQAAKDRIGDDFEKSPRWPRLCQIFATASRLEAD
FT                   FWSMGLKAG"
FT   gene            complement(291802..292770)
FT                   /locus_tag="Oant_0280"
FT   CDS_pept        complement(291802..292770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0280"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bmb:BruAb1_0208 ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13011"
FT                   /db_xref="GOA:A6WVK7"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK7"
FT                   /protein_id="ABS13011.1"
FT                   /translation="MKKTAFAALFGLALTAATSAHADDKLKLILDWYVNPDHGPIIVAD
FT                   KLGYFKDAGLDVDIVAPADASTPTKMVAAGQADLAISYQQQVHLQVHEGLPLIRVGTLI
FT                   DSPLNCLMTRDDGSVNSIADLKGKKIGYSVAGTEETLLGTILGQHGVKLSDVELINVNF
FT                   SLAPSLMSKQVDAVMGAYRNVELNQMAVEGVPGKCFFVEEEGVPVYDELVYVAASDKLD
FT                   AAEKDKIARFLSATEKAAQYIVNHPEKSYDVFASYSSELKDELNQRAWKDTVARFSRSP
FT                   ASLDYGRWSRYETYLKENGLVPSVLPVEKFAIDVNAEGSKS"
FT   sig_peptide     complement(292702..292770)
FT                   /locus_tag="Oant_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(292767..293396)
FT                   /locus_tag="Oant_0281"
FT   CDS_pept        complement(292767..293396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0281"
FT                   /product="Thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="PFAM: thiamine monophosphate synthase; KEGG:
FT                   bms:BR0214 thiamine-phosphate pyrophosphorylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13012"
FT                   /db_xref="GOA:A6WVK8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVK8"
FT                   /protein_id="ABS13012.1"
FT                   /translation="MALDPFYPIFDSAKWLERMVPLGVKLVQLRVKDKSEPELRSEIRA
FT                   AREICLAHNCQLIVNDYWKLALEEGCDFIHLGQEDLDDADLSAIRDGGLKLGVSSHDEA
FT                   ELDRALSVKPDYIALGPIYPTILKKMKWHEQGLPRLGQWKARIGDIPLVGIGGMSVERA
FT                   PGVFEAGADIVSVVTDITLNADPESRLRQWIETTRAYAGHALEQTT"
FT   gene            complement(293396..294166)
FT                   /locus_tag="Oant_0282"
FT   CDS_pept        complement(293396..294166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0282"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   bmb:BruAb1_0210 ThiG, ThiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13013"
FT                   /db_xref="GOA:A6WVK9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVK9"
FT                   /protein_id="ABS13013.1"
FT                   /translation="MLEFYGQKFESRLLLGTAQYPSPAILADAVRASQSDIVTVSLRRE
FT                   SGEARAGQDFWALIRELGVAVLPNTAGCHTPREAVTTAKMAREIFGTNWIKLEVIGDTD
FT                   TLQPDPFGLVEAARALCDDGFEVFPYMNDDLVVAERLIEAGCKVLMPWGAPIGSGRGLN
FT                   NPYALKTMRAHFPDIPLVVDAGIGVPSHAAAAMELGYDAVLINTAVAKAGDPVAMARGF
FT                   ALAVEAGRLAFEADAIEARDMAAPSTPLLGKAFL"
FT   gene            complement(294168..294365)
FT                   /locus_tag="Oant_0283"
FT   CDS_pept        complement(294168..294365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0283"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: bmb:BruAb1_0211 thiamine
FT                   biosynthesis ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13014"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL0"
FT                   /protein_id="ABS13014.1"
FT                   /translation="MTIVLNGEVITTAAANLAALLAEIELDEAVVATALNGEFVASDER
FT                   AAATLSAGDRIEVLAPMQGG"
FT   gene            complement(294362..295366)
FT                   /locus_tag="Oant_0284"
FT   CDS_pept        complement(294362..295366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0284"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: bmb:BruAb1_0212 D-amino acid oxidase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13015"
FT                   /db_xref="GOA:A6WVL1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL1"
FT                   /protein_id="ABS13015.1"
FT                   /translation="MRVTIIGAGVAGLVCAAEFHDQGHAVTVIAKSTEIGSDSCSWFAG
FT                   GMLAPWCEGESAEEPVVRLGQEAIGWWERHVSTVHRKGTLVLSHTRDATELRRFARRTE
FT                   AFDTIDQDQINALEPDLADRFRQGLFFAAEGHLNPRQTLIELAEKLQKKGVVFHLGQDV
FT                   KDVKVEADITVDARGLAARDQLQDLRGVKGEMLVVRSRDINLKRPIRLLHPRIPLYIVP
FT                   RGDGVHMIGATMIESDERGGISVRSTLELLSAAYALHPAFGEAEILETGVDARPAFPDN
FT                   LPRVRRRGKTVYVNGLYRHGFLLSPAIARMAVASATMPEDAPEPKPEFVEDYA"
FT   sig_peptide     complement(295316..295366)
FT                   /locus_tag="Oant_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.707 at
FT                   residue 17"
FT   gene            complement(295366..296253)
FT                   /locus_tag="Oant_0285"
FT   CDS_pept        complement(295366..296253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0285"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: bme:BMEI1732
FT                   phosphomethylpyrimidine kinase / hydroxymethylpyrimidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13016"
FT                   /db_xref="GOA:A6WVL2"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL2"
FT                   /protein_id="ABS13016.1"
FT                   /translation="MRDVMMDQKNSFSRTTSNGSAAFVPICVTIAGSDSGGGAGIQADL
FT                   KTFSALGVYGASVIAAVTVQNTCTVSAVHDIPPAIVAGQIDAVFSDLDVAAVKIGMVSV
FT                   PETIEAIARGLAHFSGPVVLDPVMVAKSGDRLLSENAIALLRQKLVPLATLLTPNRPEA
FT                   ACLLDSDLARDDVDAEEQGRALLELGAKAVLMKGGHAEGEICVDLLVRRDQPTLRVEAT
FT                   RIRTGNTHGTGCTLSSAIAAELAKNLPLEKAVIAAHAYLQGAIRAADALKIGQGHGPVH
FT                   HFHNLWKVHSEEAM"
FT   misc_binding    complement(296325..296481)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 65.86"
FT   gene            296715..298838
FT                   /locus_tag="Oant_0286"
FT   CDS_pept        296715..298838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0286"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein; KEGG: bms:BR0219 sensory
FT                   box/GGDEF domain/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13017"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL3"
FT                   /protein_id="ABS13017.1"
FT                   /translation="MRKRRGASASTEGTMARTSEQDFRILFTTHPTPMWVYDPETLHFI
FT                   VMNDAAYRLYGYTADEIPGMTVLDIRPQTERDRMLAAIRDRSDLERPERWQHLRANGEI
FT                   IDVLTYGRQVLFDGKEAILAIVQDRTELAEANRQANHAQTLLDSLVNNLPLGVFVKDMH
FT                   DDGRYVLYNQAASAASGQPVDEAIGSTDLDLFPEREATVIIQQDRTAMRRRGVLNVERK
FT                   IERKDGTSRTMRIIKCSIPPVEGNEPRYLIGLVEDITERREIEERMAHIAMHDSLTGLP
FT                   NRAYFAHHVESLLKKGGDSEPFALFYLDIDHFKNINDNIGHQAGDQLLQEVARRLKQIT
FT                   TSDEFIARLGGDEFAIVYRSGTLAQIAMFADRILSAFQDPFELVRNSEFVACSMGIAQA
FT                   PLHGDNPDVLMRNADLALYASKSGGRRTFRFYQHSLRLAAEKRYVMTGELRQALLDEQF
FT                   ELHYQPIFNLESGKISGFEALIRWRHPDRGMVSPAEFIPLAEETGLIGPIGDWVLRTAC
FT                   REAVLWPEDIKVSVNLSPVQFSQTTLLHSVTDALEAARLSPDRLELEITESVFLSNSKN
FT                   NIELLFELRRLGVRIAMDDFGTGYSSLSYLRSFPFDKIKIDRSFVSGIEVDTRDLAIIQ
FT                   AVATLGAGFNIVTTAEGVETAQQLERLKTERFGEVQGFLTGRPMPAGDVHSFIQNRSNV
FT                   GLEMPAAHNRLPI"
FT   gene            299005..301488
FT                   /locus_tag="Oant_0287"
FT   CDS_pept        299005..301488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0287"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper ion binding protein;
FT                   copper-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: bme:BMEI1730 copper-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13018"
FT                   /db_xref="GOA:A6WVL4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL4"
FT                   /protein_id="ABS13018.1"
FT                   /translation="MNRPVNHETISFPVPVEGMSCASCVSSVEKAVSKVPGVDKVSVNL
FT                   ATERADVTFRGEPDLPSVIDAIRKAGYDVPAGSIDLAIEGMTCASCVSKVEKALNAVPG
FT                   VTRASVNLATERAHVELAGPVQSSELIKAVEQAGYEARSLDDAQSDVKQETQSEKRDAE
FT                   AAELKKSVILSAVLTLPVFVMEMGSHLIPAVHMFVMDRIGMQNSWYLQLVLTTLVLFGP
FT                   GLRFFKKGIPALLRGTPDMNSLVVVGTLAAWGYSVVATFLPGVLPEGTVNVYFEAAAVI
FT                   VTLILIGRYLEARAKGRTSAAISRLVGLQAKSARVVRNGETIDVPLEDVRAGDVVQVRP
FT                   GEKVPVDGEVIEGSSYVDESMITGEPVPVAKEKGAEVVGGTINKTGAFTFRATKVGRDM
FT                   VISQIIRMVEDAQADKLPIQAKVDKVTGWFVPAVMAAAALTFALWLVIGGTGMLGYALV
FT                   NAIAVLIIACPCAMGLATPTSIMVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTL
FT                   TQGKPALAHFATVEGFEKDELLALVAAVEARSEHPIADAIVEAAKEKGLKLADVSAFEA
FT                   VPGFGLKAHVSGHEIAIGADRYMAKLGHDVAVFANDAKRLGDEGQSPLYAAVDGKLAAI
FT                   LTVADPMKETTPAAIAALHEQGLKVAMITGDNRRTAEAIAKRLGIDEVVAEVLPDGKVE
FT                   ALKRLSAGGKRIAFVGDGINDAPALAAADVGIAIGTGTDIAIESADVVLMSGDLRGVVN
FT                   AIAISKATIRNISENLFWAFAYNVALIPVAAGVLYPFTGTLLSPVLAAGAMAFSSIFVL
FT                   SNALRLKAFKSPIEA"
FT   gene            complement(301621..302907)
FT                   /locus_tag="Oant_0288"
FT   CDS_pept        complement(301621..302907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0288"
FT                   /product="Tagatose-6-phosphate kinase"
FT                   /EC_number="2.7.1.144"
FT                   /note="PFAM: D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ; KEGG: mlo:mll7215 probable tagatose
FT                   6-phosphate kinase agaZ"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13019"
FT                   /db_xref="GOA:A6WVL5"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL5"
FT                   /protein_id="ABS13019.1"
FT                   /translation="MSSTNVLSALPARYASGVRGGITSICSAHPLVIEAALLEGIATST
FT                   DVLIEATCNQVNQDGGYTGMTPADFRRFVEDIAARVGFDTKRLILGGDHLGPNPWKHLP
FT                   AEEALAKSDVMIDAFVRAGFTKIHLDTSMGCAGEPVALPDAVTAERAARLAKVSEAAAH
FT                   EAGYDLPVYIIGTEVPIPGGAMEEIEELELTKPGAAVETVAIHRKAFAALGLEDAFARA
FT                   IGVVVQPGVEFGNENVVFYNSEKATALSGVLSEMAQFVFEAHSTDYQPVEALSDLVDDG
FT                   FTILKVGPGLTFALREALYGLDQIAAFLDKLPEEETLRGKMEALLLAEPKNWEKYYHGD
FT                   AEELRLQRHFSYSDRIRYYWPHPVATAAVDALLNRLEGRKIPETLISQYLGTLYPAVAS
FT                   GEIEATPHALMVEAVRNVVRTYGKAVGTH"
FT   gene            complement(302904..303851)
FT                   /locus_tag="Oant_0289"
FT   CDS_pept        complement(302904..303851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0289"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sme:SMb21374
FT                   putative sugar kinase, PfkB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13020"
FT                   /db_xref="GOA:A6WVL6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL6"
FT                   /protein_id="ABS13020.1"
FT                   /translation="MKKIITIGEIVVEIMAVETGNGFKTAIPLIGPFASGAPAIFIDQA
FT                   AKMGQSCGMVSAVGNDDFGALNIERLQKDGVDISAIGVHPTAATGSAFVRYRPDGNRDF
FT                   IFNIKHSACSAIGLTPEAEMLIETADHLHIMGSALFSEGIVSAIHEATIRIKAKGGTVS
FT                   FDPNIRKEMLELPGMRQALAHALENTDLFMPSGPEIFLFTKATEEKAAVEELLARGVKA
FT                   VVVKRGAEGASYFDQSGEVFAPAFKVDEIDPTGAGDSFGAAFVTCWLRDMAPKEALVIA
FT                   NATGARAVGVKGPMEGTSTMAEIEAFLQKNGVPA"
FT   gene            complement(303866..304861)
FT                   /locus_tag="Oant_0290"
FT   CDS_pept        complement(303866..304861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0290"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   sme:SMb21375 putative sugar uptake ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13021"
FT                   /db_xref="GOA:A6WVL7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL7"
FT                   /protein_id="ABS13021.1"
FT                   /translation="MSNAQNIQKKAVDAEVRRSLFSSPLIRQYGGIIISLAVLCVVFAV
FT                   LNPRFLAFNNFMNIMQQVAVIAVAAYGMTYVILLGEIDLSIGSIIAVSGMVAAQAFAMG
FT                   FGFVPTVVFTLAAGAIMGGLNGVLSAKLMLPSFIVTVATMGIYRGMVSLPTNGAPEIIE
FT                   NDTWLAIGSENWLGLPIIIWIVGVLFIFNYILLSKTVFGRRIYLSGGNKEAAIYSGIRV
FT                   DRIKIIVFMLSGVMAAISGILLSSRLSSAQTNAGMGYELDAIAAVVLGGTSLAGGVGTM
FT                   VGTILGALIIGVINNGMNMLSVPYFYQLIVKGVVILVAVWLDVRSKSMRT"
FT   gene            complement(304858..306402)
FT                   /locus_tag="Oant_0291"
FT   CDS_pept        complement(304858..306402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0291"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pde:Pden_4850 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13022"
FT                   /db_xref="GOA:A6WVL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL8"
FT                   /protein_id="ABS13022.1"
FT                   /translation="MTDTETATKSERNALPDTVLEIRDVAKSFGPVIALKRMNLTVRRG
FT                   RVHTLLGENGAGKSTLMKILAGVFKPTSGTILLKGATYTPKDPRDARANGIAIVFQELS
FT                   LSRNLSVAENIFANHEPSRFGFVRERELNAAADKLIDELGLPVDARAKVGDLSIAQRQL
FT                   VEIAKGLSQPADVVILDEPTSSLSDSEAEILFSIIERLKARGTAVIYISHRMEEIMRLS
FT                   DDITVVRDGEYVTTTEKSETTIERLIALMVGREMNDIYPPREAPRPSASVPPILETKNL
FT                   SVAGKFNDVSIDVKPGEVLGLFGLVGSGRSDVMKALFGMLRPTGEIRLDGEVITLSSPT
FT                   DAIRNGIAFVTENRKEEGLVLPHSVERNINMVALGQLAGPFGLMRSKAERSAAKAEVLR
FT                   LAIKTASIDTVAGSLSGGNQQKIVLAKWLQTKPRILILDEPTRGVDVGAKFEIYRIIRE
FT                   LAANGAAILMVSSELPEVLGLSDRVAVMHNKHVAAIVDADGLTPETVMSYAAGMHL"
FT   gene            complement(306577..307479)
FT                   /locus_tag="Oant_0292"
FT   CDS_pept        complement(306577..307479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0292"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: sme:SMb21377 putative
FT                   sugar uptake ABC transporter periplasmic solute-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13023"
FT                   /db_xref="GOA:A6WVL9"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVL9"
FT                   /protein_id="ABS13023.1"
FT                   /translation="MFRKSLSRILFSGVALAMMAGAASAEGIGASLLTQQHPFYIALAD
FT                   AMKKEAQAENVPLEVSIANQDLSKQLADVEDFITKGVDVIIISPVDSKGVRSAINKAEK
FT                   AGIKVITVDVPANNVDVTSFVGTDNFAGGEKAAELMAKTIGEKGNVAVIDYPTVQSVVD
FT                   RIEGFKKGIAKYPDIKIVAIQPGITRPEALSAAQNILQANPDIVGIFGFGDDAALAAAS
FT                   AVKSAKLENQVKVIGFDGMEEARNAVKNDPVMVGVIAQYPDQMGKVAVETAAKVIKGEE
FT                   VPAKQPIVPGVVTKDGETK"
FT   sig_peptide     complement(307402..307479)
FT                   /locus_tag="Oant_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 26"
FT   gene            307856..308887
FT                   /locus_tag="Oant_0293"
FT   CDS_pept        307856..308887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0293"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: pde:Pden_4846 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13024"
FT                   /db_xref="GOA:A6WVM0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM0"
FT                   /protein_id="ABS13024.1"
FT                   /translation="MTEQKIRTMEEFAAASGLSRPTVSKYFDNPESVKPSTRARIEKAL
FT                   KDYNYQPNIFAVSLNRKKPKNIGVIVPHISDPFYAEIIRQIEMRCLAEGYWTIVLSSHG
FT                   ERKLEARAMRTLMSLKIAGVLMAPLGFDTDEKLLSSLSNSTPAVFLDSRISDDQPFVGT
FT                   DNRQSIGNITEYLYRTGEHPCFLEMPAVNQNALERRSAYIETMERLGVEPIVLPIEAKN
FT                   WNFEELGYQEAGRIFDRGGFPTRTVLCANDRLAFGVISAAFERRRHVGREEGCDLRVAG
FT                   HDDHPLSRFTCPPLTTVAQDYRQIAQLGLDMLFSRINAHESGAAVEKEIRRLDSHLIMR
FT                   GSA"
FT   gene            309280..311610
FT                   /locus_tag="Oant_0294"
FT   CDS_pept        309280..311610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0294"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: sme:SMc00110
FT                   probable glucose dehydrogenase (pyrroloquinoline-quinone)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13025"
FT                   /db_xref="GOA:A6WVM1"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM1"
FT                   /protein_id="ABS13025.1"
FT                   /translation="MLEGGNVLLIWLTSIVLFLIGLALGAGGIWLAALGGSWYYILAAI
FT                   GFLLTAVLLSRRSATALWVYALVILGSLGWAVYEVGFDWWQLGARGGIIVLLGFWMLTP
FT                   WIRKPLNNGAGDSGLPLAAASVIAVVVAGYAITQDSYNIAGDLPTEKVAATPDLGGNMP
FT                   DGEWHQYGRTPYGQRYSPLAQITPENVSKLQVAWQYQTGDVKQPQDVGETTYQVTPLKI
FT                   GDSLYLCTPHNWAIALDAATGKEKWKFDPKVGFNTDRQHQTCRGVSYWKDATATAGAKC
FT                   SERVYLPTSDARLIALDTATGEICTDFANGGTLDLSHGMKYNPAGYYYSTSPPAVVGDK
FT                   IIVGGAVNDNYSTEEQSGVIRAFDIRTGQLLWNWDSGNPDVTTPLPEGEHYTTNSPNSW
FT                   SVSSVDEKLGLIFVPLGNKVPDQLGMDRSENVEKFSSSIVALDVNTGQLRWVRQTVHHD
FT                   LWDMDVPAQPVLLEINGVPALVGPTKQGDLYVLDRRTGEPIIPVREIPAPTGAIPEDHT
FT                   APTQPISDLTFSPPPLRESDMWGVTMFDQLACRIKFHELFYEGRYTPPSLRGTIVYPGN
FT                   FGVFNWGSVAVDPVRQVMFGMPTYLAFTSRLVPRADIPPKGQDEKGSEQGLNRNDGAPY
FT                   GVFMGPFLGPLGIPCQTPPWGYVAGVDLRTGKIAYKHRNGTIRDMSPVPLPLKVGVPGI
FT                   GGPMITAGGVAFLGAAVDDYLRAYDLTSGKQLWEARLPAGGQSTPMSYTVGDQQFVLMV
FT                   AGGHGSVGTKPGDYVIAYTLPKG"
FT   sig_peptide     309280..309357
FT                   /locus_tag="Oant_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.533 at
FT                   residue 26"
FT   gene            complement(311668..312117)
FT                   /locus_tag="Oant_0295"
FT   CDS_pept        complement(311668..312117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0295"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: regulatory protein MerR; Transcription regulator MerR
FT                   DNA binding; KEGG: bmb:BruAb1_0216 transcriptional
FT                   regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13026"
FT                   /db_xref="GOA:A6WVM2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM2"
FT                   /protein_id="ABS13026.1"
FT                   /translation="MNIGQAAAASGISAKMIRHYETIGLIEAAERTGSGYRVYTQKDVE
FT                   TLRFIRRSRDLGFQVEQIKELLTLWRDRNRASADVKKVALGHVEELEAKMRQLQEMADT
FT                   LRYLAKNCHGDNRPDCPIIHQLAENSVESRKRPAPRKGELLHGKI"
FT   gene            complement(312190..312936)
FT                   /locus_tag="Oant_0296"
FT   CDS_pept        complement(312190..312936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0296"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bms:BR0222 ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13027"
FT                   /db_xref="GOA:A6WVM3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM3"
FT                   /protein_id="ABS13027.1"
FT                   /translation="MRLFLSLVPRALLLGVLLLFLWRPHLFEPLFRPLVDEGVPVIYDR
FT                   ANFVTLTLQHLGLVALAALASTIVAVSMAIFVTRKQGAEFLPLSRSLVNIGQTFPPVAV
FT                   LALAVPVFGFGDKPTLIALFLYGLLPIFENTLTGLTTLPPPVVEAARGMGMTSAQRLVK
FT                   VEVPLAMPVILAGIRLSVVIGLATATIGSTVAARTLGEVIIAGLISNNLAFVLQGGLVV
FT                   AALAILIFDGFQAIEHYLMKRSGRAI"
FT   gene            complement(312933..313871)
FT                   /locus_tag="Oant_0297"
FT   CDS_pept        complement(312933..313871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0297"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bmb:BruAb1_0218 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13028"
FT                   /db_xref="GOA:A6WVM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM4"
FT                   /protein_id="ABS13028.1"
FT                   /translation="MIEFDHITKRYNGRAAVDAVSFTIEPHSIAAIVGTSGSGKTTLLR
FT                   MVNRLVEPTDGEIRIDGRSIMDEPGHVLRRQIGYVIQQNGLFPHRTVAENIATVPLLLG
FT                   WQKQRIDTRVDELLDLFQLEPADYRDRYPHELSGGQQQRVGVARALAAGPNILLMDEPF
FT                   GALDPVIRAKAQEDLKAIQKRLGTTIILVTHDMEEAISLGDRIAVMDDGKLLQYGPPAE
FT                   ILARPATDFVERLVGTGERPFRLLSLMDLKTALQPGDASGATMPVTASQRDALAELLWS
FT                   GRKALPVLDHDGRPLGQVTLDRLLHQAERPA"
FT   gene            complement(313868..315064)
FT                   /locus_tag="Oant_0298"
FT   CDS_pept        complement(313868..315064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0298"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bmb:BruAb1_0219 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13029"
FT                   /db_xref="GOA:A6WVM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM5"
FT                   /protein_id="ABS13029.1"
FT                   /translation="MSATHQTIQANGTRGLFAYIDKLGLVIAAIALSGLLLPFANFRAN
FT                   RIVQGEPRYLLDALPASLALLFAAVVAAGLLIGFVRSNNLLRLFAALFCLASVMVAIGL
FT                   AASYLSPEGNRYARVSPASGFWLLFFASALYVADGLVRLRAGPFLRVGLLVIAGLLLAA
FT                   LLSSGLWDSISFMKEYQSRADSFWNEAERHIALALGSLAAATAVGIPLGLVCHRLAGLR
FT                   AFVLNSLNIVQTIPSMALFGILIAPLGWVATQFPWAGAIGIRGIGAAPAFVALFLYSLL
FT                   PIVANTVAGLAQVPEPVTDAARGMGMTRLQRLFKTEFPLAFPVILTGIRIVMVQNIGLT
FT                   TIAALIGGGGFGTFVFQGIGQTAMDLVLLGALPTVLLAFAAAVILDAAIEITGKGSSQ"
FT   gene            complement(315093..316022)
FT                   /locus_tag="Oant_0299"
FT   CDS_pept        complement(315093..316022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0299"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bmb:BruAb1_0220 ABC
FT                   transporter, periplasmic substrate-binding protein,
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13030"
FT                   /db_xref="GOA:A6WVM6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM6"
FT                   /protein_id="ABS13030.1"
FT                   /translation="MSYRNLFKGSAIALALFAGAVQFSSLAQAQVVVSSKIDTEGGVLG
FT                   NIILAILNANGIQTTDRIQLGATPVVRKAIIAGEIDIYPEYTGNAAFFFNKADDPLWKD
FT                   PAKAYGTAKQLDYDANKIVWLAPSPANNTWGIAVRKDVADENKLTNLSEFGKYISGGGK
FT                   VILAASSEFVNSAAALPAFQTAYSFTLKPDQLITLSGGDTAATIAAAANQTSGANAAMV
FT                   YGTDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKNPKIEELLKPVFEKLDLTTLQ
FT                   ELNGRVQLGGEPAKAVAEDFLKANGFLK"
FT   sig_peptide     complement(315933..316022)
FT                   /locus_tag="Oant_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.820 at
FT                   residue 30"
FT   gene            complement(316151..317416)
FT                   /locus_tag="Oant_0300"
FT   CDS_pept        complement(316151..317416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0300"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   bms:BR0227 glutamate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13031"
FT                   /db_xref="GOA:A6WVM7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM7"
FT                   /protein_id="ABS13031.1"
FT                   /translation="MTKENLLESALVRLDEAAGHINIDADVIEKLKYARETMKVRLMIR
FT                   MDDGSRKSFLAWRCRYDDTRGPTKGGIRYHPESTAEEVETLAFWMTFKCAVMNLPYGGG
FT                   KGAIQVDPRQLSKAELERLSRAYIQAFSGIIGPDRDIPAPDVYTNSMIMGWMADEYSQI
FT                   VGQSSPAVITGKPLALGGSLGRNDATARGGFYLVRHLSHDLGLAAQLRVTVQGFGNAGQ
FT                   FIAKLMASDGHKIVAVSDSSGAVYCANGLDLDALLEAKAQNKSVVSTAGKNGHEAITPD
FT                   ELLAADCDVLVPSAMENMIHADNAASIKAKLIVELANGPVTPEADEILANNGVIVLPDI
FT                   LANAGGVTVSYFEWVQNRQGYYWTLEEIHERLKTIMEREGRAIWNHAKQHNVTVRSAAY
FT                   VHALQRLAQAIEAHGTQNDFAA"
FT   gene            317745..318998
FT                   /locus_tag="Oant_0301"
FT   CDS_pept        317745..318998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0301"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: bms:BR0229
FT                   sarcosine oxidase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13032"
FT                   /db_xref="GOA:A6WVM8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM8"
FT                   /protein_id="ABS13032.1"
FT                   /translation="MSRFSAASIIKNALSGNKNWKPQWPNAEPKAEYDVIIVGAGGHGL
FT                   GAAYYLAKEHGITNVAVIEKGWLGGGNTGRNTTIIRSNYLYDESAHLYEHAMKLWEGLS
FT                   QDLNYNVMFSQRGVMMLAHTVHDVQSFKRHIHANRLNGIDNEWLTKEQAKEYCPPLDIS
FT                   ANARYPVVGATLQRRGGVARHDAVAWGYARGATERGVDIIQNCPVTAIRRDASGRVTGV
FT                   DTPRGFIKAKKVAVSAAGSTSIVMDTAGVRMPLESFPLQALVSEPVKPIFPCVVMSNTV
FT                   HAYISQSDKGELVIGSGTDQYVSYSQRGGLPLIEHTLAAICEVFPIFTRMRMLRKWGGI
FT                   VDVTPDRSPIIGKTPVPGLFVNCGWGTGGFKATPGSAHVFAHTIARDEPHWINAPFTLE
FT                   RFTTGRLIDEAAAAAVAH"
FT   gene            319018..319323
FT                   /locus_tag="Oant_0302"
FT   CDS_pept        319018..319323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0302"
FT                   /product="sarcosine oxidase, delta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, delta subunit family;
FT                   PFAM: Sarcosine oxidase delta subunit heterotetrameric;
FT                   KEGG: bmb:BruAb1_0225 SoxD, sarcosine oxidase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13033"
FT                   /db_xref="GOA:A6WVM9"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVM9"
FT                   /protein_id="ABS13033.1"
FT                   /translation="MLLIRCPYCEMERPELEFAYAGEAHIARPADPSTLTDDEWRDFLF
FT                   TRSNPRGTHYERWRHINGCGRFFNAVRDTVSDKFVTTYKAGEPRPALAETPAAETK"
FT   gene            319323..322322
FT                   /locus_tag="Oant_0303"
FT   CDS_pept        319323..322322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0303"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: glycine cleavage T protein (aminomethyl transferase);
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Glycine cleavage T-protein barrel; KEGG:
FT                   bms:BR0231 sarcosine oxidase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13034"
FT                   /db_xref="GOA:A6WVN0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039649"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN0"
FT                   /protein_id="ABS13034.1"
FT                   /translation="MTDMRIHNKGRVNKAKSVRFTLNGKTYSGFEGDTLASAMLANGEH
FT                   LAGRSFKYHRPRGILSAGSEEPNALMGVSRGPGRFEPNTRATVLELYDGLKAETQNHWP
FT                   SLKHDVGAINDAFYMFFSAGFYYKTFMWPKSFWNKVYEPFIRGAAGLGKSPSEPDPDTY
FT                   ASRYAFCDVLVAGGGPAGLAAALEAAKSGAKVILVDEQAEFGGSLLSEPEPVINGRASW
FT                   DWLNETIAALKANPNVTLLPRTTAIGYYHQNMVGLCERLTDHQAKPASNAPRERMWRVR
FT                   AKQVVLAQGAIEKPLVFAGNDRPGVMLASSARTYLNRYGVKVGNQAVVVTSHDSAWLAA
FT                   FDLAVAGVKVPAIIDVRSSVADSLVNRAKMLGIETLTGWTVTDTGGRHRVSSVRANPVS
FT                   NGSVGAARTIACDVLLMSGGWNPSVHLFSHTKGSLVWDEARQIYLPGERTEESRCAGAG
FT                   NGNFDLQAALHEGAEAGAAAANDSGHKAKASEYAVAGDFVCDGVSCRELPTDRDPGKAK
FT                   AFIDFQNDVTAKDIRLAVREGFHSIEHVKRYTTNGMATDQGKTSNINGLAVAADALKRP
FT                   TPQVGLTTFRPPYTPTTFGAFCGYNRGKLFDVTRKTPIDSWAEQHGAAFEPVSLWRRAW
FT                   YFPKTGEDMHQAVARECKATRQSLGMFDASTLGKIEVVGPDAAEFMNRMYTNPWTKLGI
FT                   GRCRYGLLLGEDGFIRDDGVVGRLTQDRFHVTTTTGGAARVLNMMEDYLQTEWPELKVS
FT                   LTSTTEQWAVVAINGPNARKLIEPMVEGLDISDEAFPHMSVAECTFLGVPARLFRMSFT
FT                   GELGYEINVPARYGLSLWKALYEAGQQYDITPYGTETMHVLRAEKGYIIVGQDTDGTIT
FT                   PDDASLGWAVGKQKPDFVGKRSLARPDMLKADRKHLVGLLTNDPKLVLEEGAQIVADPK
FT                   QALPMTMLGHVTSSYWSEALGRSIAMAVVSGGKDRMGETLYMPMPDGTVHEAVVSGMVF
FT                   YDPEGKKLNG"
FT   gene            322481..323023
FT                   /locus_tag="Oant_0304"
FT   CDS_pept        322481..323023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0304"
FT                   /product="Sarcosine oxidase gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase gamma subunit; KEGG:
FT                   bmb:BruAb1_0227 SoxG, sarcosine oxidase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13035"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN1"
FT                   /protein_id="ABS13035.1"
FT                   /translation="MLVETKPYSNRKVVIPGRLEIHAADDAARFILRIAPAKLALAEKA
FT                   LGAKIPAKIGGLIRTDDIAVACIGPDEWYIWADEAKGAAITQAFATLYETEPHSLTDVS
FT                   HRETGIDISGPKAEWLLNAASPLELSQMSFPGAARTIFDHAQIILLKWDADHYRIEVWN
FT                   SFADHVWTLLELASNEV"
FT   gene            323174..324331
FT                   /locus_tag="Oant_0305"
FT   CDS_pept        323174..324331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0305"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mlo:mll7158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13036"
FT                   /db_xref="GOA:A6WVN2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN2"
FT                   /protein_id="ABS13036.1"
FT                   /translation="MSESELPLSGLVVVDMSQFLSGPYCSLRLMDLGARVIKIERPDGG
FT                   DLSRRLYLSDTEIGGDSTIFHAINRGKDSLAIDLKNPDDLAALKKLLTQADVLIQNFRP
FT                   GVIKRLGLDYEAAKEINPRLVYASISGYGEEGPWVGRPGQDLLAQARSGLMWLNGDEGQ
FT                   GPVPFGLAVADMLAGAAAAQGILAALVRRGITNKGSHVETSLLEALVDFQFEVLTTHLN
FT                   DGRRLPKRSDFRSAHAYLAAPYGVYPAADGYLAIAMMPIAKLAPLLEADTLAPFADDPK
FT                   SAFAKRDDIKRLIADRIAEKTVDEWLAILEPADIWCARVLNWEELLASEGFSVLDMLQT
FT                   VTREDDVSITTTRSPLRINGQRPKVARAAPRIGENSKEIREEFGL"
FT   gene            324328..325452
FT                   /locus_tag="Oant_0306"
FT   CDS_pept        324328..325452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0306"
FT                   /product="conserved hypothetical membrane-anchored protein"
FT                   /note="KEGG: sme:SMb21090 conserved hypothetical
FT                   membrane-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13037"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN3"
FT                   /protein_id="ABS13037.1"
FT                   /translation="MSTIKLKSMTWSHPRGYDPMVAGAAQWLADKGVEIEWEKRSLQDF
FT                   ETFPVEELARNFDMIVIDHPHVGQITKEGCLLPLDVPSRETELKKLADGSVGQSFPSYN
FT                   WQGRQWAFPLDAATQVQAWRPDLMDKPATSWGEVLRLARAGKVLLPLRSPHSLMCFYTL
FT                   VANAGTPCAVEGELISVEDGVKAFEQLREIASLVKPECFGMDPITVFEEMAEPESEIAC
FT                   SPLIYGYVNYAMRGFRERLIRFADIPAGAAGVAGSALGGTGIAVSAFSKHPEAAIDFAY
FT                   WIASGDVQKGLYAASNGQPGHAEAWEDDTVNAATSDFYRDTRATLEGAWVRPRHDGYMP
FT                   FQEAASERINKGLLDNEKAEVVIADLNRLFRESF"
FT   gene            complement(325496..326344)
FT                   /locus_tag="Oant_0307"
FT   CDS_pept        complement(325496..326344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0307"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bme:BMEI1718
FT                   purine/pyrimidine phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13038"
FT                   /db_xref="GOA:A6WVN4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN4"
FT                   /protein_id="ABS13038.1"
FT                   /translation="MIIDTHLHLIDKSALTYPWLGDVPALNHDFLFETYRKQAERCGIT
FT                   AALHMEVDVAADAIQAETDHVQEISRRSGGFIKGAIASCRPEEPGFAEYLELQLGNPFV
FT                   KGFRRVLHVVPDDVSEGVLFRENIKRLEGTGLTFDLCTLPHQIDKVLALADLAPDVQFV
FT                   LDHCGVPDIKSGALDGWKKGITEVAQRDNVTAKISGVVAYAEQTSWTVDTVRPYVEHVI
FT                   EAFGWERIVWGSDWPVCTLASNVDAGLSTWVATTHALLEGCSEDEKALLLSENATRLWK
FT                   L"
FT   gene            complement(326414..327193)
FT                   /locus_tag="Oant_0308"
FT   CDS_pept        complement(326414..327193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0308"
FT                   /product="regulatory protein IclR"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bms:BR0234 transcriptional regulator,
FT                   IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13039"
FT                   /db_xref="GOA:A6WVN5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN5"
FT                   /protein_id="ABS13039.1"
FT                   /translation="METDDRYRAPALDKGLDILELLASVDGGLTQAEIAKHLDRSPNEF
FT                   YRMLDRLVKRGYVTKLEGDRYSLTLKLFGLAHLHAPVRRLASFATPFMRELADRSKQAN
FT                   QLAVFDRGSVVVIAQQEAPDYWGISIRVGSHISLFDTGSGHVLLAFRSPEERKMMIAEY
FT                   AKDGESVKLDESFYERLDQIRERGYEMMPSAQVAGVYNLSAPILGPDGTCIASLTCPYV
FT                   TLVNSASAPDITQTISLLQKTVKDLSKLVGSDIGTAD"
FT   gene            327364..328680
FT                   /locus_tag="Oant_0309"
FT   CDS_pept        327364..328680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0309"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bmb:BruAb1_0230 sugar ABC transporter, periplasmic
FT                   sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13040"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN6"
FT                   /protein_id="ABS13040.1"
FT                   /translation="MMSFKTSCLAGTALLALAMGSAGAADLPGKFEGVTVNAKLIGGQQ
FT                   YEALYSRIAEWEKATGAKVNILSKKNHFELDKEIKSDIASGSINWCVGSNHSSFAPQYP
FT                   DLYADLNGLLPSGEIEGFVPSVIKASTLNDKLVMLPRAQFDVSALYYQKSLYEDDAKKT
FT                   AFKEKYGYDLAPPKTWKEVSDQAVFFADPPNFYGTQFAGKEEAINGRFYEMLVAEGGEY
FT                   LKDGKPAFNSEAGVRALDWFVNLYKAKAVPAGTTNYLWDELGAGFASGTIAINLDWPGW
FT                   ATYFNDPKSSKVAGNVGIVPPPTGSSGKRTGWSGHHGFSVTESCATKEAAASLVWFLTN
FT                   EDSQKQESAAGTLPTRTAVWDYVIEQAASDPYKKEVLSVFQETAKTAFPVPQTPSWIEI
FT                   SNAVYPELQAAILGDKTSQQALDDAAKKATQILEDAGEL"
FT   sig_peptide     327364..327438
FT                   /locus_tag="Oant_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            328774..329667
FT                   /locus_tag="Oant_0310"
FT   CDS_pept        328774..329667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0310"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bmb:BruAb1_0231 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13041"
FT                   /db_xref="GOA:A6WVN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN7"
FT                   /protein_id="ABS13041.1"
FT                   /translation="MFKRISPPVLLLLPAIIILAAVVLFPLALSLYSSFTPFRLTRPDS
FT                   LFNFIGLRNYQRIMSDWVFWAAFIRTVIFLTIALNLEMLLGLGLALLINKATHGQRVLR
FT                   TLMMFPMMFSPVLVGFQFKFMFNDNIGLVNNALQSLGITSQAIPWLIDGNLALFAILLA
FT                   EVWMSTSVFAILILGGLLSMPQDPVEAARVDGCTPWQTFRYVIWPYLMPFAFIAMTIRS
FT                   LDVARAYDIVKIMTDGGPARRTELIWTLVGRTAYSDAQMGLANAMAYVAILLSILFTVM
FT                   FFRKLAAARAQIGAEW"
FT   sig_peptide     328774..328875
FT                   /locus_tag="Oant_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.352 at
FT                   residue 34"
FT   gene            329670..330548
FT                   /locus_tag="Oant_0311"
FT   CDS_pept        329670..330548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0311"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bms:BR0237 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13042"
FT                   /db_xref="GOA:A6WVN8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN8"
FT                   /protein_id="ABS13042.1"
FT                   /translation="MASTTLSNNQHRLLRRVKKVAYLIGLFLAMAIICLPGLWIVLSSL
FT                   RPPVEIMAKPPVWIPQEITLDAYYAMFSGAGGGGIPVWDYFRNSLIISVTSTIIALIVG
FT                   VSGGYAFARFRFWGKSTTFLGLMLTRSVPGIALSLPLFMLYSRIGIIDTHFGLIVTYVA
FT                   LNVPFTIWLIDGFFRQVPKDLAEAAQIDGCTRWQAFWQVEFPLAGPGIATAGIFAFLTS
FT                   WNEYALASQLTRSVNSKTLPVGLLDYTAEFTIDWRGMCALAVVMIIPALTLTFIVQKHL
FT                   VAGLTFGAVKG"
FT   gene            330555..331646
FT                   /locus_tag="Oant_0312"
FT   CDS_pept        330555..331646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0312"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: bms:BR0238
FT                   sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13043"
FT                   /db_xref="GOA:A6WVN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVN9"
FT                   /protein_id="ABS13043.1"
FT                   /translation="MAQLSIKNLVKRYGNVGVVHGINLEIADKEFVALVGPSGCGKSTT
FT                   LRMIAGLESISDGALEIGGKVVNDLPPRDRNISMVFQSYALYPHMSVRENMGFSLKIAK
FT                   QPQAEIDRRVNEASAILGLEALMERRPAQLSGGQRQRVAMGRAIVRNPEVFLFDEPLSN
FT                   LDAKLRTQMRTEIKKLHAKVQSTVVYVTHDQVEAMTLADRIVIMRDGHIEQVGTPDEVF
FT                   KRPATQFVAGFIGSPPMNMAEATVQGSELVFASGQRLPVPAQFKAKVTDGSKVTFGLRP
FT                   DDLFPKGHGLSSGDAVHEGELRVSITEPLGNETLVFVEFAGKEWVARMLNPRHLNSGEA
FT                   ISMHFDLSQAHLFDAASGKSLAV"
FT   gene            331649..332764
FT                   /locus_tag="Oant_0313"
FT   CDS_pept        331649..332764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0313"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bmb:BruAb1_0234 mandelate racemase/muconate
FT                   lactonizing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13044"
FT                   /db_xref="GOA:A6WVP0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP0"
FT                   /protein_id="ABS13044.1"
FT                   /translation="MARIEKVELRMVDLPPKVKRTDAIQSFVSQETPIVTITDSDGAVG
FT                   TGYSYTIGTGGSSVMRLLSDHLVPLILNEDADCIEAIWRKLEFATHATTIGPITALALA
FT                   AIDTALWDLRAKKQNLPLWKLAGGAKESCPLYTTEGGWLHIEKEALVEDALQAKAKGFS
FT                   GSKVKIGKPHGSEDYARLSAVRAAVGDGFEIMTDCNQGFTVDESIRRAERLKELDLAWI
FT                   EEPLPADDLDGHIRLTRSTPTPIAVGESIYSIRHFREYMQKGACSIVQVDVARIGGITP
FT                   WLKVAHAAEAFDIPVCPHFLMELHVSLTCAVQNGRYVEYIPQLDDLTTKGMEIRDGHAI
FT                   APSEPGIGISWDWDAVRARSVSEFTREIVRS"
FT   gene            332764..333096
FT                   /locus_tag="Oant_0314"
FT   CDS_pept        332764..333096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0314"
FT                   /product="protein of unknown function DUF718"
FT                   /note="PFAM: protein of unknown function DUF718; KEGG:
FT                   bmb:BruAb1_0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13045"
FT                   /db_xref="GOA:A6WVP1"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP1"
FT                   /protein_id="ABS13045.1"
FT                   /translation="MVQRMGMVIGLKPEKIAEYKKLHASVWPEILALISQCNITNYTIF
FT                   LKEPENLLFGTWDYVGADFEADMKKMADNPKNQEWWSVCMPCQKPLETRKEGEWWAMME
FT                   EVFHHD"
FT   gene            333089..334168
FT                   /locus_tag="Oant_0315"
FT   CDS_pept        333089..334168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0315"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   bms:BR0241 oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13046"
FT                   /db_xref="GOA:A6WVP2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP2"
FT                   /protein_id="ABS13046.1"
FT                   /translation="MTEAFDPKTLRQWWAKPTQPKPIVIFGAGSIVCDAHLPAYQKGGF
FT                   AVAGIFDPNLDKASALADQWGVKVFGSLEEALAVEGAIFDLATPPSAHASILAQLPEGA
FT                   AVLIQKPMGSDLAAATEILKVCRARNLKAAVNFQLRFAPMMLALYDAVDKGLLGEVVDF
FT                   DAWLALATPWGLWPFLKGLPRIEIAMHSIHYLDFVRGLLGNPQGVHAKTIGHPNHEVAQ
FT                   TRTAAILDYGNRVRCALSINHDHDFGRKFQACEFRICGTEGAAYVKLGVNLDYPRGEPD
FT                   ELWIKPKGADDWVQVVLQGAWFPDAFLNRMAQLQRFATGEDAELIGSVEDAWHTMALVE
FT                   AAYQSSAAPATPLAAKLEV"
FT   gene            334171..334617
FT                   /locus_tag="Oant_0316"
FT   CDS_pept        334171..334617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0316"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   sme:SMb21110 putative MaoC-like (monoamine oxidase-like)
FT                   protein, similar to NodN"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13047"
FT                   /db_xref="GOA:A6WVP3"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP3"
FT                   /protein_id="ABS13047.1"
FT                   /translation="MAEQKIYYEDYEMNHVRLTTGRTITETDFVVHAGHTGDFFPHHMD
FT                   AEFAKTLPGGQRIAHGTMIFAIGVGLTATLINPVAFSYGYDRLRFIRPVHIGDTIRTRV
FT                   TISAKEDDPKRANMGRVTERCEVLNQRDEVVLACDHILLVERKA"
FT   gene            334620..335354
FT                   /locus_tag="Oant_0317"
FT   CDS_pept        334620..335354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0317"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mes:Meso_3546 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13048"
FT                   /db_xref="GOA:A6WVP4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP4"
FT                   /protein_id="ABS13048.1"
FT                   /translation="MTIRFDGKTALVTAAAQGIGRASALAFAEAGAKVYATDINEAALK
FT                   EIEGVSGIITRKLNVLDEAEVKAAVAEIGQVDILFNCAGVVHGGSILEMKDEDLDFAVN
FT                   LNVKAMIRTIRAVLPGMLERKDGSIVNMASVASSVKGVPNRFAYGVTKAAVIGLTKAVA
FT                   ADYVAKGIRCNAICPGTVESPSLQDRLRAQGDYEEQRAAFIARQPIGRIGQPEEIADLA
FT                   VYLAGATYTTGQAYNIDGGWTI"
FT   sig_peptide     334620..334706
FT                   /locus_tag="Oant_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.606 at
FT                   residue 29"
FT   gene            335541..336386
FT                   /locus_tag="Oant_0318"
FT   CDS_pept        335541..336386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0318"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   mes:Meso_3545 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13049"
FT                   /db_xref="GOA:A6WVP5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP5"
FT                   /protein_id="ABS13049.1"
FT                   /translation="MKFLRYGETGQEKPGLLDADGNIRDLSAHVGDLSGAALTPDALAK
FT                   LGAIDINSLPKVEGNPRLGPCVAGTGKFICIGLNYADHAAESGMAVPPEPVIFMKATSA
FT                   IVGPNDDLLIPRGSEKTDWEVELGIVIGKTAKYVSEDDALDYVAGYCTLHDVSERAFQI
FT                   ERAGQWTKGKSCDTFGPTGPWLVTKDEVADPQNLGMWLKVNGETMQDGSTKTMVYGVRH
FT                   LVSYLSQFMSLQPGDIISTGTPPGVGMGMKPPRYLKAGDVVELGIEGLGTQKQNVRADV
FT                   "
FT   gene            336420..337697
FT                   /locus_tag="Oant_0319"
FT   CDS_pept        336420..337697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0319"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bms:BR0245 mandelate racemase/muconate
FT                   lactonizing enzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13050"
FT                   /db_xref="GOA:A6WVP6"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP6"
FT                   /protein_id="ABS13050.1"
FT                   /translation="MTKITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDDEA
FT                   LKGHGLTFTIGRGNDICCQAILAMRHLVVGASMDDFLAAPGKFWRYLTGDSQLRWIGPD
FT                   KGVMHLATGAVVNAFWDLAAKQAGKPVWRLVADMSPEEIADIVDYRYLTDALTRDEAVE
FT                   ILRKAEAGKAERIAKLEAKGYPCYTTSAGWLGYDDDKLRRLCQEAIDEGFNHVKMKVGR
FT                   DLEDDIRRLTIAREVIGPDRYLMIDANQVWEVDQAIEWVNKLAFSKPFFIEEPTSPDDV
FT                   AGHRKIREAIGDVKVATGEMCQNRIMFKQFIAEGAIDIVQIDSCRMGGLNEVLAVLLIA
FT                   AKFGKPVWPHAGGVGLCEYVQHLSMIDYVAVSGTKEGRVIEYVDHLHEHFIEPCIIKDA
FT                   AYMPPSLPGFSIEMKPQSIAEYTFKG"
FT   gene            complement(337757..338197)
FT                   /locus_tag="Oant_0320"
FT   CDS_pept        complement(337757..338197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0320"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   mlo:mll0725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13051"
FT                   /db_xref="GOA:A6WVP7"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP7"
FT                   /protein_id="ABS13051.1"
FT                   /translation="MLWTLFGILSGACIAIQAPINAALARGLGSPVTAAAISFLSGAVI
FT                   LAVIAGITARATGAMPAFNVPAGWLFVAGGALGCIYVTASVLLTPRIGAAAVMGLAVAG
FT                   QLMAGLAADRIGFMGVAVREITAGRIVGAVLLLSGALMIRFL"
FT   sig_peptide     complement(338129..338197)
FT                   /locus_tag="Oant_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.734 at
FT                   residue 23"
FT   gene            complement(338356..338431)
FT                   /locus_tag="Oant_R0004"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(338356..338431)
FT                   /locus_tag="Oant_R0004"
FT                   /product="tRNA-Phe"
FT   gene            complement(338603..338818)
FT                   /locus_tag="Oant_0321"
FT   CDS_pept        complement(338603..338818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0321"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   bme:BMEI1673 zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13052"
FT                   /db_xref="GOA:A6WVP8"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP8"
FT                   /protein_id="ABS13052.1"
FT                   /translation="MSDKKDISTAAGARVTPLRPTRPCPECGKPSSRESYPFCSPRCKS
FT                   IDLNRWLSGSYVLPGKPIDEEEEGGN"
FT   gene            complement(338827..339453)
FT                   /locus_tag="Oant_0322"
FT   CDS_pept        complement(338827..339453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0322"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: bmb:BruAb1_0276 Maf-1, maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13053"
FT                   /db_xref="GOA:A6WVP9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVP9"
FT                   /protein_id="ABS13053.1"
FT                   /translation="MSAQHKLVLASGSPRRIELLGQTGIEPDHIHPADIDETPQRAEHP
FT                   RSLARRLSREKARKAQEQLKDDANFAGAFILAADTVVAVGRRILPKTEIADEARECLRL
FT                   LSGRTHKVFTGVSLVLPNGNLRQTLVETRLRFERLSRQQMDAYLSSGEWRGKAGGYAIQ
FT                   GLAGSFVVKLVGSYTNVVGLPLQETISLLNDVDYPVYANWNSGKV"
FT   gene            complement(339488..339706)
FT                   /locus_tag="Oant_0323"
FT   CDS_pept        complement(339488..339706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0323"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   bmb:BruAb1_0277 InfA, translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13054"
FT                   /db_xref="GOA:A6WVQ0"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVQ0"
FT                   /protein_id="ABS13054.1"
FT                   /translation="MAKEEVLEFPGVVTELLPNAMFRVKLENEHEIIAHTAGRMRKNRI
FT                   RVLAGDKVLVEMTPYDLTKGRITYRFK"
FT   gene            complement(339821..340306)
FT                   /locus_tag="Oant_0324"
FT   CDS_pept        complement(339821..340306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0324"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bmb:BruAb1_0278 protein phosphatase,
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13055"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVQ1"
FT                   /protein_id="ABS13055.1"
FT                   /translation="MIITDAPPVNFSADGDDDHKSSLPKSLLFVCGKNAIRSPMAELLA
FT                   RQALPPNIYLASAGVKRGERDPFVDAVLQEEGLSLDNRQPRGLEELADGYFDLIVTLTP
FT                   LAHHTVLERMRGFSVDVEYWPTPDPTLVTGSRSQIMAAYRDVRDRLKRQIMQRFNEH"
FT   gene            complement(340313..340795)
FT                   /locus_tag="Oant_0325"
FT   CDS_pept        complement(340313..340795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0325"
FT                   /product="uncharacterised conserved protein UCP032146"
FT                   /note="PFAM: uncharacterised conserved protein UCP032146;
FT                   KEGG: bmb:BruAb1_0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13056"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVQ2"
FT                   /protein_id="ABS13056.1"
FT                   /translation="MTAAVPNARLVDVELDESIGRSTPDVEHERAVAIFDLIEENSFHP
FT                   IGDDTGGPYRLKLSLMESRLIFAITREAGEDVATHILSLTPLRRVVRDYFMICESYYQA
FT                   IRSATPSKIEAIDMGRRGLHNEGSQTLQNRLQGKIEVDFNTARRLFTLVCVLHWRG"
FT   gene            complement(340802..342094)
FT                   /locus_tag="Oant_0326"
FT   CDS_pept        complement(340802..342094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0326"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: bms:BR0252
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13057"
FT                   /db_xref="GOA:A6WVQ3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVQ3"
FT                   /protein_id="ABS13057.1"
FT                   /translation="MVKTLRQTDPDFENNFATFLASKREASEDVDRAAREIVERVRREG
FT                   DSALIDYSRRFDRIDLEKTGIAVTEAEIDAAFDIAPASTIEALKLAHERIEKHHARQLP
FT                   KDDRYTDALGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVERIVMVVPA
FT                   PDGILNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETISPVAKIVGPGNAYVAAAKR
FT                   IVFGTVGIDMIAGPSEVLVIADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEALALAV
FT                   EEAVERQLRNLPRAQTAAASWRDFGAVILVEDFEAAIPLANRIAAEHLEIATADPEALL
FT                   PKIRNAGSIFIGGYTPEVIGDYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGPD
FT                   QLRVLGPAAIEIARAEGLDAHAQSVAIRLNL"
FT   gene            complement(342272..342712)
FT                   /locus_tag="Oant_0327"
FT   CDS_pept        complement(342272..342712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13058"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVQ4"
FT                   /protein_id="ABS13058.1"
FT                   /translation="MEMLKLVALDEEDLQVLSAHLQDAVLKVSDLQYLGNEKRFVLTAN
FT                   RFVWEESKPKFLRKPQYQRRRTALHFNRVIAAKAVGIDRQKPDEVLSLMAIQFTAGETP
FT                   AGTIELTFSANAAIRLEVECIEAQMTDLGAAWETESLPRHNV"
FT   gene            complement(342913..344202)
FT                   /locus_tag="Oant_0328"
FT   CDS_pept        complement(342913..344202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0328"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   bmb:BruAb1_0282 MurA, UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13059"
FT                   /db_xref="GOA:A6WVQ5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVQ5"
FT                   /protein_id="ABS13059.1"
FT                   /translation="MDRIKIVGGNKLNGIIPISGAKNAALPLMIASLLTDDTLTLENVP
FT                   HLADVEQLIRILSNHGVDYSVNGRREHQDGAYSRTIHFTARNIVTTTAPYELVSKMRAS
FT                   FWVIAPLLARMGEANVSLPGGCAIGTRPVDLLLEALLALGADIEIENGYAKAKARNGLV
FT                   GARYKFPKVSVGATHVMLMAAALAKGETVIENAAREPEVVNLADCLNAMGAKITGAGTS
FT                   TIHIDGVTNLSGARVRVIPDRIEAGTYAMAVAMTGGDVLLEGAQESQLSAALETLRQAG
FT                   AEITETNSGLRVVRNGHGIHPVDVTTDPFPGFPTDLQAQFMGLMTKAKGTSRITETIFE
FT                   NRFMHVQELARLGAKISLSGQTATVEGVERLKGAQVMATDLRASVSLVIAGLAAEGETM
FT                   VNRVYHLDRGFERLEEKLSRCGATVERISG"
FT   gene            complement(344419..344598)
FT                   /locus_tag="Oant_0329"
FT   CDS_pept        complement(344419..344598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13060"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVQ6"
FT                   /protein_id="ABS13060.1"
FT                   /translation="MSENTTNKEKQTQSDQRKKRRAEELRANLMRRKAQSRSRRAGEAD
FT                   ERNDGITAASDDTD"
FT   gene            344746..344820
FT                   /locus_tag="Oant_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            344746..344820
FT                   /locus_tag="Oant_R0005"
FT                   /product="tRNA-Thr"
FT   gene            345218..346030
FT                   /locus_tag="Oant_0330"
FT   CDS_pept        345218..346030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0330"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="KEGG: mlo:mll1046 cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13061"
FT                   /db_xref="GOA:A6WVQ7"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVQ7"
FT                   /protein_id="ABS13061.1"
FT                   /translation="MAQFHVVAGRDQSAFYPEVKRIRMADVFDALRLGFNDFWAKPSHY
FT                   VFLCLIYPLAGLLITYWSTNANALPLLFPLMSGFALIGPIAALPLYEMSRRREEGLDTS
FT                   WKRALDVSHSPALPSIVAVGAFLFAIFIVWLLVAQNLYVHYFGPMPPESFSMLMNQVLS
FT                   TEEGRSLIFAGCGIGLLFAIVVLCSTIVTFPMLLDQDCGAAAAVATSLRVVIRNPMESL
FT                   LWAAIVTAMLIVGFATMFAGLAVVIPILGHATWHLYRKTVTHPAAMRI"
FT   gene            346204..347055
FT                   /locus_tag="Oant_0331"
FT   CDS_pept        346204..347055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0331"
FT                   /product="Urease accessory protein UreD"
FT                   /note="PFAM: Urease accessory protein UreD; KEGG:
FT                   bms:BR0267 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13062"
FT                   /db_xref="GOA:A6WVQ8"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVQ8"
FT                   /protein_id="ABS13062.1"
FT                   /translation="MIINNNKLAELSSQRVNGLGGLSIHFKDGRSRISRLYQEGAAKIR
FT                   MPQVGGDPLEAILINTSGGLTGGDRLQWDVELGENASAVITTQACERIYRSGGGEARIA
FT                   TRLKAAKGTRLAWLPQETILFNQSVLSRTLDVELEEGAEILVVEATIFGRLAMGERVDE
FT                   AMFSDRWRVRLGGRPDGRLVHAEEFRLGPDIGAELQARPVADAACAVATVLLISGEAGK
FT                   HLEAARQIIGEEGGASLWQVGPATKLMMRLHAPDSYTLRKRLGPLLALLNGKAGLPKVW
FT                   TF"
FT   gene            347132..347434
FT                   /locus_tag="Oant_0332"
FT   CDS_pept        347132..347434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0332"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="TIGRFAM: urease, gamma subunit; PFAM: Urease gamma
FT                   subunit region; KEGG: bmb:BruAb1_0294 UreA-1, urease, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13063"
FT                   /db_xref="GOA:A6WVQ9"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVQ9"
FT                   /protein_id="ABS13063.1"
FT                   /translation="MNLTPREKDKLLIAMAAMVARRRLERGVKLNHPETIALISDFVVE
FT                   GARDGRTVADLMEAGAHVITREQVMDGVPEMIHDIQVEATFPDGTKLVTVHEPIR"
FT   gene            347481..348068
FT                   /locus_tag="Oant_0333"
FT   CDS_pept        347481..348068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0333"
FT                   /product="HupE/UreJ protein"
FT                   /note="PFAM: HupE/UreJ protein; KEGG: mes:Meso_2682
FT                   HupE/UreJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13064"
FT                   /db_xref="GOA:A6WVR0"
FT                   /db_xref="InterPro:IPR007038"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVR0"
FT                   /protein_id="ABS13064.1"
FT                   /translation="MKKTTVLAAVAMALTASPAFAHLNPAEHGSFAAGFTHPLSGADHI
FT                   LAMVAVGLWAAMLGGRALFVVPAAFVGVMLLGFVAALLGMPLPFVEPVILASVVVLGLM
FT                   VALAFPVTPVVGALIAGFFAFFHGHAHGGEIGGATFLSYAAGFALATALLHAAGMGVGL
FT                   AAGRLMAGKNGKIALRLAGGATALGGLTLMAG"
FT   sig_peptide     347481..347546
FT                   /locus_tag="Oant_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            348077..348382
FT                   /locus_tag="Oant_0334"
FT   CDS_pept        348077..348382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0334"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="TIGRFAM: urease, beta subunit; PFAM: Urease beta
FT                   subunit; KEGG: bmb:BruAb1_0295 UreB-1, urease, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13065"
FT                   /db_xref="GOA:A6WVR1"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVR1"
FT                   /protein_id="ABS13065.1"
FT                   /translation="MIPGEIITQDGDIELNQGQSTITIKVANTGDRPIQVGSHFHFYEV
FT                   NAALSFERDKALGQRLDIAAGTAVRFEPGQERDVTLVPVSGKREIYGFRQMVMGKL"
FT   gene            348404..350116
FT                   /locus_tag="Oant_0335"
FT   CDS_pept        348404..350116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0335"
FT                   /product="urease, alpha subunit"
FT                   /note="TIGRFAM: urease, alpha subunit; PFAM:
FT                   amidohydrolase; Urease alpha-subunit domain protein; KEGG:
FT                   bms:BR0270 urease, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13066"
FT                   /db_xref="GOA:A6WVR2"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVR2"
FT                   /protein_id="ABS13066.1"
FT                   /translation="MPARISRATYAQMFGPTVGDKVRLADTELFIEVERDLTTYGEEVK
FT                   FGGGKVIRDGMGQSQMSRADGAMDTVITNALILDHTGIYKADVGLRDGRIAVIGKAGNP
FT                   DTQPGVSIIIGPGTEIIAGEGKILTAGGIDTHIHFISPQQVDEALNAGITCMVGGGTGP
FT                   AHGTLATTCTPGPWHIARLIQSFDGLPMNIGVFGKGNASLPGALEEMIRAGACGLKLHE
FT                   DWGSTPAAIDNCLSVADRFDIQVAIHTDTLNEGGFVEDTLNAFKGRTIHSFHTEGAGGG
FT                   HAPDIIRVCQYPNVLPASTNPTRPYTVNTIAEHLDMLMVCHHLSPAIPEDIAFAESRIR
FT                   KETIAAEDILHDMGAFSIISSDSQAMGRVGEMIIRCWQTADKMKKQRGSLPDDKPGNDN
FT                   YRARRYIAKYTINPAIAHGMAHEIGSVEVGKRADLVLWNPAFFGIKPEMVLLGGWIATA
FT                   PMGDPNGSIPTPQPMHYRPMFGSFGKARTNTSITFVSQAAMDEGLREKIGVDKQMIAVA
FT                   NTRDGIGKHSMILNNAMPQMEVDPETYEVRADGELLTCEPVDVVPMAQRYFMF"
FT   gene            350134..350646
FT                   /locus_tag="Oant_0336"
FT   CDS_pept        350134..350646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0336"
FT                   /product="UreE urease accessory domain protein"
FT                   /note="PFAM: UreE urease accessory domain protein; KEGG:
FT                   bmb:BruAb1_0297 urease accessory protein UreE,
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13067"
FT                   /db_xref="GOA:A6WVR3"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVR3"
FT                   /protein_id="ABS13067.1"
FT                   /translation="MFRATAIIRADKVIDAVPAGHAVLERDERHLRRKAIVLEGGEKVL
FT                   VDFAEPIVLEHGDRLVLDDGREIEIRAASEELYEIRGRDPLHIAELTWHIGNRHLAAQI
FT                   ESDRIFILRDHVIKAMLEGLGATVTDVTAIFSPLRGAYSGGHSHDDHDHHHGHHEHDHE
FT                   HHHHHHD"
FT   gene            350618..351304
FT                   /locus_tag="Oant_0337"
FT   CDS_pept        350618..351304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0337"
FT                   /product="urease accessory protein UreF, putative"
FT                   /note="KEGG: bms:BR0272 urease accessory protein UreF,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13068"
FT                   /db_xref="GOA:A6WVR4"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVR4"
FT                   /protein_id="ABS13068.1"
FT                   /translation="MNIITTTTTDTTTALLRLMAWLSPVFPVGSFSYSHGLERAVHDGY
FT                   VADTATMSDWLRWLVTRGSGWNDAVLCAESWRRAVAKGDLVEVAELAEALAGSRERHME
FT                   TMLQGEAFLAAARSWPSSVFDRLPADCPYPVAVGAVAGANKVSLGLTLAAFLQAFCINL
FT                   LQASIRLSVMGQNGVTATMSDLEPVLAETATRIEKTSLSDLGSATYISDIMAMKHETQH
FT                   SRLFRT"
FT   gene            351301..351921
FT                   /locus_tag="Oant_0338"
FT   CDS_pept        351301..351921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0338"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: bmb:BruAb1_0299
FT                   UreG-1, urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13069"
FT                   /db_xref="GOA:A6WVR5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVR5"
FT                   /protein_id="ABS13069.1"
FT                   /translation="MTQKNGPLRIGIGGPVGSGKTTLTEKLCKALRDKYSVAVITNDIY
FT                   TQEDALILARSQALSEDRIMGVETGGCPHTAIREDASINLQAIAEMNRRFPDLEIVFIE
FT                   SGGDNLAATFSPDLADLTLYVISVCQGEEIPRKGGPGITRSDFLVINKSDLAPHVHVDL
FT                   DIMQGDAARMRGKRPFGFTDLHRGKGVPEIIDFIVENGGLEAR"
FT   gene            complement(351922..353376)
FT                   /locus_tag="Oant_0339"
FT   CDS_pept        complement(351922..353376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0339"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein; KEGG: hne:HNE_1798 deoxyribodipyrimidine
FT                   photolyase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13070"
FT                   /db_xref="GOA:A6WVR6"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVR6"
FT                   /protein_id="ABS13070.1"
FT                   /translation="MWLDISASHFCSGIFLMKHHALVWLRNDLRINDNPALDAAAETGG
FT                   HITAVYVHETVAEIRAPGCAVRWWLDQSLEAIRKQLADRGIELLIETGDPRDILPQLIA
FT                   KLAVTELFWNRRYAPAEREFDANLKAQLKESGTGVTSFPGNLLLEPWELKTASDTPYQV
FT                   FTPFAKALRHHHIPRPLSRRQWDIKPTQETCYSPNVPAWAKKFDGLWNIGEDAARDCLT
FT                   RFLENTLSTYTEDRDVPGIDGTSRLSPHLRFGEISARQAWYATLAFMDEHHSARAGGEK
FT                   FLSELIWRDFNYHQLYHRRDISRHDMRDTLSGIAWRDDRAAFEAWRRGQTGFPIIDAGM
FT                   RQLWATGWMHNRVRMLVASFLTKNLLIDWRKGEEWFWDTLVDGDIASNPGSWQWVAGCG
FT                   MDAAPYFRVFNPILQGEKFDAEGQYVRHWVPELSGLSNKWLHKPFEAPKDVLTSAGIAL
FT                   GSTYPKPIIDLQASQREARKRLNSQP"
FT   gene            complement(353496..353572)
FT                   /locus_tag="Oant_R0006"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(353496..353572)
FT                   /locus_tag="Oant_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(353732..355285)
FT                   /locus_tag="Oant_0340"
FT   CDS_pept        complement(353732..355285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0340"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bms:BR0274 sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13071"
FT                   /db_xref="GOA:A6WVR7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVR7"
FT                   /protein_id="ABS13071.1"
FT                   /translation="MAVVEKTTDTGTPSPEAASQTATTERLSSTQFTRLPWRNRLSSKL
FT                   LLLTALAVLITEVLIFVPSVANMRVRWMSSRLDTVGAVSEVLAAGGDMDVPRDIQDKVL
FT                   LATGTKAIAMREAGASRLLAMSEVPGKIDQVIDLNNISEAAAIWDAFGTLFNGGDRTLR
FT                   IYGSVSPSSSPGRIIEIVTSDAPLRHAMLVYARNVTFISLIISVIAASLIYLIIHEMLL
FT                   RPVRIMHRNMIDFASSPDNPALILVPENRKDEFGVAQRQISHIQSDLQRTLKEQKHLAD
FT                   LGLAVSKINHDMRNILASAQLMSDRLADTEDPMVQRFAPKLIRTLSRAISYSESVMAYG
FT                   RSQEAPPRPRRVLLHTIIADVQETLSPRSESSVEFENLVPEDFELNVDSEQLFRVLSNL
FT                   CRNSVQAMERDQSIDDATVKRLTISAGRIGTMAIIGVEDTGPGLPQKARDNLFTAFKGS
FT                   TRSDGTGLGLAIAQELIRAHGGTIELREDRPVGAHFEIRIPDLPMQRGDRSLQRAEESV
FT                   "
FT   gene            355666..356793
FT                   /locus_tag="Oant_0341"
FT   CDS_pept        355666..356793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0341"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bms:BR0276 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13072"
FT                   /db_xref="GOA:A6WVR8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVR8"
FT                   /protein_id="ABS13072.1"
FT                   /translation="MKSWKQIALCLLIAAAAVGGWYAYKNKNDVVKTAATGEEAPKGEG
FT                   GRSAPLVVVEAAGEETINNRLTAIGSARALSTVSITPYSSGYMTKLYVKAGDSVKEGDS
FT                   IAELDAETEKIAVAKAETALKDAQTTRQRIAKLRATNTATEVQVVETELAVANAQLALQ
FT                   DAQLALSRRTVRAPISGIVGILPVNVGNYITAQTSIGRIDDRSKVLIDIWVPERFAPQI
FT                   KVGQPLTAESTAFPGETYSGEINAVDNMLDEASRTLHVRAEVPNTQDRLRAGMSFSVTV
FT                   LFPGDRYPSVDPLAIQWGADGSYVWRVEDGVAKRIVARIVQRNSTNILIDGPVKQGDMI
FT                   VTQGVQTVRDDAPVRVKDEQGTALADPVSITRTAG"
FT   sig_peptide     355666..355725
FT                   /locus_tag="Oant_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.505 at
FT                   residue 20"
FT   gene            356804..359956
FT                   /locus_tag="Oant_0342"
FT   CDS_pept        356804..359956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0342"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bms:BR0277 AcrB/AcrD/AcrF multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13073"
FT                   /db_xref="GOA:A6WVR9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVR9"
FT                   /protein_id="ABS13073.1"
FT                   /translation="MTGHNSSSSSGGSTALFIRRPVFAFVINVLIVVAGLAAFTGVDIR
FT                   ELPDVDRPVVTISTDFSGASAETIDRQLTQVLENAVARVSGVKSISSTSSFERSRVTVE
FT                   FNDGVDLNVAAADMRDAISRVANDVPEEADPSRIIKADSNADPVMRLAVTSDTMSVDDM
FT                   TVLVEDQIQDILSAVPGVADVQINGDRDKIFRIDINQARLASYGLTIADISTALSSMGL
FT                   DAPAGSLRSADQSIVVRATANLEKPEDFENVYINGRTQIRDVATVTLGPDIESSAVRSN
FT                   GKTAIGLGIVRQAQSNTLDISEGIRAAVANLQKTLPAGVNIAVTSDDANFINGAIHEVE
FT                   IALIASVIIVVAIIFVFLWDIRATLIPALSMPVALIGTIAAIYLAGFSVNILTLLALVL
FT                   ATGLVVDDAIVVLENVVRRRNQGMGPRAAAVLGTQEVFFAVIATTLTLAAVFVPISFLP
FT                   GQAGGLFREFGFVLAIAVLLSSVVALTLCPMLASRFLKEGNGEDGGHGPLFLRRIGGGL
FT                   ATFYKKTLHICLSAPFVVVLVAMLFAGASFVGYGLIRQELTPSEDRAVALLRINGPQGI
FT                   SVEFLQSQLDKIEEAVQPLRDSGEIITTYAIAGSGGSSNNGFVVLTLAPWKERARSQQE
FT                   IMADITQRIKGITAVRIFTTQPNSLGIRGAGNGLQFAIVGSDYAKLQPAAQAVVAALEK
FT                   DPRFVQPRLSVEPTQPQLSVEINRERASDLGIDITGLANAVQSVLDGRKIGSVYVGDRS
FT                   FDVKLVATTNPINDPTDLENIFMKTTDGRYVPMSSIATVVEKAVPPQLDRETRQRSVSI
FT                   TTNLRDDFALGDAYKVAQEIAAPLLPPGSHIIPLAEASTLSETSSGLAMVFGFAIIIIL
FT                   LVLAAQFESFVSALIVMATVPLGLGCAVFAMLLTGTSLNVYSQIGLVLLVGIMAKNGIL
FT                   IVEFADQLRDRGLSVREAIEEASNIRLRPVCMTMICAVLGGVPLVLASGAGAEARVALG
FT                   WVIVGGLGLATIATLYVTPVAYLLLGRFTQPKAEEEARLERELNYALKGKSQKGGTAEP
FT                   AE"
FT   sig_peptide     356804..356878
FT                   /locus_tag="Oant_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.839 at
FT                   residue 25"
FT   gene            complement(360009..361007)
FT                   /locus_tag="Oant_0343"
FT   CDS_pept        complement(360009..361007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0343"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   sme:SMc01827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13074"
FT                   /db_xref="GOA:A6WVS0"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS0"
FT                   /protein_id="ABS13074.1"
FT                   /translation="MKKAISLCLGTAGLALALMSSSAMAADKLTLQLKWVTQGQFAGYY
FT                   VAKDKGFYEEENLDVDIKPGGPDVAPPQVIAGGGADVVVDWMPSALATREKGVPLVNIA
FT                   QPFKKSGMMLTCRKDTNITKPEDFKGRTLGVWFGGNEYPFLSWMSHLKIPTEGGKDGVT
FT                   VLKQGFNVDPLIQKQADCISTMTYNEYWQVIDAGIPADQLVVFPYEEQGVATLEDGLYV
FT                   LEKSLDDPAMVDKLARFVRASMKGWKYASENPGEAADIILDNDASGAQTKEVQERMVKE
FT                   IGKLVDGSDGTLDVAAADRTVETLLGGGSDPVITKKPEGAWTAKITDAMKK"
FT   sig_peptide     complement(360930..361007)
FT                   /locus_tag="Oant_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(361121..361981)
FT                   /locus_tag="Oant_0344"
FT   CDS_pept        complement(361121..361981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0344"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_2046
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13075"
FT                   /db_xref="GOA:A6WVS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS1"
FT                   /protein_id="ABS13075.1"
FT                   /translation="MMTGILSVIALIAVSWLVVGWVASLKTRNPLGQKLLDIAVPALFG
FT                   IAMLLLWEVTVRLFAIPQVLLPAPSAIWARITASVPILWADFRQTFLKAVIIGYVAGCG
FT                   LGFITAIIADRIPFLRKGLLPLGNLAAALPIVGVAPIMVMWFGFDWQSKAAVVIIMTFF
FT                   PMLVNTVAGLASTGAMERDMMETYGSSYWQTLFKLRLPAAMPFIFNALKINSTLALIGA
FT                   IVAEFFGTPIVGMGFRISAEIGRMNVDMVWAEIFVAALAGSLSYGLIALIERRMTFWHP
FT                   SYRRA"
FT   sig_peptide     complement(361919..361981)
FT                   /locus_tag="Oant_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.479 at
FT                   residue 21"
FT   gene            complement(361978..362871)
FT                   /locus_tag="Oant_0345"
FT   CDS_pept        complement(361978..362871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0345"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SMc01825 putative
FT                   permease ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13076"
FT                   /db_xref="GOA:A6WVS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS2"
FT                   /protein_id="ABS13076.1"
FT                   /translation="MKGFLHDRFIPVATILAVIIALWYGLAVVLNAPFERDQATRAGTE
FT                   ITFSTLVANTMHQDRPVLPAPHQVAEEIWKTVFGVKPSSKRSLIYHGWVTLSSTLLGFV
FT                   LGSALGVLLAVGIVHSRTLDKSLMPWIITSQTIPILAIAPMIIVVLNAIGISGLLPKAI
FT                   ISTYLSFFPVAVGMVKGLRSPDVMHLDLMRTYNASRSQVFWKLRWPAAMPFLFTSMQIA
FT                   VAISLVGAIVGELPTGAVAGLGARLLAGSYYGQTVQIWAALVAAALMAAVLVALIGVAA
FT                   QLVNRRMGVKPERAAT"
FT   gene            complement(362908..363744)
FT                   /locus_tag="Oant_0346"
FT   CDS_pept        complement(362908..363744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0346"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: atc:AGR_C_4331 putative ABC-transport protein,
FT                   ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13077"
FT                   /db_xref="GOA:A6WVS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS3"
FT                   /protein_id="ABS13077.1"
FT                   /translation="MNLNDSMATRSRDNGRGEANAQTVIDIKDLSLVFETNDGPVHALS
FT                   NIDLAVKRGEFVSFIGPSGCGKTTLMRVVADLEQPTSGSVTVNGKTPEQARLDRSYGYV
FT                   FQAAALFPWRTIEDNISLPLEIMGFSKAERRERIEKNLALVNLSGFDKKYPWQLSGGMQ
FT                   QRASIARALSFDPDMLLMDEPFGALDEIVRDHLNEQLLKLWAATRKTVIFVTHSIPEAV
FT                   FLSTKIVVMSPRPGRIHEIIDCDLGPDRPLEIRESEAFLKIAHRVREGLRLGHIHE"
FT   gene            complement(363778..365232)
FT                   /locus_tag="Oant_0347"
FT   CDS_pept        complement(363778..365232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0347"
FT                   /product="dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="TIGRFAM: dihydropyrimidinase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; KEGG: bms:BR0278 D-hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13078"
FT                   /db_xref="GOA:A6WVS4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS4"
FT                   /protein_id="ABS13078.1"
FT                   /translation="MAKVIKGGTVITADRTFKADVLIEGEKIVAVGDNLSGDEVIDASG
FT                   CYIMPGGIDPHTHLQMPFMGTYSSDDFDTGTAAALSGGTTMVVDFVLPDSEGNLLDALQ
FT                   EWFQKAGKARTDYSFHMAITGWNERTFNEMAEVVKRGINTFKHFMAYKGALMVNDDEMF
FT                   ASFQRCAELGAMPLVHAENGDIVAQLQAKLMAEGNDGPEAHAYSRPPEVEGEATNRAIM
FT                   IADQAGVPLYVVHVSCEQSHEAIRRARQKGMRVFGEPLIQHLTLDESEYHNKDWDYAAR
FT                   RVMSPPFRDKVNQDSLWAGLAAGSLQCVATDHCAFTTEQKRYGIGNFTKIPNGTGGLEE
FT                   RMPVLWSRGVRTGRLTPNEFVAVTSTNIAKILNIYPQKGAVLPGADADLVIWDPEATKK
FT                   VSAKTQLSSIDYNVFEGFELKGLPRTTLSRGRIAFDKGHVKAEPGDGRFIEREPNGAVN
FT                   RALSQWKEIVAPRKVERSAEHMPIGV"
FT   gene            complement(365294..366541)
FT                   /locus_tag="Oant_0348"
FT   CDS_pept        complement(365294..366541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0348"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   PFAM: peptidase M20; KEGG: bmf:BAB1_0310 peptidase
FT                   M20/M25/M40"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13079"
FT                   /db_xref="GOA:A6WVS5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS5"
FT                   /protein_id="ABS13079.1"
FT                   /translation="MVLTSNLRVNGDRLWDSLMDMAQIGPGVRGGNNRQTLTDEDGEGR
FT                   KLFQSWCEKSGLSMGVDTMGNMFFLRPGEDADADPVYMGSHLDTQPTGGKFDGVLGVLG
FT                   GLEVMRTLNDMNIKTKRPIVVVNWTNEEGTRFAPAMLSSGVFAGVHEQDWAYQRTDAKG
FT                   KKFGDELERIGWKGDEPVGQRKIHAMFELHIEQGPILEVEHKDIGVVTHGQGLWWLQVT
FT                   LTGKEAHTGSTPMKMRKNASLGLGKMLQLVNEIAMSHQPDAVGGVGHIDVSPNSRNVLP
FT                   GQIVFTVDFRSPNQDVLDDMKTRFEKEAPKIAAELDIGIEIEVAGHFDPVTFDDGCVVA
FT                   IRNAAERLGYSHRNIVSGAGHDACWVNRVAPTAMVMCPCVDGLSHNEDEDISKEWASAG
FT                   TDVLLHAVLETAEIVS"
FT   gene            366762..367460
FT                   /locus_tag="Oant_0349"
FT   CDS_pept        366762..367460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0349"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional regulator YcdC domain protein; KEGG:
FT                   bmb:BruAb1_0306 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13080"
FT                   /db_xref="GOA:A6WVS6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS6"
FT                   /protein_id="ABS13080.1"
FT                   /translation="MATAPSDSRTDTVENEKMSNDKSEGATRIQGINRRLILDAALEVF
FT                   SAYGFRGSTVDQIAEKAGMSKPNLLYYFPRKQNIYVTVLEDTLATWLEPFEHINPDGDP
FT                   LEELRRYIAVKLEMSAKKPEASRLFANEILHGAPAISDFLKGHLKQLVDEKAAVIHRWI
FT                   AEKRLAPVDPYHLIFTIWAVTQHYSDFSVQVGAVLGRRSEEAGFYDETAKAVSAIILDG
FT                   IRPRNENSSS"
FT   gene            367457..367855
FT                   /locus_tag="Oant_0350"
FT   CDS_pept        367457..367855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0350"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bms:BR0281 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13081"
FT                   /db_xref="GOA:A6WVS7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS7"
FT                   /protein_id="ABS13081.1"
FT                   /translation="MKTILIAAAIVRDEAGRFLLVRKRGSEIFFQPGGKIDAGEQPQIA
FT                   LIREIEEELGILIDESQLSYAAKMSAPAANELDATVEAELFHLSLKEGQVPAASSEIEE
FT                   LIWLKAGDQSRPVALLSQSIQARFSDAV"
FT   gene            complement(367852..368925)
FT                   /locus_tag="Oant_0351"
FT   CDS_pept        complement(367852..368925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0351"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PE00248 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13082"
FT                   /db_xref="GOA:A6WVS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS8"
FT                   /protein_id="ABS13082.1"
FT                   /translation="MASIDIQSVRKSYGEHAVLHGVDLEIKDGEFIVLVGPSGCGKSTL
FT                   LRMIAGLEDITAGQVQISGKRVNELAPKDRDIAMVFQSYALYPHMSVADNMSYSMRLRK
FT                   TPKEKIASAIKSTAAKLGLDPLLERRPKALSGGQRQRVAMGRAIVRQPKAFLFDEPLSN
FT                   LDARLREQMRAEIKKLHGELKATSIYVTHDQIEAMTLADRIVAMHGGVVQQVGSPLELY
FT                   DHPANLFVAGFIGSPAMNFLDVTYLEQDGGPRLKLKDGTLIALPQPVKLKDGGNATLGI
FT                   RPEHVHIENSAGLTTDVDLVEPTGFGIILHLSLHGLPFKIFTLDRDALHAQGSIQVSFP
FT                   AQHLHLFDREGNRVESA"
FT   gene            complement(368940..369773)
FT                   /locus_tag="Oant_0352"
FT   CDS_pept        complement(368940..369773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0352"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SMc01979 putative sugar
FT                   transport system permease ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13083"
FT                   /db_xref="GOA:A6WVS9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVS9"
FT                   /protein_id="ABS13083.1"
FT                   /translation="MTNRKLLLVGAHRIAILLFVLFALFPIFWLVKVSVTPNDLLYSEG
FT                   VRLWPSRMTFDHFSHVLNNSSFPLFFRNSLIVSGSTAIIVTLLASLSGYALSRFNFRAK
FT                   YWIVALMLLTQMFPLVMLIAPIYKIMAPLGLTNSLIGLIIVYSAFNVPFATFLMQSFFD
FT                   GIPKDLEEAAKIDGATQFMAFRQIILPLTLPGIAATLGFVFTAAWSELLFALMLISGND
FT                   SATFPVGLLSFVSKFSVDFGQMMAAGVLALIPACLFFFLIQRYLVQGLTAGAVKG"
FT   gene            complement(369778..370731)
FT                   /locus_tag="Oant_0353"
FT   CDS_pept        complement(369778..370731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0353"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL110365 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13084"
FT                   /db_xref="GOA:A6WVT0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT0"
FT                   /protein_id="ABS13084.1"
FT                   /translation="MNDTASIKAPVHNDVPRQDRRSFLQRLAHASEPYLYSAPALILIG
FT                   AIMLVPLVLGVSYAFRDIQLLNPFSGGYVGLDHFRELATDQAFYRSLKNTLWWTGCSVL
FT                   LQFVFGLILALLLDKPFAGRGIAQALIFLPWAVPTFLTGLNWAWLFNPVIGPLPHWLHA
FT                   IGILSAPDNILSDPNLAMWGIITAGVWWGIPFFAITMLAALQAIPRDLYEAAAIDGAGP
FT                   VQRFLSITLPYLAPTMAITILLRTVWIANSADLIVVMTGGGPADRTQIVASYIFTQAFK
FT                   RLDFGYASAIAMVLLVLLMVYSMLIVLLRQTLLNKD"
FT   gene            complement(370806..372065)
FT                   /locus_tag="Oant_0354"
FT   CDS_pept        complement(370806..372065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0354"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sme:SMc01977 putative sugar-binding periplasmic ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13085"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT1"
FT                   /protein_id="ABS13085.1"
FT                   /translation="MKKLIAAAFATMLLSGTALADTTLKLVEVITSPERTKTLESIVAK
FT                   FEAANPGTKVEIISLPWGESFQKFATMVSAGEIPDVMEMPDTWVSLYANNGMLENLEPY
FT                   LEKWETTPDLTERALELGRSVNNTAYTLPYGFYLNAMFYNKKLLSEAGVSEPPKTMDEF
FT                   VEASKKIAALPGKSGFCMRGGPGGLNGWVIFAASMAGDNKFFNEDGTSTMNSEGWKKGI
FT                   TWMVDLYKNGLAPKDSVNWGFNETVAGFYSGTCAFLNQDPDALIAIAERMKPEDFGVTI
FT                   MPKGPDGKTFPTIGFAGWSMMSGSQNKDLSWKLISMLEGPEGNIEWNKRTGALPVLKSA
FT                   QNDPFYSGEQFKGWFDELADKNVVPTVMPTYLEEFAFFKDSLVIKTSQEALLGDITPDQ
FT                   LADQWAEYLTKAQQKHLSKQ"
FT   sig_peptide     complement(372003..372065)
FT                   /locus_tag="Oant_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(372101..373270)
FT                   /locus_tag="Oant_0355"
FT   CDS_pept        complement(372101..373270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0355"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   rle:pRL110363 putative methionine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13086"
FT                   /db_xref="GOA:A6WVT2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT2"
FT                   /protein_id="ABS13086.1"
FT                   /translation="MTDGMDPLDFAALTVAHDESNAYDAVVPPIVQTSLFTFPSYDDMV
FT                   ASYRGEKVRPIYTRGLNPTVRAFEEMLAKLEGGEDALGFASGMAAISSSVLAFVNPGDR
FT                   IVAVRHVYPDAFRLFGTIMKRMQVQVDYVDGRDEEAVAKALPGAKLFYMESPTSWVMEA
FT                   HDVGALAAIARQHGVLSIIDNSWASPIFQRPLSLGVDLVVHSASKYLGGHSDVVAGVVT
FT                   GSKALINTIRAETYPYLGGKLSPFDAWLLVRGMRTLPTRMKAHEASALEIAKRLQALDV
FT                   VETVCHPALANRLPAGLKGTSGLFSVIFREGVNIREFCNHLDLFKLGVSWGGHESLIVP
FT                   GEVVLQQKAQPNSAHTFGIDPRSVRLHVGLEGTEALWRDIEGALAASTE"
FT   gene            complement(373267..373983)
FT                   /locus_tag="Oant_0356"
FT   CDS_pept        complement(373267..373983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0356"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: ret:RHE_PE00243 probable transcriptional
FT                   regulator protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13087"
FT                   /db_xref="GOA:A6WVT3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT3"
FT                   /protein_id="ABS13087.1"
FT                   /translation="MKDRRLLQIAPLPPMDRARQVTDALANYIATAQLQAGDRLPAERE
FT                   LMTALAVGRSTIREAIRHFQALGVIEARKGSGTYLLKPISAATIHMPLSFDPAQLRDAL
FT                   LQSLEVRRGIEAEASMVAARKRTAEDLVIIERNLNEMERVHIAEGTSGPEDLAFHLAIY
FT                   DATHNPLFRQLLEQMREAFLHFWDHPFERIDFARRTFPFHRTLFNAIVAQDPEAARQET
FT                   LKILDIVEEDIKEMSK"
FT   gene            374276..375334
FT                   /locus_tag="Oant_0357"
FT   CDS_pept        374276..375334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0357"
FT                   /product="Pyridoxal 4-dehydrogenase"
FT                   /EC_number="1.1.1.107"
FT                   /note="PFAM: aldo/keto reductase; KEGG: atc:AGR_L_2031
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13088"
FT                   /db_xref="GOA:A6WVT4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT4"
FT                   /protein_id="ABS13088.1"
FT                   /translation="MLHAAIEEIPMQLKASEKRTLGRTGLTVTALGLGTAPLGGLYAPV
FT                   SRADADALLEAGWGSGIRYFDSAPMYGYGRCEHLLGDMLREKPERAVISTKVGRLMTNE
FT                   RAGRTLPPSPPKNPLDSGWHNGLNFREVFDYSYDGVMRSFDDSQQRLGFPEIDLLYVHD
FT                   IGRVTHGDRHELHWNALTKGGGFRALTELRAAGNIKGFGLGVNEWQIIRDALEEADLDC
FT                   SLLAGRYSLLDQVSEKEFLPLAQKRGMALVIAGVFNSGILAAPRGGEQKFDYADAPAEI
FT                   IVRTNRLHDICDEYHVPLAAAAMQFPLRHEAVSSILIGVRSPEQIRQNVVWFEQSIPDE
FT                   FWNMLRSEGLIS"
FT   gene            375337..376257
FT                   /locus_tag="Oant_0358"
FT   CDS_pept        375337..376257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0358"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mlo:mlr3534
FT                   probable sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13089"
FT                   /db_xref="GOA:A6WVT5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT5"
FT                   /protein_id="ABS13089.1"
FT                   /translation="MTSKILCVGALTMDTIFRLDTLPEQAGKYLPREAVEIAAGMASSA
FT                   AAAIARLGGDVALWASAGTDPVGDRAVAELEAEGIDCSYIRRLEGARTAFSSILVDANG
FT                   ERIIVPFYDRKLASPSDLVPPIVAGAYAAVMTDVRWPWAAETALRAARDAGIPAILDAD
FT                   TAPVELLETLLPLATHIVASEPAAISVTGTTDLHECVRILSNRYDVFTSVTAGADGCYW
FT                   TEGAGKPVSHVAGFKVNAVDTLAAGDVFHGAFAHGLVEGKPMTDIIRFANASAAIKCAR
FT                   FGGRAGSPSKTEVLSFIETGVVPVR"
FT   gene            376531..377433
FT                   /locus_tag="Oant_0359"
FT   CDS_pept        376531..377433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0359"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   atc:AGR_C_4548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13090"
FT                   /db_xref="GOA:A6WVT6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT6"
FT                   /protein_id="ABS13090.1"
FT                   /translation="MAHNHSGQERFGLSAALTTPFDADGKIDVGRALKHALARLDSGCS
FT                   SVTLFGTTGEGASIADAERAALLDAFIAQGFPASNIVVGVMENSIADAVLQAGDALRRG
FT                   CKAILLAPPSYFKNLSDEGLFNWFSAVFKGLGSNARSIILYNIPSVTAVELSVDLIGRL
FT                   RATFGDIIIGVKDSSGNWAYTEKLLAAHKDIAILIGDERDLAAGVRLGGQGAISGMANL
FT                   FPDRLLGMINDGQDDAELVGAVQQLLNYPVTPAVKAMVARHTGDKEWRRVRAPLISLND
FT                   ADFDAIGSVFDRLHMAKAA"
FT   gene            377472..378134
FT                   /locus_tag="Oant_0360"
FT   CDS_pept        377472..378134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0360"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: atc:AGR_C_4549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13091"
FT                   /db_xref="GOA:A6WVT7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT7"
FT                   /protein_id="ABS13091.1"
FT                   /translation="MADDHNEPVKLRDKAYQSFTQHLLARDFHPGQFVSQRQLVTMTGL
FT                   PLGAIRELIPRLEAEGLIKTVPQRGLQIAHIDLNLIREAFQFRLFIEKESIAIFCQSAS
FT                   DELLRSLRAEHEDTLNRAMSEGETPELEERAQNIDWSLHDTIVGSLDNEIIWRAYQTNT
FT                   IKMRLINQERFRITGRVIPVMQEHLAVLAAIETRDPQTAMDAIAVHINNARKLALQI"
FT   gene            378211..379545
FT                   /locus_tag="Oant_0361"
FT   CDS_pept        378211..379545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0361"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: atc:AGR_C_4552 putative multiple sugar transport
FT                   system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13092"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT8"
FT                   /protein_id="ABS13092.1"
FT                   /translation="MNLLRPTRRQFLAGTAAIAASGVTGISPSFAQSTVDWKKYAGTTL
FT                   EVNLIKSPRGEILQKYQKEFEELTGIKVNSEQMPEQQQRQKAVIELTSGRPSFDVIHIS
FT                   YHVQKRQFEKGGWLADLNPFLKDPTLTDASLTEDDFASAGLTFAKDANGRFGALPFSVD
FT                   YWIIYWNKELFAAKGIEFPKTFEELVAAAEALTDPSTRTYGFVARGMKNANAPVYTSLL
FT                   LGYGKQSVDADGNLQTDSAEGIEAAKLYQRLMTKSAPPGVAGFNWAECQSNFLQGRVGM
FT                   WLDGIGFAPPLEDPNKSRVVGKVGYGVMPAGPNAQAAPTTGDGIGVTEASKNKEAAYLY
FT                   CQWAISKEMGARLLQSGSGVPFRKSVIDDEAVRKGVTMPAGWVEALSKSAPISQLCLPV
FT                   IVPVTEFRDIIGVGLTNLLNGADAETEMKRATEEFRPVLARSEGK"
FT   sig_peptide     378211..378306
FT                   /locus_tag="Oant_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 32"
FT   gene            379542..380480
FT                   /locus_tag="Oant_0362"
FT   CDS_pept        379542..380480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0362"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_C_4553 putative
FT                   multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13093"
FT                   /db_xref="GOA:A6WVT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVT9"
FT                   /protein_id="ABS13093.1"
FT                   /translation="MTSAAPIGAKTEAAANAASSTKTGKSRLRPSYWPFVLPALITVGA
FT                   VIVFPWVFTLWMSANQWQLGGEQSFVGFDNYLRLAADMRFWESMWHTLVYTVLSVVAPM
FT                   ILGTIAALVFDSKLPMRGLLRGIFVMPMMATPVAVALVWTMMYHPQLGVLNYLLSLIGI
FT                   APQEWIFNQSTVIPSLVLVETWQWTPLVMLIVLGGLASMPRDPFESAEIDGANGWQKFR
FT                   YITLPMILPFIMVAVIIRSIDALKSFDIIYAMTQGGPGTASETINIYLYNVAFSYYDIG
FT                   YGSAIAVVFFIVIIAMSMILLALRQRTKWNS"
FT   gene            380490..381308
FT                   /locus_tag="Oant_0363"
FT   CDS_pept        380490..381308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0363"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_C_4555 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13094"
FT                   /db_xref="GOA:A6WVU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU0"
FT                   /protein_id="ABS13094.1"
FT                   /translation="MARKSILSKLGTALMVFIIVSPAIFFFVWMLSLSLKYEIDNGAYP
FT                   PILIPDRIAWSNYSGIFETNDFLLYFWNSILVTGTATLLALLVGVPAGYGIARLRANKS
FT                   AIVIMIARMTPGLSYLIPLFLLFQTLGLLGTLWPQIIIHLVVTVPIVIWIMIGYFETTP
FT                   LELEEAAIIDGASSWQVFMKVALPIAKPGVVVSLILAVIFSWNNFVFGIVLASRETRTL
FT                   PVAVYNMLSFEQVSWGPLAAAALVVTLPVLLLTVFAQRQIVAGLTAGAVK"
FT   sig_peptide     380490..380600
FT                   /locus_tag="Oant_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.772) with cleavage site probability 0.557 at
FT                   residue 37"
FT   gene            381324..382382
FT                   /locus_tag="Oant_0364"
FT   CDS_pept        381324..382382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0364"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: atc:AGR_C_4558
FT                   probable ABC transporter ATP-binding protein Y4OS"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13095"
FT                   /db_xref="GOA:A6WVU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU1"
FT                   /protein_id="ABS13095.1"
FT                   /translation="MASVSIRNAIKKYGNVGVLHGVSVDIQDGEFVVLVGPSGCGKSTL
FT                   LRMIAGLEEISDGEIAIGPRVVNDLRAKERDIAMVFQNYALYPHMTVADNMGFALMLKN
FT                   APKEERDSRVNRAAEILGLNKLLDRFPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSN
FT                   LDAKLRVQMRGEIKGLHQRLKTTTIYVTHDQIEAMTMADKIVVMRDGLVEQIGAPLDLY
FT                   DRPANMFVAGFIGSPSMNFVNGKIEEGSFVADGGFRMPLPEGDYASLSGKAVYGVRPEH
FT                   MKIAEQGVPVTVEIVEPTGSEIMVMGKLGDQPITCLFRERLTVRPRDVLTIAIDPATSH
FT                   VFEPKKGKRVSR"
FT   gene            complement(382419..383729)
FT                   /locus_tag="Oant_0365"
FT   CDS_pept        complement(382419..383729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0365"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate dehydrogenase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   bmb:BruAb1_0308 dihydropyrimidine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13096"
FT                   /db_xref="GOA:A6WVU2"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU2"
FT                   /protein_id="ABS13096.1"
FT                   /translation="MADLSTNFLGIKSPNPFWLASAPPTDKAYNVERAFKAGWGGVVWK
FT                   TLGAEGPPVVNVNGPRYGAIHGADRRLLGLNNIELITDRPLEVNLREMKEVKMRWPDRA
FT                   LIASIMVPCEEEAWKAILPLVEETGADGIELNFGCPHGMSERGMGAAVGQVPEYVGMVV
FT                   KWCKQYSRMPVITKLTPNITDIRKPARGAKENGTDAVSLINTINSIVSVDLDSMSPVPS
FT                   IDGRGSHGGYCGPAVKPIALNMVAEIARDPETYGLPISGIGGITTWRDAAEFIALGCGT
FT                   VQVCTAAMTYGFKVVEEMIDGLSDWMDSKGYQTLDDFRGMAVGHVSDWQYLNLNYVTKA
FT                   RIDQDSCIKCGRCHIACEDTSHQAITSLVNGARHFEVIDEECVGCNLCVNVCPVEDCIT
FT                   MEQIGDFDPRTKAPIPAQYANWTTHPNNPMAVKEAAE"
FT   gene            complement(383741..385243)
FT                   /locus_tag="Oant_0366"
FT   CDS_pept        complement(383741..385243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0366"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bme:BMEI1638 glutamate synthase
FT                   (NADPH) small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13097"
FT                   /db_xref="GOA:A6WVU3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU3"
FT                   /protein_id="ABS13097.1"
FT                   /translation="MRSADNSPIDAVDNPGHTNGPDIHGSRLEKADYAHVFDDLHPPLN
FT                   KHEALVESDRCYYCYDAPCMNACPTSIDIPRFIRQINTGNAIGAAKTILSENILGGMCA
FT                   RVCPTETLCEEVCVRETSEGKPVKIGELQRYATDVLMETGNHPFKRAPDTGKHIAIVGA
FT                   GPAGISAAHRLAMYGHQVTIFEARPKGGGLNEYGIAAYKTVNNFAQRELEFVLKIGAIN
FT                   IEYNQTLGQDITIETLKAGYDAVFLGMGMPGVNDLALVGEDAPNVIDAVDYIANLRQAK
FT                   DLSSLPVGRNVVVIGGGMTAVDVAIQTKKLGAENVTIVYRRGQESMNASAYEQELAQIH
FT                   GVVIRHWLQPHALERNEDGTVNAVVFEYTNADSGKLSGTGEYLILEADQVFKAIGQKFE
FT                   PEPIAGSGIGLSKGRISVDEDRRTSVEGIWAGGDCVAGGQDLTVASVEDGKVAAESIHA
FT                   TLTKRPEAIEGFADAVLSGGALHAPSPSASRDRSVPLGQEQG"
FT   gene            complement(385479..386411)
FT                   /locus_tag="Oant_0367"
FT   CDS_pept        complement(385479..386411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0367"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mlo:mlr2632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13098"
FT                   /db_xref="GOA:A6WVU4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU4"
FT                   /protein_id="ABS13098.1"
FT                   /translation="MKPRDVATYIFLAVAWGLSFLVVLRVVEAFGWAGAVAFRSFIAAG
FT                   TLFAIAKLSGRNLDFQAGWKPFAVVGATTVAGQLIGLSYGTPLIGTAMAAICVASIPLF
FT                   SMVISQLWGLERITSRGLIGLLLGVTGIVLLVGFPAVAVTPEFIMGCIAVLFSCFSAAF
FT                   GSNYASRRLSTTGSWETTIGAFVFGGILSLPLILAVPVPAMPGMIDFVYLLISACVMSA
FT                   LTYVLYFKLVGNVGPTKAISVEFVVTVIAVLVGAVFLKEQLSLIQFVGAAVIISGCALV
FT                   LSSRPALPKESQTFPASEATPDGLKSDPL"
FT   gene            complement(386499..386957)
FT                   /locus_tag="Oant_0368"
FT   CDS_pept        complement(386499..386957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0368"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: cyclase/dehydrase; carbon monoxide
FT                   dehydrogenase subunit G; KEGG: bmb:BruAb1_0310 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13099"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU5"
FT                   /protein_id="ABS13099.1"
FT                   /translation="MDLTGEERIAAPRQAVWDALNDIETLKSCIPGCEDIERISETEIR
FT                   AALKVSFGILKVRFHGILELSNMKPPVSYTISGHGEGSIAGFAHGATDVRLDEDGTDTI
FT                   LSYAIRGDAGGKVAQIGTKLLGSVARKIADRFFANIAEAASNAAAKTT"
FT   gene            387108..388757
FT                   /locus_tag="Oant_0369"
FT   CDS_pept        387108..388757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0369"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   bms:BR0285 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13100"
FT                   /db_xref="GOA:A6WVU6"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVU6"
FT                   /protein_id="ABS13100.1"
FT                   /translation="MARDATKLEATVAKLKKHWADSAPHDMRAAFKSDPGRFERYSLSL
FT                   DDLLFDWSKCRVNDETIGLLKELAIAADVEGRRAAMFAGEHINNTEDRAVLHVALRDTS
FT                   SKEVLVDGHNVLPDVKEVLDRMAAFADGIRSGAIKGATGKKITDIVNIGIGGSDLGPVM
FT                   ATLALSPYHDGPRAHFVSNIDGAHIADTLGILDPATTLVIIASKTFTTIETMTNAQTAR
FT                   KWVADALGEAAVGAHFAAVSTALDRVAAFGIAEDRVFGFWDWVGGRYSVWSAIGLPVMI
FT                   AIGPEDFRKFLAGAHSMDVHFRDAPLEKNLAVWLGLIGYWHRAICGYGSRAIIPYDQRL
FT                   ARLPAYLQQLDMESNGKSVTVDGKPVSGPTGPVVWGEPGTNGQHAFFQLLHQGTDTIPL
FT                   EFIVAAKGHEKHLDHQHEMLLANCLAQSEALMKGRTLDEARAQLKAKNLPESEVERIAP
FT                   HRVFSGNRPSLTLVHDKLDPFALGRLVALYEHRVFVEAQIFGINAFDQWGVELGKELAT
FT                   ELLPVVSGEESSDGRDASTQGLVAHLHARRKA"
FT   gene            388840..389901
FT                   /locus_tag="Oant_0370"
FT   CDS_pept        388840..389901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0370"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bms:BR0286 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13101"
FT                   /db_xref="GOA:A6WVU7"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU7"
FT                   /protein_id="ABS13101.1"
FT                   /translation="MKTEIVKFAGDVPGNAIELRVLRFAGKDSDAPSAYLQSSLHGAEL
FT                   PGQAALHFLVPMLKKAADEGRILGNITVVPQANPIGSNQWQAHQHLGRFETFSLTNFNR
FT                   AFPLLPDFDTSELPEPDAPISLAQRLKATLLKLALPNDIVLDLHCDDESENYVYIAEEF
FT                   AEDMKDLAIALNSTAILAWDTTADAAFEEACAHPVLQLPADKRNMKRRAVTTVEFRGLS
FT                   DVYADMGKGDAEGLYKFLVHRGVVRDDNVKLETEYKGLVTPLSHVEMLRAPEGGMVLFH
FT                   VAPGDEVKAGTKLVTVVTKPGEPEGDITLTAPQDGRILTRRSLRYVRRGDDLLKLLGAQ
FT                   PSTVKKRAGALEA"
FT   gene            389898..390626
FT                   /locus_tag="Oant_0371"
FT   CDS_pept        389898..390626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0371"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bms:BR0287 hydrolase, haloacid
FT                   dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13102"
FT                   /db_xref="GOA:A6WVU8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU8"
FT                   /protein_id="ABS13102.1"
FT                   /translation="MSDKLSAERMKSIRAVLFDKDGTLIDFDRTWFSISWQLAQRAAKG
FT                   DEVRARALLDAGGYDWLTERFRANSVIAAGTVEDIVSLWHPDVASEQVRKLVEEYDAYC
FT                   VTEGARSAVAIEAVRETLETLREMGLRLGIATNDSEAGAHATAKALGIHGLFEVVIGYN
FT                   TAARPKPYPDPLLYFAEKLGLAPHEIAMVGDNLHDLETAHAAGAGLAVGVLSGNSPREA
FT                   LEPHADVVLDSVAGLPELLK"
FT   gene            390744..391379
FT                   /locus_tag="Oant_0372"
FT   CDS_pept        390744..391379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0372"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bja:blr1415 hypothetical glutathione S-transferase like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13103"
FT                   /db_xref="GOA:A6WVU9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVU9"
FT                   /protein_id="ABS13103.1"
FT                   /translation="MSMILIGQYDSPFVRRVAIAMRLYGLPFEHEPWSTFGDRDRIAEF
FT                   NPLSRVPTLVLDDGDVVIESAAILDYLDEIAVGKPPLVAQKGIERRQALKICALSTGLA
FT                   DKAVSLLYEGLLRSEKSSVWVERCETQIARVLDVLESDLAERKSSYWFGDDIGHTDIAA
FT                   ACALRFLREAHPSLFDEQKHPALAGLAARCEALAPFQEIVQPLVPPSA"
FT   gene            complement(391446..393191)
FT                   /locus_tag="Oant_0373"
FT   CDS_pept        complement(391446..393191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0373"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bme:BMEI1632 acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13104"
FT                   /db_xref="GOA:A6WVV0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV0"
FT                   /protein_id="ABS13104.1"
FT                   /translation="MAKKTTGQSASVVESVAADTAKKGALKQEKIWLKSYPVGVPHEID
FT                   LSNTSSIGDMILASCRQFPDNPAFTCMGKDLSFKKLDEYSRALAAFLQSRGLVKGDRVA
FT                   VMMPNILHYPIAFTAILRAGFVVVNVNPLYTPRELEHQLNDSGAKALIVLENFASTVEK
FT                   TLNSVNVPNIIVASMGDMHGFKGHIINFVVRRVKKMVPVWNIPGHIRFKDALAQGRAQS
FT                   FNPIPVQGSDLAFLQYTGGTTGVSKGAMLTHSNILANVEQMHVWMEVAFRNKGKPKALN
FT                   FVCALPLYHIFALTVNAMIGIKLGARNILIPNPRDISGFVKELKKYPFHIFPGLNTLFN
FT                   GLMNNPDFQTLDFKPLILTLGGGMAVQRPVAERWQKMTGCHVTEGYGLSETSPVACANA
FT                   LDATEFSGTIGLPMPSTDVAIRDDDGNDLALGEVGEICVRGPQVMSGYWERPDETKRAI
FT                   MPDGFFRTGDMGFMDERGYTKIVDRKKDMILVSGFNVYPNEIEEVAAGHPGIVETAAVG
FT                   IPNEHSGEVVKLFVVRSDLNLTEDEVKAYCAERLTNYKRPREVEFRESLPKSNVGKILR
FT                   RELRD"
FT   gene            complement(393443..394090)
FT                   /locus_tag="Oant_0374"
FT   CDS_pept        complement(393443..394090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0374"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional repressor MAATS-type domain protein; KEGG:
FT                   bme:BMEI1631 transcriptional regulator, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13105"
FT                   /db_xref="GOA:A6WVV1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV1"
FT                   /protein_id="ABS13105.1"
FT                   /translation="MRRTKAEAAETREAILVAAEQVFLERGVNQSTLMEIACHAGVTRG
FT                   AIYFHFHDKLEIARTIIGNVRFPQEEIMLQAAAVNHPNPMHVLEQSIIQALHLFSNDVR
FT                   QQNIFIIINQRCEFVGEMAPLEDRLREARSNVLSLLAGLLDVAARRGELSKEWTADTAA
FT                   LILLSMLSGLLNEWLRGDRNYDLVTYGGKAISILIRSLRNQEFEAHQTQDYT"
FT   gene            394260..395474
FT                   /locus_tag="Oant_0375"
FT   CDS_pept        394260..395474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0375"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bms:BR0291 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13106"
FT                   /db_xref="GOA:A6WVV2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV2"
FT                   /protein_id="ABS13106.1"
FT                   /translation="MTLNRSIRLFAAGAAFLVFAGQPVLAQAPGGATPPPPQVSVTVVK
FT                   PHDVPVTYEYAARISAYRDVQVRARVGGILLHRNFIEGTEVKAGDVLFEIDPAPYEAEL
FT                   EKAQAQVAQAEAQYQQSIRDAERAEQLVQQKVQSTAVRDSAFATRDLNKAAVAAAKAQL
FT                   RTAELNLSYTKVTAPISGITSQEQVNEGSLIGTDASSSLLTSITQLDPVYVNFSFTDTE
FT                   AAEIDRLRAERGATGEDADRLKIKVLFGDGQAYDHEGTIDFTSSSLDTETGTLGARAVV
FT                   ENPNRRLIPGQFVRAVILGIQVKDAITIPKAALLQGPQTQFVYVVNKDNVVEVRPITVS
FT                   RELSDAWLVSEGLNAGERVISEGLVKAAPGKPVNPVDAATEASNQTSPDKAGAEAGKEQ
FT                   AADKQ"
FT   sig_peptide     394260..394340
FT                   /locus_tag="Oant_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            395471..398620
FT                   /locus_tag="Oant_0376"
FT   CDS_pept        395471..398620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0376"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bmb:BruAb1_0318 hydrophobe/amphiphile efflux-1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13107"
FT                   /db_xref="GOA:A6WVV3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV3"
FT                   /protein_id="ABS13107.1"
FT                   /translation="MNRFFVDRPVFAAVISIVLVLAGLICIRILPIAQYPELTPPQVVV
FT                   SATYPGASAETVAQTVAAPLEQQINGVENMLYMQSSSLGSGTMQLTVTFALGTDPDQAT
FT                   INVNNRVQRATSSLPQEVQRLGVTVDKRSTTILGMVAMFSDSDRYDRTYVGNYALLNVV
FT                   DDLKRLSGVGDVQLLGNIDYSMRIWLRPDKLAQYNLTPSDVSTAIQEQNAQFAAGRFGD
FT                   QPDPQAGPFTYTATTQGRLPDAAAFENIILRSSSNAATLRLKDVARVELGTESYLVDSN
FT                   LNGTSAVPIAIYLQPGANALNTMELIQNRMNELKASFPAGIDYSIPFDTTKFIKVSIEE
FT                   VIHTFIEAIILVVLVVFIFLQNWRATLIPIIAVPISIIGTFAGMYVLGFSINLLTLFGL
FT                   VLAIGIVVDDAIVVLENVERIMTTDKLSPRKAAIKAMGEVTGPVVAIVLVLCAVFIPVA
FT                   FMGGLVGEMYKQFAVTIAISVTLSGLVALTLTPALCALILKPGHHEPMLPFRIFNRFFE
FT                   RVTDGYSRGVRFFLKRAAIGLIIFAGLLGATYYLFERVPGSLLPDEDQGYLFSVAVLPP
FT                   AASLERTTAVLDQASANIRKSPAVESVFAVSGFDLLSGGLKTSAGTMFIMLKDWKERTT
FT                   PETDARNLPGAIMAMNSGIKDGLVLAFNPPPIMGLSTTGGFELYVQDRTGGGVESLTRA
FT                   TKLITEAAAKRPELQGVRTTFDPNVPQYDIQLDREKAKAMGVPINSVFTAMQATFGSLY
FT                   VNDFTLFGRNYQVNLQSEAEFRRDPSDLKHVFVRANSGSMIPLDALVTVKRIVGPDQLE
FT                   RFNAFNAAKITGNPAPGFTSGDSIKAMQEVAAEVLPQGYQIAWTGSAYQEVTTSGTGTQ
FT                   AMIFGLVMVFLILAAQYERWSLPLAVITAVPFAIFGALLATDLRGLTNDVYFQIGLVTL
FT                   IGLAAKNAILIVEFAVLERETGKSAIEAAASAARLRFRPIVMTSLAFILGVVPLAISTG
FT                   AGSASRHSIGTGVIGGMLAATFIATFFIPMFYSLIARKPPKRPEDEDVNETTGPNGQTD
FT                   I"
FT   gene            complement(398751..398915)
FT                   /locus_tag="Oant_0377"
FT   CDS_pept        complement(398751..398915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13108"
FT                   /db_xref="GOA:A6WVV4"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV4"
FT                   /protein_id="ABS13108.1"
FT                   /translation="MFDGVPAQWHKTPEQTKRSPNEAAYVFLGIMLAALSVPATFLGWA
FT                   IVQSIASLF"
FT   gene            complement(399240..400088)
FT                   /locus_tag="Oant_0378"
FT   CDS_pept        complement(399240..400088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0378"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bms:BR0295 amino acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13109"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV5"
FT                   /protein_id="ABS13109.1"
FT                   /translation="MKRYLPRLLVALAFTCGAHSAWASDAQPEAPSFINQKERLPLPSL
FT                   QALNRLRFLTTVDFPPFNMLGDQGQLSGYNVDLAKALCRQLGVDDVCQIEAVPWNELEE
FT                   RLLSGQAEAIIAGWKSTDENRDQFAFSRSYMRLPARFATTNAGTFNDDAVTATKGKGVG
FT                   VVAGSAHEQLLKSYFPQAIAKSYPDASLMFADLKSGKVSAVFHDGMSLSMWLNSPEGHA
FT                   CCSFTAGAYLAPQYLGSGLSIAVAQKNAPLASAFNNALQALQLKGTLTELYLRYFPNSF
FT                   Y"
FT   sig_peptide     complement(400017..400088)
FT                   /locus_tag="Oant_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            400325..402205
FT                   /locus_tag="Oant_0379"
FT   CDS_pept        400325..402205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0379"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bmb:BruAb1_0322 glycosyl transferase, group 2 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13110"
FT                   /db_xref="GOA:A6WVV6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV6"
FT                   /protein_id="ABS13110.1"
FT                   /translation="MSNGSIAFDLEICSAISARLEQCGVSRDALLGAYSTATHHGTSFC
FT                   VELIQRGDVAESAIYAAIADLLGLEFTNEALPSRIFVSGEEKPSAFIDVGQVMVLGADG
FT                   SSYLYIAPSENRIRKLRDHILATPQLKSRIRICTPTLLKQIMRQRHQKDLIARAHEMTP
FT                   QSFSAARVLDTPQAFIIAMAIYAFFACVFNWPTMTLLVLHVALSVFFFGCVMIRLFAAV
FT                   SGRRLKFLEIRKCNPRDLPNYSVLVPLYREQEVIGQLITSLKRLNWPASKLDIKLVCEK
FT                   DDFDTVSAIRRERLPLNFELVLVPSGGPKTKPKALNYALQFARGEIVAVFDAEDRPHPD
FT                   QLLEAWQTFQAEGDKLACVQAPLIIGNFRHNLLTRMFAFEYAALFRGLLPWLASRGLVV
FT                   PLGGTSNHFRRSCLEEVGGWDAYNVTEDADLGVRLARFGYHIGVITRGTIEDAPVNYDI
FT                   WRKQRTRWLKGWMQTWLVHGRQPHNTWRELGWFRFSVNQIYTLGIISSALLHPLMLAMF
FT                   AILLISMLFGPLTTHGVWLLGIDVTNILLAYLSFYLLGARTMEPTELGGYAYLFSIPVY
FT                   WVLISISAWRALWQLMRVPHLWEKTPHQPSLFYISADDEVRNVEPRPMID"
FT   gene            complement(402148..403092)
FT                   /locus_tag="Oant_0380"
FT   CDS_pept        complement(402148..403092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0380"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bmb:BruAb1_0323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13111"
FT                   /db_xref="GOA:A6WVV7"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV7"
FT                   /protein_id="ABS13111.1"
FT                   /translation="MGDSSKTANKKKDKKDEAKPIDKPIKLKIDGVARSFDINDPKLPK
FT                   WIDDNALQSGGYPYPSKMKSDEYEETLERLQIELVKLQYWLQDTGGRVISVFEGRDAAG
FT                   KGGTIFTIREFMNPRTARNVALPKPTETEQGQWYFQRYVAHFPTAGEFVTFDRSWYNRA
FT                   GVERVMGFCTPAQLETFLTETPDFERMIVTDGIHLFKFWLDIGQEMQLKRFHERRHSPL
FT                   KNWKFSPMDVAGISRWNDYSDALHTMLERTDTGYAPWTIIRSNDKRRARLAAIRRILLT
FT                   LPYEGRDLQAIGAEDQSIIGRGSTFLTSSSAEM"
FT   gene            403205..404497
FT                   /locus_tag="Oant_0381"
FT   CDS_pept        403205..404497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0381"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: Phosphate regulon sensor kinase PhoR; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; KEGG: bmb:BruAb1_0324 sensor histidine
FT                   kinase, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13112"
FT                   /db_xref="GOA:A6WVV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV8"
FT                   /protein_id="ABS13112.1"
FT                   /translation="MSEAGNRTDPEPQAEKSIFEPLLRVKGVLIASMVLAVCVLALDLP
FT                   FWFRAGLLAVVVLGAVWLASEVASSEPDEEPAKTAAPNEMAGVSGERLADLLTDPMVVF
FT                   DHSGTVLFNNSAALEAFQSLETGTALYLRFRAPEMHALIQGVIADGEARSIEYFERVPI
FT                   DRWFKAMVKALPGKDGRPELFVLLFRDQSETRRIDRMRSDFIANASHELRTPLASLRGF
FT                   IETLQGPARNDAAARDRFLDIMQKQAERMSRLIDDLLSLSRLEMRAHLAVNECVDMTSI
FT                   LNHVADTLTPLAAGLDISIERQLPDHPVTVTGARDELIQVFQNLVENACKYGQAGKRVI
FT                   VKLDEDNSGSSAEVVASVQDFGPGIAAEHLPRLTERFYRIDVETSRAQKGTGLGLAIVK
FT                   HILARHRGRLVVRSQLGEGSTFTVRMPKRTV"
FT   gene            complement(404503..405630)
FT                   /locus_tag="Oant_0382"
FT   CDS_pept        complement(404503..405630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0382"
FT                   /product="protein involved in cellulose biosynthesis
FT                   (CelD)-like protein"
FT                   /note="KEGG: rpd:RPD_3294 protein involved in cellulose
FT                   biosynthesis (CelD)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13113"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVV9"
FT                   /protein_id="ABS13113.1"
FT                   /translation="MLTKDFDIRVYSSAEQLSSDWPDADDKTGSAFFVFQTKSFVRAWD
FT                   ATYGRRPGTQLCLTEVRQHDGTPLLFLPLSITSIYGSRVLGFIDDGVSDYNVPIVFPAA
FT                   AKLSPDTTARVLEAVVAAVPSHDVIAFCKMPERVEGFANPLWQLANKLSNASTHAISLM
FT                   RPMDEIERSIQSISNIKKRDRTLQKMEGCRFFIAQTQAERRSVLQVMLRQKQRRFEETM
FT                   VPGFDAHPEKRRFFEEATEQLAQHNGLHLSALAVGETILATMWSVVRNDHYCAMITTFE
FT                   AGTWSKFSPGKVIILRLLHRLKADGYACFDLGFGDEGWKIGLCDRTIPLRDYIRPATLR
FT                   GRTSLILARSLEWIRSTLLYKKLRPLKWRVLRKFG"
FT   gene            405806..406801
FT                   /locus_tag="Oant_0383"
FT   CDS_pept        405806..406801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0383"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sme:SMb21500 putative glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13114"
FT                   /db_xref="GOA:A6WVW0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW0"
FT                   /protein_id="ABS13114.1"
FT                   /translation="MSVSIIIKTLNEEKRIAEAVESALKALPGGKVEVIVADSGSTDRT
FT                   IEIAQSYPIKIVQIEPPARASCGLGPQLGFQYSTQPYICLIDGDMTIEPDFLPAALDYL
FT                   DKHPDVGGVTGHVVDQILESLEFQRRAKRHSPEARTGDIDRMNGGGLYRRSAIEQAGYF
FT                   SDRNLHGHEEFDAGVRLRSKGWKLYRLDRPFVQHFGYTMNAYKLLVRRWKSKYLRGTGE
FT                   VLRAAMGQAHQKNLFRELPELRLWGAVYLWWLVILAALVFVPGWPLAILAAAVIAAIPF
FT                   AAMSIRSRSIELGVYAVVAWIFHAAALPLGFFQPRRKPTDWIESKVIREP"
FT   gene            406801..408993
FT                   /locus_tag="Oant_0384"
FT   CDS_pept        406801..408993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMb21499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13115"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW1"
FT                   /protein_id="ABS13115.1"
FT                   /translation="MKILRLAISVSLIGLAMSNAGAEEWLPVTENNLEISDGSPLDFSG
FT                   FLTNIPIEEKNRLIANAAGHFAKADEPDQTMRLQCAAIAWGPPSSGVVDHAFIDRYVRQ
FT                   LRLHGYNIARLHFVDADLMLGQERDFDFRPEALDRMRYLMAALKREGIYWIIDGLTSES
FT                   GALGGKDTDRWGLEGNLKRRTYVDDAAFDHWLRFQKEVYATINPYTGLTPLEDPALALI
FT                   IPFNENGIEFTSFVHEHDDGTTFWPGYRPAFNAFLKKRYANTAALSRAWGGLASDENLE
FT                   QQAIQLPESRSGGGRRLRDFQAFLVESERLLAQRMEQGLRGLGYRGLVAPYNNWFTVQT
FT                   ALSRQSQKALVANTYHDWIGTLSPGTEIKHTSSIADAASYVSEIAVGRWLGRPFLVTEY
FT                   EHLFWNRYRYEAGLVFPAYAALQGWDGICRHGQGPLTLAFDEAAPFRQRIVPYTFAVDP
FT                   VARAGETLASLLFRRGDIETADFNLPFMMQGEASLGESLEFRESARLKPLALVGGIGLA
FT                   TKELAWPQGLQKKVAVDYRNVSLDNVLQRLKTAGLLADDNATNPSQGLFESATGQIRLD
FT                   RNKLRMQVVTPKTEAIAFAELKDRLTLRELSLGNAEERGLFAVSAIDEKPLKDSEKLLI
FT                   IFASDARNTDMRFRDKAEKIIEDWGRLPVTLLRNRVDVTLARNTVSWTLSPVGLDGKIH
FT                   DKIAVGSGPIAFRLDNGAGKAGPTTFFLLERKLAAQ"
FT   sig_peptide     406801..406869
FT                   /locus_tag="Oant_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(408987..410108)
FT                   /locus_tag="Oant_0385"
FT   CDS_pept        complement(408987..410108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0385"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: sme:SMb21512 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13116"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW2"
FT                   /protein_id="ABS13116.1"
FT                   /translation="MTRISTSANDIKSRRVRAMHIDDIPAVRTLFQRVFRPHSKSCNKT
FT                   FDQYFQKFFFESPYYDPAIGSVVHEDEHGEIDSAISVLPIPYRVNGQSIMGRLLCAFMM
FT                   KPEMSPRGAAELTLTLRPSEKILNFTDSAAPVSLKHSEAIGGITLGTHGLGWTRIFRAA
FT                   SYVASYVAERRPILGGWATSSVGRMLNPLFPIPAIMRAAKPRANVKEIAQDEAISLVPG
FT                   YLQSYLAHPAWTESDINWLFLMASDNQAAGTLRFCAINDRTGSPSGFFCYYVRSNGIAE
FT                   VLNILAKAGMEKHAVDAMLLHLQDEGHVAAQGRVDPRYLNALSQQSIMFFRLKANVCVA
FT                   TANADMLNAVQRNDIFIGGLAGESWSRLSTDFY"
FT   gene            complement(410109..411392)
FT                   /locus_tag="Oant_0386"
FT   CDS_pept        complement(410109..411392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0386"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   sme:SMb21513 putative cell-surface polysaccharide exporter
FT                   protein, PST family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13117"
FT                   /db_xref="GOA:A6WVW3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW3"
FT                   /protein_id="ABS13117.1"
FT                   /translation="MKRHWSTLLSYAASSGSLFAANIAQLFTFAILARYLGSHEFGLFV
FT                   TVMAVTSIATFICGLGGAECLVRRVAQDRAIYPAMLGHNLILIAVTGVVLVAAGMVILP
FT                   FWLSGSPEFTNNLFGLFLLLVTNIVLVRLILLVEQIYIAHTDFVSANLSVVGFAIARTI
FT                   GATIACLVFGVSTVVGWAYWQFGVHVLVAVVYALFLRRLGLPQYTIVRDELRLGVMFAS
FT                   QFIFKAVRQNADLLLLGTLVTPSIVGSYGVTRRIIDSSTLTVEAMNRLVYPHLARASAN
FT                   GIHHALPITMRLLGAAIAIGIFTSLAVFIIAPYLPYLFGSEYDTLVSFCRTLCWITVFV
FT                   ALWSIAVDLLGAASQHSYRTAVLNTGNILGAPLLALATWYAPITGTFAAIYVIEISIVL
FT                   ASWGCVIYLVRRSRDAEEKKGGFKQAGA"
FT   sig_peptide     complement(411330..411392)
FT                   /locus_tag="Oant_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            411738..413267
FT                   /locus_tag="Oant_0387"
FT   CDS_pept        411738..413267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0387"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   sme:SMb21506 putative auxiliar protein involved in export
FT                   of cell surface polysaccharides, MPA1 family without
FT                   cytosolic domain, slightly ExoP-like"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13118"
FT                   /db_xref="GOA:A6WVW4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW4"
FT                   /protein_id="ABS13118.1"
FT                   /translation="MYTLRDLASKARVTETASENLASVDDRLRAVRRETYVVREEEKVT
FT                   ETIAPANKGLMLPELDLFEALAWMRARWILIAALAIIGGLAGLAYGMTAKPRYTAYTDL
FT                   LVPPSGLQLLPNDVYAQSLQADSQILDIESKMRILTSGNVLRRVVTDLKLNEDEEFVPP
FT                   PPAFDVRAMLGLSKPAGPKDDTLTAVRALSQRINVTRPERSYLVTIAVWTENPEKSVKV
FT                   ADSLANAFQEEVAQADADGAGRAAAALSERLSSLQKAATEAEEKVSAFRRAHGLQTSGG
FT                   ELVSTQSMTQINSKLVDAKARVADASTRYQELTKDTGSAVSPASTLQSPTMTNLRGQYA
FT                   SLKQRYDALAMTYGPRYPELMNTERQLAGLEQQLAQERARILQSAKVDLDQANAVVAAL
FT                   NAQAASARSAVALDNDAQVQLSDLERDMAAKVSIYNTFLTRSSETSQRQQLDATNIRII
FT                   STAIPPIGRSWPPKTVVLGAGGGIAGMGLGVVLALSLGYLGAWRRNREGLV"
FT   gene            413350..414426
FT                   /locus_tag="Oant_0388"
FT   CDS_pept        413350..414426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0388"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: sme:SMb21505
FT                   putative membrane protein, similar to Wzy-like
FT                   polysaccharide polymerase ExoQ"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13119"
FT                   /db_xref="GOA:A6WVW5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW5"
FT                   /protein_id="ABS13119.1"
FT                   /translation="MFLFIWIGTNPYPDLGAVTGVTAKAADSSSLNQLVTLFLTGSFLV
FT                   CALSSSMRSAILQPRVLIGLVFFWLFMTALLSAHPMIASKKVVLSILTALNASIFLMLP
FT                   QSERQMARLLAAGSLITLAFAYFGVIFMPQRAIHQGTEVIEPMLAGAWRGHYPHKNAAA
FT                   ASLVLMSFFGLYIWKTGLPKTGMLIVALCVFFVLNTGGKTSTAMLPFIVVMSLVFVRLK
FT                   WTRVFIAIGGIAAFNIIAVGAAVFDPLRELVQSLGVDASFTNRSDIWKLAFAAISAKPI
FT                   FGYGLDSFWKTPEMVYAGGGGASWAVAAFNAHNSFLDMMINAGIIGLILTLIWIMVLPL
FT                   RYIRAFPFQVGSYPHELK"
FT   gene            complement(414393..415339)
FT                   /locus_tag="Oant_0389"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(414393..414995,414995..415339))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Oant_0389"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: nha:Nham_4172 ISSpo6, transposase orf A"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13120"
FT                   /db_xref="GOA:A6WVW6"
FT                   /db_xref="InterPro:IPR001523"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW6"
FT                   /protein_id="ABS13120.1"
FT                   /translation="MSRALSIDLRIRVVAAVDGGASHREAAERFGVSAASVSRWRNLQL
FT                   QQGNVRPGPLGGDRNSHKTEAHADQIMIWLAEHRDGTLFELRSDLAAQGIIISKSALHR
FT                   FLVRHEQTRKKKTGHAVEQSRPDVLEKRQCWFEEQLDLDPERLVFIDETWTATNMARSH
FT                   GRCRKGERLRMGFPHGHRKTTTLVAGLRNTGMVAPLVIDGPINGDWFEAYVAQVLVPTL
FT                   KPGDIVILDNLSSHKRPAARELIEAVGATMMFLPPYSPDFNPIEKAFSKLKALLRKAAE
FT                   RTVNGLWDRIGQMVELIEPQEAQNYFNSCGYDPT"
FT   gene            415547..416431
FT                   /locus_tag="Oant_0390"
FT   CDS_pept        415547..416431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0390"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   mes:Meso_2876 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13121"
FT                   /db_xref="GOA:A6WVW7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW7"
FT                   /protein_id="ABS13121.1"
FT                   /translation="MVLHYGCCLRIALAGKGKARLKQLLGAGAMMEMDSLDKARSRLEW
FT                   YAIRLNDSISRRFPLRPFCLPKNERIITFTFDDVPDTAESAGAAILDKHGVHGTFYIAG
FT                   NLVGTKEAKRNLITQEGCRKLVERGHELGCHTYDHLKVPYVGAQNIVADLDRNTAYLDV
FT                   FEPDRVEARNFAYPYCASSMMSRRLFADRFSTCRGGGNRINRGMIDLAFLQAVEIRQPD
FT                   DDAARQTRWIDDLNANPGWLVFYTHDVSDTPTEFGCKPETFERLVSHAVKSGAAVLSVR
FT                   EALARLGAQRGAA"
FT   gene            416428..417672
FT                   /locus_tag="Oant_0391"
FT   CDS_pept        416428..417672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0391"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mes:Meso_2877 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13122"
FT                   /db_xref="GOA:A6WVW8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW8"
FT                   /protein_id="ABS13122.1"
FT                   /translation="MTHLNDKEHRLLAINNYFYRRGGAETVFLDHIKLFSEIGWQTAPF
FT                   AMQHPDNFPSDWSSYFVSEIEYGRESSPLTKFVQAGKIIYSWEARDRIKALIERFRPNV
FT                   AHAHNIYHHLSPSIFPVLKDAGIPTVMTAHDLKLACPAYKMLSHNQICERCKGGRIYNV
FT                   ALHKCIKDSTALSGLVFVETAIHRMLGLYRNTLDRIVVPSRFYIAKLAEWGWPEEKLVY
FT                   IPNFAHTDDLKPYADESDYFAYVGRLAPEKGIGTLIRAAAIARQKLVIAGTGPEEQSLK
FT                   AIATEAGGDVTFAGYVSGERLHRLIGEAKALVLPSEWYENAPISILEAYALGVPVIGAD
FT                   IGGIPEMIIEGETGMVSRAGDIDDLARVLGEFAGLSPQARRKMGNVGRVWAGNEFSPQA
FT                   YRNRTLELYAELGAL"
FT   gene            417672..418799
FT                   /locus_tag="Oant_0392"
FT   CDS_pept        417672..418799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0392"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; Protein of
FT                   unknown function DUF1972; KEGG: mes:Meso_2878 glycosyl
FT                   transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13123"
FT                   /db_xref="GOA:A6WVW9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVW9"
FT                   /protein_id="ABS13123.1"
FT                   /translation="MVRNDKRPRVMMLGLRGVPNVQGGVEKHVEELARLYVTKDWDVEV
FT                   IGRRPYLEKKQPYVWEGVRVTPIWAPTSMKFEAIVHTVLGVLRAGFKRPDVLHIHAIGP
FT                   ALAVPLARLLGLRTVVTHHGFDYNRQKWGRLARTMLKLGEWCGMRFANARIAVSNDIAQ
FT                   TMQQHFHVPITFIPNGVTLRPACRDKTWLEKHGLLPERYIALVARIVPEKRQLDLIEAF
FT                   AKLSDSSLKLALIGSAEYTAEYAGAVRARADAVPGVVLTGALQGEELSALFSQAALFVL
FT                   PSSHEGMPIALLEAMGYGLNVLASDITANVEVGLSEESYFPLGNVDALKDALRQKIDSP
FT                   LTSKQSQEMIDWIARDYSWSGIADRTLEVYKSTLK"
FT   gene            complement(418912..419451)
FT                   /locus_tag="Oant_0393"
FT   CDS_pept        complement(418912..419451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0393"
FT                   /product="GcrA cell cycle regulator"
FT                   /note="PFAM: GcrA cell cycle regulator; KEGG:
FT                   bmb:BruAb1_0325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13124"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX0"
FT                   /protein_id="ABS13124.1"
FT                   /translation="MNWTDERVELLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLKL
FT                   SGRGKTTTAAPRSKKVNTVAAAPRPAAQHSTGVHTTTMRTATVTKTVGATALQMDYAVD
FT                   VVAERVVKPASDVVVPISRRLSLLQLSERTCKWPIGDPLNEDFHFCGHESGESSPYCSY
FT                   HSRLAFQPTAERRRAR"
FT   gene            420197..421408
FT                   /locus_tag="Oant_0394"
FT   CDS_pept        420197..421408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0394"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   bmb:BruAb1_0327 acetylornithine aminotransferase,
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13125"
FT                   /db_xref="GOA:A6WVX1"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX1"
FT                   /protein_id="ABS13125.1"
FT                   /translation="MTDATTVQPLYDTYNRAALRFERGEGIWLITESGERYLDFAAGIA
FT                   VNSLGHSHPHLVETLKTQAEKLWHLSNVYEIPAQEKLGRRLVESTFADKVFFTNSGAEA
FT                   LECAIKTARRYQYVSGHPERYRIVTFEGAFHGRTLATIAAGGQAKYLEGFGPKVDGFDQ
FT                   VPFGDEAALRAAITDETAGILLEPVQGEGGLRGFPEEFMRMLRQICDEKGLLLILDEVQ
FT                   TGVGRTGKLFAHEWAGIKPDIMAVAKGIGGGFPMGACLATAEAAKGMTAGVHGTTYGGN
FT                   PLAMAVGNAVLDVVLADGFLENVQATALVMKQGLASIVDRYPSVVSEIRGRGLLIGIKC
FT                   VVPNTSLIQALRDEHFLSVGAGDNVVRLLPPLVTTPEEAREALKRIETAVERLATANPI
FT                   SKTA"
FT   gene            421413..422351
FT                   /locus_tag="Oant_0395"
FT   CDS_pept        421413..422351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0395"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: bms:BR0302 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13126"
FT                   /db_xref="GOA:A6WVX2"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX2"
FT                   /protein_id="ABS13126.1"
FT                   /translation="MASDNGIKHFIDLSAVPASELRAIMEDAKARKARLKAGEIERPFA
FT                   GKVLAMIFEKPSTRTRVSFDVGMRQLGGETIMLTGSEMQLGRSETIADTAKVLSRYVDA
FT                   IMIRTTSHERMLELAEYATVPVINALTDDTHPCQIMADVLTYEEHRGPIKGKTFAWMGD
FT                   GNNVLHSLVEAAARFDFNVNIATPEGSEPKSQYVDWAKANGASIMSTIDPERAANGADC
FT                   IVTDTWVSMGQEDHARGHNVFMPYQVNARLMAKADPKALFMHCLPAHRGEEVTDEVIDG
FT                   PQSVVFDEAENRLHAQKAILAWCLQSRDLGA"
FT   gene            422353..423381
FT                   /locus_tag="Oant_0396"
FT   CDS_pept        422353..423381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0396"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: bmb:BruAb1_0329
FT                   chaperonin, 33 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13127"
FT                   /db_xref="GOA:A6WVX3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX3"
FT                   /protein_id="ABS13127.1"
FT                   /translation="MADKTSNEHTEVENIQVNLGDFDFAGDDAVVPFQVEGLDVRGRAV
FT                   QLGASIDGILKRHNYPEEVARLLAEATVLTVLLGTSLKFEGKFIFQTQSDGPVDMLVVD
FT                   FRTPRSVRAYARFDEERLKEAVAAHKTKPEELLGRGTLAFTVDQGAYTQRYQGIVALDG
FT                   STLEEIATTYFRQSEQIPTDLKLSVAKLVERGADGKPVEQWRAGGLIIQFLPESELRAR
FT                   IPDLPGGDEDEAEVAFHPEDDAWDEARSLVGTIESSELTDPQVGSERLLYRLFHERGVR
FT                   VFDSVPVLDECSCSRDKISGVLSGFTAEEIAESADNGKISVTCEFCSKRYEFDPAEFAP
FT                   KS"
FT   gene            complement(423458..423850)
FT                   /locus_tag="Oant_0397"
FT   CDS_pept        complement(423458..423850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0397"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: bmb:BruAb1_0330
FT                   ApaG protein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13128"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVX4"
FT                   /protein_id="ABS13128.1"
FT                   /translation="MYRAVTRGIEVSVEPFYLEDQSEPEENRYVWGYRITIANNSTETV
FT                   QLRSRYWQITDANGYVEEVRGPGVVGEQPTLEPGDSFQYSSGCPLTTTSGVMVGRYQMQ
FT                   GNGGSLFEVDIPAFSLDIPEQRRTLN"
FT   gene            complement(424109..425302)
FT                   /locus_tag="Oant_0398"
FT   CDS_pept        complement(424109..425302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0398"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.4.1.1"
FT                   /note="TIGRFAM: O-succinylhomoserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein;
FT                   KEGG: bmb:BruAb1_0331 MetZ, O-succinylhomoserine
FT                   sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13129"
FT                   /db_xref="GOA:A6WVX5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX5"
FT                   /protein_id="ABS13129.1"
FT                   /translation="MTTENTRKFRPATELVHAGSLRSGFAEMSEAMFLTQGFLYPNAEA
FT                   AEARFKGEDPGFIYSRYANPTTDMFEKRMCALEGAEEARATASGMAAVAAAILCQVQAG
FT                   DHVISARAVFGSCRYIVETILPKYGVEISIIDGSDIENWKAAVRPNTKVMFLESPSNPT
FT                   LEIIDIAAVAQVANEAGAKLIVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGG
FT                   VVLSDREWIENTLQDYFRHTGPGLSPFNAWIMLKGLETLAVRVRQQTLSATAVADFLAN
FT                   KPGVKRVIYPGRADHPQADIIAKQMTGGSTLIALELDGGKEAAFKFQNALQVFSISNNL
FT                   GDAKSLITHPATTTHKNLSDEAKAELAISDGLLRISVGLEDTDDLVEDVEEALKAAR"
FT   gene            425772..426863
FT                   /locus_tag="Oant_0399"
FT   CDS_pept        425772..426863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0399"
FT                   /product="2-deoxycytidine 5-triphosphate deaminase"
FT                   /note="PFAM: 2-deoxycytidine 5-triphosphate deaminase;
FT                   KEGG: bmb:BruAb1_0332 dCTP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13130"
FT                   /db_xref="GOA:A6WVX6"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX6"
FT                   /protein_id="ABS13130.1"
FT                   /translation="MMQKDAGILADADISALFESGLLASPRPLDPDQIQPASLDLRLGA
FT                   KAYRVRASFMPGPGTPVLEKLERLKLHEIDLTAGAVLETGCVYIVPLLEGLALSADLSA
FT                   SANPKSSTGRLDIFTRVIADGAQEFDKVPAGYNGPLYLEVSPRTFPIVVRTGSRLSQIR
FT                   FRKGRAQLDEAELAALHHAETLVAAEMPNISGGGIALSVDLSGGPDRLIGYRGKHHTAV
FT                   VDVDKRAAHDVLDFWEPIYDRGARELVLDPDEFYILVSREAVHVPPLYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHSAAGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYEHMLHRPS
FT                   ALYGVDLGSNYQAQQLKLSKHFR"
FT   gene            426918..427928
FT                   /locus_tag="Oant_0400"
FT   CDS_pept        426918..427928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0400"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bme:BMEI1615
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13131"
FT                   /db_xref="GOA:A6WVX7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX7"
FT                   /protein_id="ABS13131.1"
FT                   /translation="MTTGIERDQDGKLQATTDAPQRRLSVGIVALPGFTLSALSLFLDP
FT                   FRLAADDRDKSRQIRCAWKICTLSGDPVTSSSGMVIEPTAPMGELDDCDYVAVVGGLLA
FT                   QYRPRQQALIDIIKRADRRGKTVVGLCTAAFLLAEADLLPDRNCCVSWFHRDDFLELFD
FT                   GYTADTTSLFHRSGRHFTCAGGLGTASLALSIIQNEISEELARKSASILMIPYELVRSE
FT                   QPALSFNGVRSPMIRKAIRIFEETLEDPVPMIDVARRLGISVRQMERGFKLALERTAFE
FT                   VREELRVKKAKELLSETGLSLLEVAVASGFTDTRSMNRSFSRQKQKAPRDYRKQR"
FT   gene            428020..428286
FT                   /locus_tag="Oant_0401"
FT   CDS_pept        428020..428286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13132"
FT                   /db_xref="GOA:A6WVX8"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX8"
FT                   /protein_id="ABS13132.1"
FT                   /translation="MSDGVNRFLGDTPARVLIKLVLISLVVGVVMSAFHWTPYDIFYGI
FT                   RDFFLRLWNMGFSAISGFVDYLILGAAVVIPAFILLRILSYRK"
FT   gene            428321..428803
FT                   /locus_tag="Oant_0402"
FT   CDS_pept        428321..428803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0402"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: bmb:BruAb1_0335
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13133"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVX9"
FT                   /protein_id="ABS13133.1"
FT                   /translation="MQQKQGLTLNRRGFLVLAGGALAVSVVPLNMALAAGDNDPTPIFN
FT                   AIRKANGLPLMATDSKLEQAALYQARRMASYGKIGHSVGWGNGFVARLRQAGIRGPAAE
FT                   NVASGQRDTQAVFDAWMKSPGHRKNMLDPTFEHYGLAWATPENKPTYIYWAMMLGL"
FT   sig_peptide     428321..428425
FT                   /locus_tag="Oant_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.933 at
FT                   residue 35"
FT   gene            428931..430286
FT                   /locus_tag="Oant_0403"
FT   CDS_pept        428931..430286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0403"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: bmb:BruAb1_0336
FT                   DNA-damage-inducible protein F, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13134"
FT                   /db_xref="GOA:A6WVY0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY0"
FT                   /protein_id="ABS13134.1"
FT                   /translation="MDQSLQRVGGVTRPFDVTHRMVMLIAIPMTLAAITTPLLGLVDMG
FT                   VVGQMGQAELIGGLAIGALVFDFLLSMFNFLRSGTTGLVAQAVGAEDAVEEQAIFWRAI
FT                   IIAVVAGSLMILCLPIIIAVSSTFMHPTSATQEAMATYVSIRMLSAPVALINYSILGLV
FT                   LGRGQGLVGLGLQVLLNGINIVLCIILGLEMGWGVTGVAWATVTGETVAALVGMFIVLR
FT                   HFRKDASLRPNRARIFQKQGILRMFAVNRDIMIRSFLLLTAFAFFTRAGSDLGTVTLAA
FT                   NAVLLNFFLVAGFFLDGMAAAAEQIVGRSIGARYSPAFVRGAKLTFVWGLVMASIIAFF
FT                   LLVFGDAIIGLLSKAEDVHAEALKYLPWAALTGITGLLAFHMDGVYIGATWSRDMRNMM
FT                   FLSLALFMVVLYAAKPVMGNHGLWLALNLFLSIRGVTLLAILPRRYRTEFIA"
FT   gene            complement(430287..431381)
FT                   /locus_tag="Oant_0404"
FT   CDS_pept        complement(430287..431381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0404"
FT                   /product="Dihydroorotate oxidase"
FT                   /EC_number="1.3.98.1"
FT                   /note="PFAM: dihydroorotate dehydrogenase; KEGG: bms:BR0311
FT                   dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13135"
FT                   /db_xref="GOA:A6WVY1"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVY1"
FT                   /protein_id="ABS13135.1"
FT                   /translation="MSGLFETLGRRALFAFDAEQAHGLSIAGLKTGLVTCGAPNDPALS
FT                   VKVAGLQFPNPLGMAAGYDKNAEVPDALLKLGFGFTEIGTITPRPQSGNPRPRIFRLVE
FT                   DRAVINRLGFNNEGHDAAFKRLSQRAGKSGIVGVNIGANKDAEDRIADYVAGIRRFYQL
FT                   ARYFTVNISSPNTPGLRNLQARDSLRELLSRVLEARNEEGKMCTLKRPVFLKIAPDLAN
FT                   EELDDIAAEATEQKLDGIIISNTTLSRAGLKSAENRDETGGLSGAPLFDRSTIVLARMR
FT                   ERVGPDMPLIGVGGVDSAETALTKIKAGADLVQLYTGLIYRGPNLPAEIVRGLSAAVKR
FT                   EGVTNIAALRDRDTKDWARRELSA"
FT   gene            complement(431381..431731)
FT                   /locus_tag="Oant_0405"
FT   CDS_pept        complement(431381..431731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0405"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   bmb:BruAb1_0338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13136"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY2"
FT                   /protein_id="ABS13136.1"
FT                   /translation="MTNEIIYKIAPRDLWAQAEQAGSFTGAPVDIADGYIHFSTATQVR
FT                   ETAAKHFAGQQDLLLISVNASALGAALKFEVSRGGALFPHLYGELPLAAVLKVEPLPLG
FT                   DDGLHIFPELED"
FT   gene            431846..432304
FT                   /locus_tag="Oant_0406"
FT   CDS_pept        431846..432304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13137"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY3"
FT                   /protein_id="ABS13137.1"
FT                   /translation="MLNRKTLMVRNLAAVALLGSALAPSVAFAQENGRYRLEGTETGYV
FT                   RLDTRTGALSTCTEQQGQLVCKMATEDREAYENDIADLQDRLEKLEDKVSALEGKGGSA
FT                   ASGLPTEQEFEQSMSYMERFMRRFMDIAKSFDSEPESPNKETAPGGRT"
FT   sig_peptide     431846..431935
FT                   /locus_tag="Oant_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(432443..433393)
FT                   /locus_tag="Oant_0407"
FT   CDS_pept        complement(432443..433393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0407"
FT                   /product="proline iminopeptidase"
FT                   /note="TIGRFAM: proline iminopeptidase; PFAM: alpha/beta
FT                   hydrolase fold; KEGG: bmb:BruAb1_0340 Pip, proline
FT                   iminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13138"
FT                   /db_xref="GOA:A6WVY4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY4"
FT                   /protein_id="ABS13138.1"
FT                   /translation="MTRNTLYPEIQPFKEEMLQVSPLHRIHVEQCGNPDGKPVIMIHGG
FT                   PGGGITPTMRRLHDPERYRIILFDQRGCGRSTPHAELRENTTWDLVADMEHIRAHLGIE
FT                   KWQVFGGSWGSTLGLAYAQSHPDRVAELVLRGIFMIRRFEVDWMYSNGASILFPDHFEA
FT                   YQEHIPEAERGDMIAAYYKRLTDRDPQVQLEAARRWARWEGSVISLMPDPARVNAFGED
FT                   QYAIAFARIECHYFQNRGFLDSDDQLLRNVDRIRHIPGVIVHGRYDVCTPFINAWQLKK
FT                   MWPEADLRTVEDAGHAVTEPGITHELIEATKRFAQ"
FT   gene            433623..434267
FT                   /locus_tag="Oant_0408"
FT   CDS_pept        433623..434267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0408"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bmb:BruAb1_0341
FT                   DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13139"
FT                   /db_xref="GOA:A6WVY5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY5"
FT                   /protein_id="ABS13139.1"
FT                   /translation="MHFIIADDHPLFRGALRQVLSGQSQSVEIIEVGDFDAVKKLVGER
FT                   EDIDLLLLDLTMPGGTGLSGLVTLKALQPALPVIIVSATDDAATIRHAVELGASGFISK
FT                   SASMETIGEAVRAVLAGDIWTPADIELDHPHDPEIEALIARLRTLTPQQTRVLTMLAEG
FT                   LLNKQIAYELGVSEATVKAHVSAVLQKLGVDSRTQAVILLSRIGNDALSTD"
FT   gene            complement(434279..437794)
FT                   /locus_tag="Oant_0409"
FT   CDS_pept        complement(434279..437794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0409"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bms:BR0316 sensor histidine kinase/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13140"
FT                   /db_xref="GOA:A6WVY6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY6"
FT                   /protein_id="ABS13140.1"
FT                   /translation="MQGWGIIGAAFLYLLLLFAVASIGDRRTSRWNSAPRPYIYALSLA
FT                   VYCTSWTFFGSVGLSAQRGLEFLGIYIGPILVFTLGNRLLRHIVRLAKSEHITSIADFL
FT                   AARYGKSFGVASLATCIAAVGSIPYIALQLKAVSGSVGLVMEHYGSAVDPSVFIFGDIS
FT                   LPVAAVLAVFAILFGTRHTDATEHQNGLILAVALESVIKLCAFLTVGFACTFFLFGAPS
FT                   QLINQISQSPEALEAFHYQTSIGTWIVQSALSAAAIIMLPRQFHVTVVESRSEKELRTA
FT                   SWLFPLYLVLINIFVFPIALIGVMTLGGNVSGDLYVLALPLAAGAHWLALVAFLGGLSA
FT                   ATAMVIVACVALSIMISNHLVLPLFIRRLAKQHAAEQRDLTKVILNTRRLTIIGILAFA
FT                   FAYYRFTSNNIHLASIGFVSFAAIAQFVPAFIGGLFWRNANGRGAMLGLSAGFLVWAYT
FT                   LLLPTMAPENAAILRDGFLGFTALRPEALFGTNALPLTNGVMWSLAANTLFYILGSLSR
FT                   TSTPLERIQASIFLPRYFIGTPTLKRFRTTVTVAELKATMARYLGAERVERAFLRFEGR
FT                   EQRRLDPGMTVDTPLIRHAEQLLGTAVGSASARLVLSLLLQKSDASGRDARQLLDDAST
FT                   ALQQNRNLLQTALDQMEQGITVLDKDLRLTFWNRQFRKLFDLPDEVMQVGIPVSEIVEQ
FT                   LHSRGDISFNAQNGVIRSLAAVRQPWRIDMKSTGKVLEIQSNPMPDGGIVATYTDITAA
FT                   VEADVTRQKAAEMLEQRVADRTAELTRVNQQLAKAQTAAEEANQGKTRFLAAAGHDILQ
FT                   PLNAARLYSTALAEKLGRSETSEFARNIDSSLEAVEAILGMVLDISRLDTGSLKPDLSV
FT                   FHLDKLMSQIATDFTPLAAAKGLKLRVVPSSIVVKTDRNMLRRLIQNLVSNSIKYSRKG
FT                   GILLGVRRRGSFVELQVFDTGIGIPSQKLKLVFREFTRLDEGMREAEGLGLGLSIVDRI
FT                   ARLLSLPLSLSSTPDKGTMFTLRIPVSQEKVPADDVKSRRGLQKALELTGLDVLCIDND
FT                   ASILSGMETLLRGWGCHVTTLRSGAALKNYCADHSTPPDVIVADYHLLHENGLDMIGFA
FT                   RETFQVEIPAVLLTADRSKEVRQRAEDENVTVLHKPLRPAALRSLLSHFYHARQDNRSA
FT                   QNAAQ"
FT   sig_peptide     complement(437729..437794)
FT                   /locus_tag="Oant_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.572 at
FT                   residue 22"
FT   gene            438118..438531
FT                   /locus_tag="Oant_0410"
FT   CDS_pept        438118..438531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0410"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: bmb:BruAb1_0344 MscL, large conductance
FT                   mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13141"
FT                   /db_xref="GOA:A6WVY7"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WVY7"
FT                   /protein_id="ABS13141.1"
FT                   /translation="MLKEFKEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGL
FT                   ITGGIDFSNMFIQLAGEPRATLAAAREAGATIAYGNFVTLLINFLIIAWVLFLVVKGMN
FT                   RMKKKEEAKPEPEAPREEVLLTEIRDLLAKQKA"
FT   gene            438688..439854
FT                   /locus_tag="Oant_0411"
FT   CDS_pept        438688..439854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0411"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mlo:mlr5693 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13142"
FT                   /db_xref="GOA:A6WVY8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY8"
FT                   /protein_id="ABS13142.1"
FT                   /translation="MTLIANLRREAAQSPESGIVAVANHGRGREGLIPLWVGEGDLSTP
FT                   DFIRAAAQKGISEGETFYTWQAGIPELREALARYHARHFPLPLKPENFYVTGSGMHAIE
FT                   MALTATVGAGEEAIYLSPAWPNFVGAAGLAGAVPVPVELEFGANGWLLDPEKIAAAITP
FT                   RTKALFINTPSNPTGWTADRETLQFILDLARKHGLWIIADEIYTHFYYGGGRAPSFMDI
FT                   MEPDDRIIFVNSFSKNWAMTGWRVGWMTVHPSLGPIIENLIQYSNSGVAQFMQRGAVTA
FT                   LDEGDAFISMQVERARSTRDSLCAALLSTGKVRLTPPQGAFYLFFGVDGVGDSVKAAID
FT                   MVDNANVGLAPGSAFGLGGEGFFRLCFCRDPEQVDEAARRLVRWIEKL"
FT   gene            complement(439905..441182)
FT                   /locus_tag="Oant_0412"
FT   CDS_pept        complement(439905..441182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0412"
FT                   /product="5-aminolevulinic acid synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="TIGRFAM: 5-aminolevulinic acid synthase; PFAM:
FT                   aminotransferase class I and II; aminotransferase
FT                   class-III; KEGG: bmb:BruAb1_0345 HemA, 5-aminolevulinic
FT                   acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13143"
FT                   /db_xref="GOA:A6WVY9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVY9"
FT                   /protein_id="ABS13143.1"
FT                   /translation="MDYRRFFEEAIDQLHAEKRYRVFADLERIVGRFPRAIWRNNGTAR
FT                   EITVWCSNDYLGMGHHADVIKAMCDTAGNAGSGSGGTRNISGNNHPLVELETELADLHG
FT                   KEAGLVFTSGFVSNEASISTIARLLPNCLILSDELNHASMIEGVRRSGAEKKIFRHNDV
FT                   EHLEQLLKAADPARAKLIVFESVYSMDGDIAPIEKIADLADKYNAMTYIDEVHAVGMYG
FT                   ARGGGITERDGLAHRIDIIEGTLAKAFGALGGYITGSRAIVDAVRSYAPGFIFTTSLPP
FT                   AVAASATAAIRHLKNSQVERNGQQRQAQRAKDVLSAAGFPVMPSETHIVPILVGDPELC
FT                   KKASDRLLEVHGIYIQPINYPTVPRGTERLRITPSPLHDDALIDGLKDALLEVWNALGI
FT                   PYAEPTVSQPASSERIIPLMVSKAGG"
FT   gene            441450..442538
FT                   /locus_tag="Oant_0413"
FT   CDS_pept        441450..442538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc04209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13144"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ0"
FT                   /protein_id="ABS13144.1"
FT                   /translation="MKPTRTVMNYPASATGDWTAYWRASPMRHLRLRWRHVQLSVPHRK
FT                   KSANLIAASGSFEALRPGDLPLVCVVRNAAPYMKSFLRYYREMGVTRFIVVDDRSDDGT
FT                   TEILSSAPDVDLFTSDVGYAQADRGRVWRDALFNLYGRGRWYLSVDADEFFVFPRMEQR
FT                   DIRSFIEELEGNGIRRCLAPMIDMYPGGLLREGVFVDDGTKYPFEVSSHFDGDGYTATW
FT                   EKFGVAVRGGPRLRLFGRSMRLSKFPLIWVDEKTDYRRGSIHGPGPCFRNFLPATGALL
FT                   HYRFSSLSVGEFKRIASEKSHAGGAEHYRAIVENERFSDDLSLVYEGSVQYTGPDCLVR
FT                   RGFMADLHDIERGAKPRSRLSA"
FT   gene            complement(442528..443229)
FT                   /locus_tag="Oant_0414"
FT   CDS_pept        complement(442528..443229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0414"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bmb:BruAb1_0346 polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13145"
FT                   /db_xref="GOA:A6WVZ1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ1"
FT                   /protein_id="ABS13145.1"
FT                   /translation="MPVPIFLYHQIDVPPQHRTPYRSMIVHPDRFCQQMAWLKRLGYRG
FT                   LSVRDAIPYIYGGKQGKVAVITFDDGFENVFRNALPVLQEFGFTATNYFVANQIGGFNL
FT                   WDQKIGVARANCMSVSELREWADLGHEVGSHTLDHALLPEISEQEAITQIQQSRMKIED
FT                   LLGHEVTSFAYPYGGENAVIRKIVEAAGYTNATTTEKRRARSNDDPFGIPRLTIRRNDI
FT                   LLQFLRKTFTR"
FT   gene            complement(443238..444005)
FT                   /locus_tag="Oant_0415"
FT   CDS_pept        complement(443238..444005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0415"
FT                   /product="glycosyl transferase family 25"
FT                   /note="PFAM: glycosyl transferase family 25; KEGG:
FT                   bms:BR0321 glycosyl transferase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13146"
FT                   /db_xref="GOA:A6WVZ2"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ2"
FT                   /protein_id="ABS13146.1"
FT                   /translation="MNETRPDITANDGPQRAVKAFIIHLERATDRQPQVEELVRRLPVE
FT                   TDVVNAVDGRTLDAQTISRVYRRSAHKPRYPFQLSTNEIACFLSHRKAWQAIVDQELDA
FT                   GLVLEDDVELTPEFAAAYSAACQILKADSFIRFPFRERESGRVVLNTETLRIIEPVPVG
FT                   LGMVAQLVGREAAQRLLSATEVFDRPVDTTAQMNWVTGLKPLSVLPGGVKEISVQLGGS
FT                   TIQKSRSLPDKLKREILRPLYRWKIKSRSRAAI"
FT   gene            complement(444055..444756)
FT                   /locus_tag="Oant_0416"
FT   CDS_pept        complement(444055..444756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_2115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13147"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ3"
FT                   /protein_id="ABS13147.1"
FT                   /translation="MSEPLRIFIGWDSREPIAYEVAKASALKHSSIPLEIVPIKLQDLV
FT                   DRGVYTREVDPLASTEFTYSRFFTPWLAGYKGWALFCDCDFLFLGDIAGLQAYNDPSKA
FT                   VYCVQHDYQPKDSVKMDGKVQTSYPRKNWSSCMLFNCEHPSTRQLTPELINSETGAYLH
FT                   RMQWAADDEIGALPTDYNWLEGWNEKPETGLPKVVHYTRGGPWFKDWQNVDYADLWRAE
FT                   ADSVEPGWKPV"
FT   gene            complement(444834..445448)
FT                   /locus_tag="Oant_0417"
FT   CDS_pept        complement(444834..445448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13148"
FT                   /db_xref="GOA:A6WVZ4"
FT                   /db_xref="InterPro:IPR001675"
FT                   /db_xref="InterPro:IPR038578"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ4"
FT                   /protein_id="ABS13148.1"
FT                   /translation="MKKTLIIVGNAPLPRDLSAEVDAADFVVRFNEPKKSIGMSGTRTD
FT                   LLMLATSSKPMQRRLRDPGFVQTPTFKAAKEVMLAYHPSIIRKYHPGPNFLSRLKGRRG
FT                   DWTMQTIEVVGSAGKEIRIMPPQFYLAGCKELGVTDENISKAFPSTGFFGIWYMLGKCP
FT                   EESWDVKICGFTWEGWKRHTWGDERSWVEQKVKSGRISLIQ"
FT   gene            445606..445833
FT                   /locus_tag="Oant_0418"
FT   CDS_pept        445606..445833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0418"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   mlo:msr1062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13149"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ5"
FT                   /protein_id="ABS13149.1"
FT                   /translation="MQDMHFSKDRERRKLTIGRKIKKGDTTMNLRTHFHRWMQYRENIR
FT                   ELSGCTDRELSDLGLSRTDIHRVAREAAFA"
FT   gene            complement(445903..446088)
FT                   /locus_tag="Oant_0419"
FT   CDS_pept        complement(445903..446088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13150"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ6"
FT                   /protein_id="ABS13150.1"
FT                   /translation="MEGQVIFYKDDRILYRHHIDVQEDDYSKGVNDALIAFQRNYAGFD
FT                   LAGDNIHIRFKKPGDV"
FT   gene            complement(446263..447153)
FT                   /locus_tag="Oant_0420"
FT   CDS_pept        complement(446263..447153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0420"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bms:BR0324 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13151"
FT                   /db_xref="GOA:A6WVZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ7"
FT                   /protein_id="ABS13151.1"
FT                   /translation="MNLRSFQAFVEVVRQGGFSAAAKTINATQSTVSKAVRQLEDELGL
FT                   VLLDREISPSRLTTAGEIVFRRAVAMLAEKDDMLAELGELRGLKRGLLKLGLPPIGSSV
FT                   LFAPVFAAYTKLYPEIDIQLVEHGSRRLEELLLAGDVELAASLLPVEDSFEWQDVRCEP
FT                   VVALLSTDHALARGDGVSLQDIASLPFILFESGFALNHIILDACRSHGFSPNVAVRSSQ
FT                   IDFIVELVAAGMGIGFLPKMIAEQRHHPGVLIHRIKGADVNWNLALIWRKGAFLSHAAR
FT                   AWLELSKAGTGTASS"
FT   gene            447262..447669
FT                   /locus_tag="Oant_0421"
FT   CDS_pept        447262..447669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0421"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: bmb:BruAb1_0351
FT                   holin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13152"
FT                   /db_xref="GOA:A6WVZ8"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ8"
FT                   /protein_id="ABS13152.1"
FT                   /translation="MNAHSLLIRFRYALHHSRLMQIATLVGFWLAGELFVRLVGLPLPG
FT                   GIVGMALVLALLLSGRVSLFSMKRGAEWFLAEMLLFFVPAVLAILEHKELLGLLGLKIM
FT                   AVILLGTLTVMSVTALTVDLCYRWSLRYVAK"
FT   gene            447656..448351
FT                   /locus_tag="Oant_0422"
FT   CDS_pept        447656..448351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0422"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: bme:BMEI1596 LrgB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13153"
FT                   /db_xref="GOA:A6WVZ9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A6WVZ9"
FT                   /protein_id="ABS13153.1"
FT                   /translation="MSLSNPLVATLFWSAATILLYLAAKRVYRRFPMWWLTPLVVTPLL
FT                   LIALVIGLNQNYRGYFGATHWLVALLGPATVAFAVPIYQQRATIRRYWPVLLAGVVVGS
FT                   SSAMASAWGLAHLLGLNEAISLSLMPRSMSTPFAMTVSGDIGGAPDLTAIFVVLTGVFG
FT                   AALGEVMLNWLPIRSALARGALFGMGAHGAGVAKAHQIGSEEGSIAGLVMVLVGLVNVL
FT                   AAPLIAHFL"
FT   sig_peptide     447656..447727
FT                   /locus_tag="Oant_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.460 at
FT                   residue 24"
FT   gene            448748..450301
FT                   /locus_tag="Oant_0423"
FT   CDS_pept        448748..450301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0423"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: phospholipase/Carboxylesterase;
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase; KEGG:
FT                   pde:Pden_0331 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13154"
FT                   /db_xref="GOA:A6WW00"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW00"
FT                   /protein_id="ABS13154.1"
FT                   /translation="MTSGIHHITLITRKVQANVDFYAGFLGLRIVKQTGGFEDAEQLHL
FT                   FYGDRSATPGSLITFLVWEDGAKGRVGHGQVSEIALAIDRTAIGFWLERALRYHVPSEG
FT                   PVQEFGEPVLRLRDPDGVIVKLVGCDLAANDAWESEGIPPAFAVRRLRAATILSEAPEQ
FT                   TAGFIERYFDFRPSAKEGTIDRLLSDSGDAIDVRDAGGFWPGIPGTGIADHVAFRAADT
FT                   GDVEKAEKELSKLNSSAVNVHDRKYFTSLYVREPGGTLFEFATDAPGFAIDESVEKLGQ
FT                   FLFVPPGNEEKADAIRARMPQFALPGEERVIYRDLPFVHRIHQPEDPDGSTLVLLHGTG
FT                   GNENDLMPFARKAAPHATLLGVRGRSTEEGIQRWFRRFDLKKFDQADIQFEAQAFEAFV
FT                   EGAAAAYGIDLNRTAFIGNSNGANLLAAFMRLHPHVVRTAVLLRGQEVLEEQPDGADLS
FT                   DASVLLMNGASDPFGDETGTLEKVLRDDGAALTISTVEAGHALIDEDILIVSDWLRDKI
FT                   "
FT   gene            complement(450342..451295)
FT                   /locus_tag="Oant_0424"
FT   CDS_pept        complement(450342..451295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0424"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mlo:mll3759 similar to ABC
FT                   transporter (binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13155"
FT                   /db_xref="GOA:A6WW01"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW01"
FT                   /protein_id="ABS13155.1"
FT                   /translation="MALELTGLHHLTAITADAPGNRRFYTDTLGLRLVKKTVNQDDTSA
FT                   YHLFYADGLASPGTDITFFDWPVQREQRGTNSVARTGLRVNGVESLDWWRKHLNDKGVQ
FT                   TGDIFEVAGRAVLDIEDPEGQRLRLTDDGGAGEAHSWDRSPVPAERQIRGLGPITLSVP
FT                   ELAPTQIILEKVMNMRQTGDYASPDGEGHVHVFSMGPGGAAAELHVAVQPNLPTAWQGA
FT                   GAVHHVAFRTPDQESMQEWVDRLRSVRMPSSGEVERYYFRSLYFREPNGILFEIATDGP
FT                   GFAVDEPLESLGESLSLPPFLEGKREAIERNLKSLD"
FT   gene            451630..452880
FT                   /locus_tag="Oant_0425"
FT   CDS_pept        451630..452880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0425"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900 hydrolase
FT                   family protein; KEGG: bms:BR0328 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13156"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW02"
FT                   /protein_id="ABS13156.1"
FT                   /translation="MRRVFSRTAPALLVLLSVLAGCASRPEGVLIPVGDVASPGTTKVN
FT                   LVVATTRRPSDNPGILFSGERDKLVSLNEIVVSIPPEKNRKAGEVQWPKKLPPNPQKDF
FT                   TTVSVTPVKTDVEMAGWVRPHLTKSRRVMVFVHGFNNTFEDSVYRFAQIVHDSGADVAP
FT                   VIFTWPSRASVFDYNYDKESTNYSRDALEQILRAIAREPEVKDITVMAHSMGSWLTVEA
FT                   LRQMAIRDGRVNAKITDVILASPDLDVDVFSKQFLAMGKQHPRFTLFTSRDDKALALSR
FT                   RISGNIDRLGQIDPSIEPYRSELEKAGITVIDLTQLKAGDRLNHGKFAASPEVVQLIGQ
FT                   RLVAGQTITDSQVGLGDRLGAVAMGTAQGVGTAASLVVTAPIAVFDPNTRKTYDEQIDR
FT                   FGRAVGNTVGAVTTPTQ"
FT   sig_peptide     451630..451701
FT                   /locus_tag="Oant_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.645 at
FT                   residue 24"
FT   gene            452976..453845
FT                   /locus_tag="Oant_0426"
FT   CDS_pept        452976..453845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0426"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase; KEGG: bms:BR0329
FT                   pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13157"
FT                   /db_xref="GOA:A6WW03"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW03"
FT                   /protein_id="ABS13157.1"
FT                   /translation="MQIIRTIEELRQILAPARRAGKRIGFVPTMGYLHKGHLELVHRSR
FT                   AENDVTVVSIFVNPLQFGANEDLDKYPRDLERDAALLHRADVDYLFAPAVSDMYPQPMQ
FT                   TVVDVPTLGNQMEGEARPGHFAGVATVVNKLFNIVGADAAYFGEKDFQQLVIIRRMVED
FT                   MAIPVRVVGVETVREEDGLACSSRNVYLSPEQRAAAIIVPKALDEAERLYRSGVDDPDA
FT                   LEAAIRTFIATEPLATPEVVALRDPETLERLTAVQGRPVLVALFVRLGTTRLLDNRVIA
FT                   HVAQEQAA"
FT   gene            453820..454674
FT                   /locus_tag="Oant_0427"
FT   CDS_pept        453820..454674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0427"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase; KEGG: bme:BMEI1592
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13158"
FT                   /db_xref="GOA:A6WW04"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW04"
FT                   /protein_id="ABS13158.1"
FT                   /translation="MSRRNRRPEMSASVKQKRLTPKAISALKGERPIVSLTAYTTPIAR
FT                   LLDPHCDLLLVGDSLGMVLYGMDSTLAVTLDMMIVHGQAVMRGAETACVIVDMPFGSYQ
FT                   ESKEQAFRNAARVMQETGCDGVKLEGGEEMAETVAFLVKRGIPVFGHVGLMPQQVNTVG
FT                   GFRSLGRGDEEADRIRRDAQAIADAGAFALVIEGTVEPLAREITASLAIPTVGIGASAA
FT                   CDGQILVSDDMLGLFQDFTPRFVKRFAQLAPQISDAAKAYAEEVQARAFPGPEHVFGAK
FT                   PKG"
FT   gene            454734..455684
FT                   /locus_tag="Oant_0428"
FT   CDS_pept        454734..455684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:pRL110618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13159"
FT                   /db_xref="GOA:A6WW05"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW05"
FT                   /protein_id="ABS13159.1"
FT                   /translation="MSELFSGVAVTDDIAHTELIAVLTAVTSEQPRVMTVRQGQALPSG
FT                   PFESEHRSLQSGLRAWVQSETAHPVGYLEQLYTFADRDRHAQGERIISISYLGLVRESD
FT                   AAAGQAGWRGWYDYLPWEDHRQGEPAIMEHLNNALLVWAYRAETPELTAQRMRRIAFTF
FT                   GFESGEWSGRWNEDLVLQRYELLFEAGLVAEAGMKEDENGRSMFADHRRILATAIARLR
FT                   AKIKYRPVVFELMPDSFTLLQLQRTVEALAGLRLHKQNFRRLIEQQDLVEETGESDSET
FT                   GGRPAKLFRFRYSIVEERALSERHLAGAKLPISRD"
FT   gene            455765..456736
FT                   /locus_tag="Oant_0429"
FT   CDS_pept        455765..456736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0429"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: ret:RHE_PE00441
FT                   quinolinate synthetase A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13160"
FT                   /db_xref="GOA:A6WW06"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW06"
FT                   /protein_id="ABS13160.1"
FT                   /translation="MNDHVSVSQLYDRVAKVLPKAEWLGFEDDVAAILELKKKRNAVIL
FT                   AHNYQTPEIFHCVADIVGDSLALARKAAEVDADVIVLAGVHFMAETAKLLNPDKTVLIP
FT                   DMAAGCSLADSITPEDVALLREAHPGVPIITYVNTSAAVKAASDICCTSGNAKKVVESL
FT                   GVPRVLMIPDEFLAQNVARETDVEILAWHGHCEVHERFTPDDIRELRESHPGVVVLAHP
FT                   ECPPDVVEAADFAGSTAVMSDYVGEKKPQRVVLLTECSMSDNVAVDHPDVEFIRPCNLC
FT                   PHMKRITLANIRDALENNRHEVTVEAALMEPARRAVERMLAV"
FT   gene            456733..458241
FT                   /locus_tag="Oant_0430"
FT   CDS_pept        456733..458241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0430"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="TIGRFAM: L-aspartate oxidase; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ret:RHE_PE00440 L-aspartate oxidase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13161"
FT                   /db_xref="GOA:A6WW07"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW07"
FT                   /protein_id="ABS13161.1"
FT                   /translation="MTTTPVLVIGSGLAGLMTALTLSPQPVLLVTAGSLGLSGSSMLAQ
FT                   GGIAASVGADDSAALHLADTIAAGDGLCDRGVAAEIVAAGAEVIAALEAHGVHFDRKAD
FT                   GVFSLGLEAAHSRHRIVHVDGDSTGAGIMRALTAKVLATPSITVLENTRALRLIKQDGR
FT                   VVGACLENLGPVAATAVVLATGGIGGLYNATTTPLGNLGQGAALAGRAGAVLADMEFVQ
FT                   FHPTALGVSAPRLPLVSEAVRGEGAHLVNDRGERFMADIPGRELAPRDVVARAIGSEIA
FT                   QGRKVYLDARAALGARFATRFPGIDALCKQHGIDPSGDLIPVRPATHYHMGGIRTDADG
FT                   RSSLPGLWAVGEAACTGLHGANRLASNSLLEAAAMGLRAARALSNEDAVDARHPVPFSL
FT                   PQSADPEPVRRIVSSHLGLLRDEEGVRFAITTLLPLAETDDAAAVALAVAVAAFERCES
FT                   RGGHTRTDHPHKDAVAKRRFHTFKTAFALAREIVETNRISRIAS"
FT   sig_peptide     456733..456822
FT                   /locus_tag="Oant_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.522 at
FT                   residue 30"
FT   gene            458238..459095
FT                   /locus_tag="Oant_0431"
FT   CDS_pept        458238..459095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0431"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   ret:RHE_PE00439 nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13162"
FT                   /db_xref="GOA:A6WW08"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW08"
FT                   /protein_id="ABS13162.1"
FT                   /translation="MNLPRLSPLVVEPLVRAALLEDLGLAGDITSNAVVPEDHRSAMLF
FT                   SLRQPGVIAGLDVAEMAFRLVDPDVTFERMARDGQSLEKGADVARVSGSSRSILAGERT
FT                   ALNFLGHLSGIATATTNLVKAVAGTKASIVCTRKTTPGLRALQKYAVRAGGGMNHRFAL
FT                   YDAVLIKDNHIAVAGGVREAIERAKAGAGHMVKIEVEVDTLRQLEEAMAIGVDAVLLDN
FT                   MSPAQLREAVSIIDGRAISEASGGITPETVAAVAASGVDLISVGWTTHSAPNLDIGLDF
FT                   ELNR"
FT   gene            459766..460479
FT                   /locus_tag="Oant_0432"
FT   CDS_pept        459766..460479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0432"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mlo:mlr2543
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13163"
FT                   /db_xref="GOA:A6WW09"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW09"
FT                   /protein_id="ABS13163.1"
FT                   /translation="MRRCIGWKIGSFDQISLILTGRRSGINWQRPEVLEIDLPSTAIKP
FT                   KPRTKPAEIRRDELMAAAEALFLEKGFAATSVDEIVRLADVAKGTFYLHFRSKDDILLA
FT                   LRERFVDGFCARLERQLGLLPADDWQGKLAAWAETGIAGYLDNYKLHDMVFHDFHPPMR
FT                   RMKQENPAIVRLDALLTDGNAAGVWKIADTRLTAVLLFNALHGAVDEIISNPDMMDRAE
FT                   MVAGVKTFFLQAVRS"
FT   gene            complement(460549..461325)
FT                   /locus_tag="Oant_0433"
FT   CDS_pept        complement(460549..461325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0433"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   bmb:BruAb1_0357 Fpr, ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13164"
FT                   /db_xref="GOA:A6WW10"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW10"
FT                   /protein_id="ABS13164.1"
FT                   /translation="MSSNFNQETVTDIHHWTDTLFSFRTTRDPGFRFQSGQFIMMGLEV
FT                   NGKPLTRAYSIASSLYEDGLEFFSIKVPNGPLTSKLQHLKVGDQIILSKKPVGTLLYDN
FT                   LKPGKNLWLLSTGTGLAPFLSIIRDLEAYERFEKIILVHGVRQVAELAYTDFIANELPQ
FT                   DEFLGEMVKNQLIYYPTVTREPYKNRGRLTDLIRSGQLFTDIGLPEFNHDDDRMMLCGS
FT                   PEMLAETKQILEERGFKEGSQSEAGHYVIEKAFVEK"
FT   gene            complement(461501..462151)
FT                   /locus_tag="Oant_0434"
FT   CDS_pept        complement(461501..462151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0434"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   gox:GOX1800 superoxide dismutase [Fe]"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13165"
FT                   /db_xref="GOA:A6WW11"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW11"
FT                   /protein_id="ABS13165.1"
FT                   /translation="MLNGDYAQAIRSFKMSFTLPPLPFATNALEGVGMGTETLELHHGK
FT                   HHQAYVTALNGFVEKNDALKGKSLEEIVLFAKDKADLAPVFNNAGQHWNHDLFWQNLSA
FT                   TGGRLPGALEKKIVEDFGSVDQFKEAFKAAAVGQFGSGWAWLVLANDGKLKVTKTPNGS
FT                   NPLATGEGKALLGLDVWEHSYYLDFRNRRPDYVTNFLDKLANYEFAEATLKAA"
FT   gene            462359..462958
FT                   /locus_tag="Oant_0435"
FT   CDS_pept        462359..462958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0435"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: bpm:BURPS1710b_A0077 predicted transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13166"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW12"
FT                   /protein_id="ABS13166.1"
FT                   /translation="MLSLKMRGAQTAATIGEHLGTTGEAVRQQLVRLAEEGLVSSHSVS
FT                   QGVGRPSLFWDLTEAGNKRFPDTHADLTVQLLHSVRTILGDDALDTLIAHRETETRRQY
FT                   QTRLKDLSLDQRVKELADIRSAEGYMADAEKRDDGSWLLIENHCPICAAADACQGFCRS
FT                   ELQVFRAVLGPDVSVNRTEHILAGARRCAYVIAPTA"
FT   gene            complement(462975..464399)
FT                   /locus_tag="Oant_0436"
FT   CDS_pept        complement(462975..464399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0436"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bte:BTH_II1278 major facilitator superfamily protein
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13167"
FT                   /db_xref="GOA:A6WW13"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW13"
FT                   /protein_id="ABS13167.1"
FT                   /translation="MQDQKPTAGWGDLFAGRNAIVSLTLVGGVALHAINVFIATTILPT
FT                   VVADIGGMDYYAWNTALFVTASILGSALVPRLLSQAGPRSAYLIAAVIFAAGTLTCGLA
FT                   PSMPVMLAGRAIQGLGGGMMLALSYSMIRIVFDEALWPRAIGLVSGMWGVATLVGPAIG
FT                   GVFAELGIWRAAFWSLAPVIAVFTIMAMTVLPRESGSAASNDQLAWPQLILLTAAVLAV
FT                   SAGSISSELAFNAGGVALAIILLLLLAAVEKKASRRILPKGSFSIQKLGALYLTLAFLS
FT                   ASVTSSEVFVPLFFQVLHNQSPLVAGYLAAIMGGSWTLGSIGSSGVAAGRTDRVILAAP
FT                   VMGVAGMVTLAVLIPAGSEGHWYDLLPICIALAVIGFGVGLTWPHLLTRIFKRADAEDQ
FT                   NLASASVTMVQLFTTALGAALAGMVANMAGLTNPGGFTGTAHAALWLFSGFAILSALAF
FT                   VSALALVRSARQPQPA"
FT   gene            464891..466060
FT                   /locus_tag="Oant_0437"
FT   CDS_pept        464891..466060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0437"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="TIGRFAM: carboxynorspermidine decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: bmb:BruAb1_0360 NspC,
FT                   carboxynorspermidine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13168"
FT                   /db_xref="GOA:A6WW14"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW14"
FT                   /protein_id="ABS13168.1"
FT                   /translation="MFPQLGKPALLARPDFPFGRPGTLMIQTPYYLIDKTKLKRNMEKV
FT                   AYVREKSGAKALLALKCFATWSVFDLMSEYMDGTTSSSLNEVRLGHERFGGETHAYSVA
FT                   YADNEIDEVISHADKIIFNSIGQLERFADKAAHIKRGLRLNPGVSSSTFDLADPARPFS
FT                   RLGEWDVAKVEKVMDRVTGFMIHNNCENSDFGLFDKMLTDIEEKFGSLLHRVEWVSLGG
FT                   GIHFTGDDYPVDDFCARLKAFSEKFGVQVYLEPGEASITKTTTLEVTVLDTLYNGKNLA
FT                   IVDSSIEAHMLDLLIYREKAKMAPNNGEHSYMVCGKSCLAGDIFGEFTFDKELSIGDRL
FT                   SFEDAAGYTMVKKNWFNGVKMPAIAVRELDGTVKIVREFDYADFEGSLS"
FT   gene            466139..467419
FT                   /locus_tag="Oant_0438"
FT   CDS_pept        466139..467419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0438"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   bmb:BruAb1_0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13169"
FT                   /db_xref="GOA:A6WW15"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW15"
FT                   /protein_id="ABS13169.1"
FT                   /translation="MAGNRWKRKHRQKMKKNVLIIGAGGVAQVVAHKCAQNSDILGDIH
FT                   IASRTVEKCRKIIDSVHEKKSLKTEVKLEAHALDALDIEATKALIQKTGVQIVINVGSA
FT                   FLNMSVLRACIDTGVAYMDTAIHEDPKKICETPPWYGNYEWKHLKECEEKGITAILGIG
FT                   FDPGVVNAYARLAADDYLDEVKSIDIVDINAGSHGRWFSTNFDPEINFREFTGTVYSWQ
FT                   GGQWQSNKMFEVGHTFDLPVVGPSKAYMTGHDEVHSLSKNYPNADVRFWMGFGDHYINV
FT                   FTVLNNLGLLSEQPVKTAEGLEVVPLKVVKAVLPDPSSLAPDYTGKTCIGDFVKGTKDG
FT                   KEKEVFIYNVADHKDAYNEVGSQGISYTAGVPPVAAAILIASGEWDVKKMVNVEELNPK
FT                   PFLHILNQIGLPSRIKDEDGDRALDFA"
FT   sig_peptide     466139..466240
FT                   /locus_tag="Oant_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.626 at
FT                   residue 34"
FT   gene            complement(467499..468530)
FT                   /locus_tag="Oant_0439"
FT   CDS_pept        complement(467499..468530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0439"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: bmb:BruAb1_0363
FT                   hypothetical proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13170"
FT                   /db_xref="GOA:A6WW16"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="PDB:4K8L"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW16"
FT                   /protein_id="ABS13170.1"
FT                   /translation="MRSTKVIHIVGCHAEGEVGDVIVGGVAPPPGKTVWEQSRFIASDE
FT                   TLRNFVLNEPRGGVFRHVNLLVPPKDPRAQMGFIIMEPADTPPMSGSNSICVSTVLLDS
FT                   GIIPMQEPVTRMVLEAPGGLIEVEAECRNGKAERISVRNVPSFADRLNASLEVEGLGTI
FT                   TVDTAYGGDSFVIVDAASIGMKIEPGQARELAEIGVKITKAANEQLGFRHPEKDWNHIS
FT                   FCQITEPVTRDGDILTGVNTVAIRPAKLDRSPTGTGCSARMAVLHAKGQMKVGERFIGK
FT                   SVLGTEFHCRLDKTLELGGKPAISPIISGRAWVTGTSQLMLDPSDPFPSGYRLSDTWPN
FT                   MPE"
FT   gene            468983..470395
FT                   /locus_tag="Oant_0440"
FT   CDS_pept        468983..470395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0440"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: bms:BR0339
FT                   multidrug resistance protein NorM, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13171"
FT                   /db_xref="GOA:A6WW17"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW17"
FT                   /protein_id="ABS13171.1"
FT                   /translation="MDRTIDAGFREPHESGTQRWSREMAAALKLGWPLIFTNLSQAALT
FT                   ATDVIFIGRLGADTLASALLATSFYHTLMIFSMGLVSAVMPMIAIALGKNRHSVRDVRR
FT                   TVRQGLWTVIMISIPVWIVLWHCEEIFLFLGQRPDIAARSTDFMHTLQWALLPYLGYIV
FT                   LRSFFAAMEKPMWTLLIAALAIGFNALAGWTLIFGHFGFPRMELHGAGIATTASSTMMF
FT                   LGLAFITVRHHRFRRYHLFGRFWRPDWARLRELWRIGIPMALTFVFETSIFYAAVVMMG
FT                   RIGPTAMAAHAVAIQIASLSFMVPLGFGQVATVRVGRAYGRGDPQAVAYAGWSAYALGV
FT                   GFMAVMGLLMVLIPRVFIGVFLDLHDPQNLPVMELAVTFLALAALFQIVDGAQAVAAGM
FT                   LRGLRDTRIPMFLALFGYWGVGLPLGALLAFQFELGGVGIWLGLAAGLGIVSVLMTLRW
FT                   RRHLAHISAHPA"
FT   gene            complement(470454..470972)
FT                   /locus_tag="Oant_0441"
FT   CDS_pept        complement(470454..470972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0441"
FT                   /product="Invasion associated locus B family protein"
FT                   /note="PFAM: Invasion associated locus B family protein;
FT                   KEGG: bmb:BruAb1_0366 invasion protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13172"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW18"
FT                   /protein_id="ABS13172.1"
FT                   /translation="MKSYRVIGLAFTLATISGASAFAAPLPGGASTLQETYQDWTVSCQ
FT                   SQKETSICVMRQDQSSTQTGQRVLTAELRNVEGKVEGVLLMPFGLDLAKGAALKIDEVA
FT                   GPNLAFSTCLPQGCLAPVSFEAKQVAALKAGTNINVTTTALSPSQPVAFKVSLKGFGAA
FT                   LDRITALTK"
FT   sig_peptide     complement(470901..470972)
FT                   /locus_tag="Oant_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            471163..472620
FT                   /locus_tag="Oant_0442"
FT   CDS_pept        471163..472620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0442"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   Cache type 2 domain protein; KEGG: bmf:BAB1_0369 gliadin,
FT                   alpha/beta:ATP-binding region, ATPase-like:bacterial sensor
FT                   protein, C-terminal:histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13173"
FT                   /db_xref="GOA:A6WW19"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017171"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW19"
FT                   /protein_id="ABS13173.1"
FT                   /translation="MSPFPHQAGTLKSPWKSRLVVPGGEVVTLRYQIVALAIVPLIVAI
FT                   LTVTAFITWQSANLVQSSIATFEKNMLKAKETELLNLTNLALSSIQQIYDDAGPDDTAA
FT                   MEKVRKILTSLDYGRDGYFFVYDYDGNNVVHPRQTFRPGHNWLDLVDPDGDRVIANLID
FT                   KAKEGGGLHQYKWEKPSSGEMADKLSFAVGLSKWKWMLGTGVYLDDVYVQTAAANADFR
FT                   ANIRTTFLIVSLIAVPAVMLVFATCMLLNLRERRMADNKLKELAQRIIDTQEEERARLA
FT                   RELHDGISQNLVGVRYAIDLASRQVRMDSGGAPLAIEKASDALNGAIKEVRRLSHDLRP
FT                   RILDDLGLTVALKALCEHFSERTGIETQLEASGLNETLKPEASTALYRVVQEALTNVER
FT                   HSGASQVSIRLWGSGGKVTMTVADDGNGFTARDLKDQLSGLGLRNMQERMAHFGGVLLV
FT                   ETGADGTQLTARLPKSATERKREPEVA"
FT   gene            472617..473258
FT                   /locus_tag="Oant_0443"
FT   CDS_pept        472617..473258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0443"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bms:BR0342
FT                   DNA-binding response regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13174"
FT                   /db_xref="GOA:A6WW20"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW20"
FT                   /protein_id="ABS13174.1"
FT                   /translation="MTNECKIRVLLVDNHPLVLDGLRAVLETYDDIDIAGAASNARAAL
FT                   ELALTVNPDVVLMDINMPLLNGIDAIELFKKQLPGIRILMLSMHDSREYISTSIMRGAS
FT                   GYVLKDVSTTEIVAAIHAVASGGTYFSSGVSEALLDSGDRKSEGLSVRENDVLVLVAEG
FT                   GSNREIAIRLGISEATVETHRKNIKKKLGIASTAGLTRYVIENRLRLSSQ"
FT   gene            473424..473972
FT                   /locus_tag="Oant_0444"
FT   CDS_pept        473424..473972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0444"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: bms:BR0343 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13175"
FT                   /db_xref="GOA:A6WW21"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW21"
FT                   /protein_id="ABS13175.1"
FT                   /translation="MSVLLALSRAIDAANNFIGKSVSWLILVAVLISAINAVSRKLFNV
FT                   SSNAWLEAQWYLFSAVFLIAAGYTLLHSEHVKVDLLYSRYSRRTQLLVEIFGTIFFLLP
FT                   FCLITIYLSWPIVEAKIASGETSNNTGGLVLWPVWVLIPIGFGLLALQGISELIKRIAI
FT                   LQGRIPDTVALEDAEAQTL"
FT   gene            473984..475552
FT                   /locus_tag="Oant_0445"
FT   CDS_pept        473984..475552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0445"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: bmb:BruAb1_0370 TRAP
FT                   dicarboxylate transporter, DctM subunit, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13176"
FT                   /db_xref="GOA:A6WW22"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW22"
FT                   /protein_id="ABS13176.1"
FT                   /translation="MIAFIAENLAPLMFLSLVVVLLLGYPVAFALAFVGFAFGFVGIEM
FT                   GLLPVNLFGAIPDRIFGQMSNETLLAIPFFTFMGLILERSGMAEELLDTIGQLFGPVRG
FT                   GLAFAVIIVGALLAATTGVVAASVISMGLISLPIMLRYGYDRKVASGTIAASGTLAQII
FT                   PPSLVLIVLADQLGRSVGDMYKGALVPGLLLVGFYCAFIIGMSIFRPDTVPALPPHART
FT                   LKGWKLAQKVVISLVPPLVLIFLVLGTIFIGVATPTEGGAMGAVGALLLAIINRRLNMT
FT                   MLTSALYATAKLSSFVIFILLGARVFSLTFYGVNGHIWVEHLMTSIPGGEVGFLIVANL
FT                   LVFFLAFFLDYFELAFIIIPLLAPVADSLGIDLVWFGVMLAVNMQTSFMHPPFGFSLFY
FT                   LRSVAPSRPYKDKVTGATIQPVTSGQIYMGSIPFLLIQLVMVGIIISFPGIVTHYKSGH
FT                   PQADPASIQINVPMPDAGGGNPFGAAPAPFGAPSPSTEPLPAPSFGSPQPSFGQDKDLQ
FT                   QKPAQ"
FT   sig_peptide     473984..474076
FT                   /locus_tag="Oant_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.730 at
FT                   residue 31"
FT   gene            475611..476729
FT                   /locus_tag="Oant_0446"
FT   CDS_pept        475611..476729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0446"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: bms:BR0345 extracellular solute-binding protein,
FT                   family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13177"
FT                   /db_xref="GOA:A6WW23"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW23"
FT                   /protein_id="ABS13177.1"
FT                   /translation="MKQDLSRRTFLTKGAAIGAAAATSGAALATPAIAQELPTLRWRLT
FT                   SGFPNNLDTIYGGAVYMANAVSKMTEGKFQIQVFQAGEIVPGPQAIDAVQANTVEMAHT
FT                   CGYYFTGKNPAFAIGTAIPFGMNTRLQNAWLYHGGGNELYNAFLADYGIVGIVGGNTAA
FT                   QMGGWYRKEIKSLADLKGLKMRIAGVAGEVMSRLGVVPQQLPGGDIYPSLERGTIDAAE
FT                   WVGPYDDEKLGFYQIAPYYYYPAFWEGGASVHFFINKQQYESLPEPYKVALNTAAEAAT
FT                   QNMISLYDVKNTAAIRSLVSKGVKLQPLPRDVLDAAYKVAFELYAEYNEKNPAWAKIYP
FT                   SWKKFRDEGFEWFRVAEYTYDSYVYAQQAAGR"
FT   sig_peptide     475611..475715
FT                   /locus_tag="Oant_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.738 at
FT                   residue 35"
FT   gene            477031..478170
FT                   /locus_tag="Oant_0447"
FT   CDS_pept        477031..478170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0447"
FT                   /product="porin"
FT                   /note="PFAM: porin; KEGG: bmb:BruAb1_0657 Omp2b, porin"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13178"
FT                   /db_xref="GOA:A6WW24"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW24"
FT                   /protein_id="ABS13178.1"
FT                   /translation="MKIKSLLFGSAAALVATTGAYAADTVVAPEPESVEYVRVCDAYGA
FT                   GYFYIPGTETCLRVSGYVRYDAAGGDNVYGRGFVDRDGSVDTRRNSWDNKARFTLRLST
FT                   ASETDLGTLKTFAETRYDWGNGVEGASGSLRFAYIQLGGLRVGLDESAFVTFPGYLGDV
FT                   INDDVILAGGYRTGLISYTFTGGNGFSAILSLEQGNNDDTDSAYGYNGVIKDYTPHVVG
FT                   GLKYEGGWGKIAGVAAYDARNEEWAGKVRADVNITDRFSVWAMGGYKSNKDQYIMQTDG
FT                   NGHDIGQVRAISSFYGTWGGDWAVWGGAAFKATDKAVFNAQLAYDGTNTFAATANVAYE
FT                   MVPGFTVTPEVSYTKWSDSKSYLNGKDAVQGMIRFQRSF"
FT   sig_peptide     477031..477099
FT                   /locus_tag="Oant_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(478574..479410)
FT                   /locus_tag="Oant_0448"
FT   CDS_pept        complement(478574..479410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0448"
FT                   /product="protein of unknown function DUF861 cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861 cupin_3;
FT                   Cupin 2 conserved barrel domain protein; KEGG:
FT                   bmb:BruAb1_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13179"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW25"
FT                   /protein_id="ABS13179.1"
FT                   /translation="MGNDKNNRSYYAPTGGLPPQTQLLTDRAMFTEAYAVIPKGTFSDI
FT                   VTSFLPFWDKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRAELDESAEGVLFVVEGE
FT                   IAVTVAGKTHTLTEGGYAYLPPKSGWTLRNNGAMTARFHWVRKAYEYVDGLDVPEPLFL
FT                   NEKDIAPNPMPDTNGAWATTRFVDPNDLRHDMHVTIVTLEPGGVIPFAETHVMEHGLYV
FT                   LEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRHMKFSR"
FT   gene            complement(479520..480947)
FT                   /locus_tag="Oant_0449"
FT   CDS_pept        complement(479520..480947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0449"
FT                   /product="Chitin deacetylase"
FT                   /EC_number="3.5.1.41"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bmb:BruAb1_0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13180"
FT                   /db_xref="GOA:A6WW26"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW26"
FT                   /protein_id="ABS13180.1"
FT                   /translation="MKYPRNLVGYGRNTPDPRWPGGANIAVQFVVNYEEGGECSILDGD
FT                   AASECLLSEIVGAQPWQGQRNLNMESIYEYGARSGFWRLWRAFTRRNMPVTVYGVTLAM
FT                   ARNPEAVAAMKEADWEIASHGLRWWEYKDVPEEIEREHIRDAVRLHTELTGSRPLGIYQ
FT                   GKPSDNTLKLVMEEGGFLYSADSYADELPYWVEGPKGPHLIVPYTLDANDMRFATPQGF
FT                   NSGDQFYTYLKDTFDVLYREGAEGAPKMMSIGLHCRLVGRPGRVAALERFLDYVQSHDK
FT                   VWVAKRVDIARHWHENYKPVTADVVPSKASRDAFVARYGSIFEHSPWIAERAYDAGFSL
FT                   EEDAASGLAAAMTKAFRAASTDERLAVLKAHPDLAGKLAQAKRLTAESTAEQAGAGLDA
FT                   LTDAEKQTFTELNDAYTAKFGFPFIIAVKGRNKKEILDAFQRRVSNDRDTEFETACAQV
FT                   ERIALLRLKDILPEALY"
FT   gene            481216..481581
FT                   /locus_tag="Oant_0450"
FT   CDS_pept        481216..481581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0450"
FT                   /product="Hydroxyisourate hydrolase"
FT                   /note="TIGRFAM: Hydroxyisourate hydrolase; PFAM:
FT                   Transthyretin; KEGG: sme:SMb21285 conserved hypothetical
FT                   protein, transthyretin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13181"
FT                   /db_xref="GOA:A6WW27"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW27"
FT                   /protein_id="ABS13181.1"
FT                   /translation="MGQENSGNGRLTTHVLDTVSGKPAANLRIELRRVENQQAEPIREI
FT                   RTNDDGRCSEPLLAGENLRAGSYELLFHVGEYFGKTDDVIPFLDVVPLRFGISDEKAHY
FT                   HVPLLVSPFSYSTYRGS"
FT   gene            481587..483077
FT                   /locus_tag="Oant_0451"
FT   CDS_pept        481587..483077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0451"
FT                   /product="Xanthine dehydrogenase small subunit"
FT                   /note="TIGRFAM: Xanthine dehydrogenase small subunit; PFAM:
FT                   ferredoxin; molybdopterin dehydrogenase FAD-binding;
FT                   [2Fe-2S]-binding domain protein; CO dehydrogenase
FT                   flavoprotein domain protein; KEGG: bms:BR0349 xanthine
FT                   dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13182"
FT                   /db_xref="GOA:A6WW28"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW28"
FT                   /protein_id="ABS13182.1"
FT                   /translation="MNQSVHQSVRHTIRFLLNGEKVELDRVSPTETLLDYLRLSAKLRG
FT                   TKEGCGEGDCGACTVLVGKISDGKLVYESVNACIRFMGSLDGCHVVTIEHLRGADGELH
FT                   PVQKAMIEFHGSQCGFCTPGFVMSLYALWMREPKPADAQIEKALQGNLCRCTGYEAIMR
FT                   AARIISDYGTVMEDPLAAERAHVLEQLTAMRDGVRVEVGEGKDRLIVPGDLDDFATILA
FT                   AEPKATIVAGSTDVGLWVTKMMRDISPVVFIGHLEELRSVREENGVVTIGAGVTYTEAF
FT                   GFLAKRIPQLGQLINRIGGEQVRNMGTIGGNIANGSPIGDTPPPLIALNAKLTLRKGAE
FT                   RRTIPLEEFFIAYGKQDRQPGEFVEAVHVPVPAEGSHFAIYKVSKRYEEDITATLGAFH
FT                   LTLDAAGNVETVRIAYGGMAATPKRASTVEAALTAKPWTEATVEAALEAYAEDYTPLSD
FT                   MRATADYRLLAARNLLRRFFAETEGSYVPLRAAEIAAA"
FT   gene            483088..485442
FT                   /locus_tag="Oant_0452"
FT   CDS_pept        483088..485442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0452"
FT                   /product="Xanthine dehydrogenase molybdopterin binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /note="TIGRFAM: Xanthine dehydrogenase molybdopterin
FT                   binding subunit; PFAM: aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase molybdopterin binding; KEGG: bms:BR0350
FT                   xanthine dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13183"
FT                   /db_xref="GOA:A6WW29"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW29"
FT                   /protein_id="ABS13183.1"
FT                   /translation="MNKHPANALKAARIVGGVATDQKHDSAHKHVTGTAVYIDDIPEPE
FT                   GTLHIGVGYSSVAHGSFKSIDLSAVRAAPGVIDVLTYKDVPGENDVSPSGMHDDPIFAV
FT                   DKVEFHGQPIFAVIAKSRDQARRAARLAKIEYEETTGIYSIDALDGLKDRLVTTPLTLK
FT                   RGDARAAIDTAPHRIKNRMYLGGQDHFYLEGQVSLAIPGEDEDVTVYCSTQGPSETQHL
FT                   VAHALGVPSHSVTVEVRRMGGGFGGKETQANQWAAIAAIAAKKHKRAMKIRLDRDEDMT
FT                   STGKRHGFVIDYEVGFDDDGNILGIDYLFALNAGFSADLSGPVGDRALFHCDNAYFFPA
FT                   VHAQSAPLYTNTVSNTAFRGFGGPQGMVGAERVIDEVAFAVGKDPLEIRKRNFYDEMGK
FT                   DGTRNVTPYHQKVEDCIIQRIVSELEESSDYAKRREAIREFNAKSRYVKRGMALTPVKF
FT                   GISFTKTESNQAGALVHVYNDGSVHMNHGGTEMGQGLHLKVAQVVAEEFQIDIDRVKIT
FT                   ATTTAKVPNTAPTAASSGADLNGMAAQDAARQIKKRLIHFAAQQYQVPEDQVVFLPNRV
FT                   RVGNQEISFNDLVKQAFIGRVQLSAAGHYKTPKIHWDRAKGRGHAFYYYAYGAACSEVS
FT                   VDTLTGEYVVERTDILHDTGRSLNRAIDIGQVEGGFVQGMGWLTTEELVWDDKGRLRTH
FT                   APSTYKIPLASDRPKIFNVALTDWSEAYEPTIHRSKAVGEPPLPLGLSVLHALADAIAT
FT                   VADHKVCPRLDAPATPERVLMAIERLRKQKG"
FT   gene            485447..486289
FT                   /locus_tag="Oant_0453"
FT   CDS_pept        485447..486289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0453"
FT                   /product="Xanthine dehydrogenase accessory protein XdhC"
FT                   /note="TIGRFAM: Xanthine dehydrogenase accessory protein
FT                   XdhC; PFAM: protein of unknown function DUF182; KEGG:
FT                   bme:BMEI1574 XdhC protein (assists in molybdopterin
FT                   insertion into xanthine dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13184"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW30"
FT                   /protein_id="ABS13184.1"
FT                   /translation="MPGARDDIRAFLNRRPDSVLVEVTDVKGSAPRDAGAWMLVARDMI
FT                   FRTIGGGQLEYMAIDHARKVLLGGRDSPKDVPPMNVPLGPEIGQCCGGRVGLSFRRVSR
FT                   GLTDELVSKVDAEIATRPHVYVFGAGHVGDALASALSLTPVRVILVDTREAELMACDVP
FT                   GVETCLSAMPEQVVRSAPPGSAFIVLTHDHALDFLIVAEALQRRDAVYVGMIGSKTKKA
FT                   TFKNWLKREIGSDNLFENLVCPVGGAVVKDKRPEVIAALAAAEVLTAVLTSVRVSQPA"
FT   gene            complement(486386..487300)
FT                   /locus_tag="Oant_0454"
FT   CDS_pept        complement(486386..487300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0454"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bmb:BruAb1_0378 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13185"
FT                   /db_xref="GOA:A6WW31"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW31"
FT                   /protein_id="ABS13185.1"
FT                   /translation="MSYLDNLRVFVRVVELGNLSAAGRDQRASPAVASNRIKELEKHLG
FT                   VRLFNRTTRKLTPTEHGRVFYDGALKILEAVDEAEAAVAELAKNPKGSIRITAPLGFGR
FT                   RLIASGIPEFHDKYPDIEVRLRLSDHEVDIMSEGVDVAFKLGVLENSNLRMRGIMNCER
FT                   VICAAPAYLEKHGVPQSPDELLGDKHDCLLLRFPGSKEYFWSLQTAEGLRKFEVTGPFD
FT                   SDDGDVLTQWALGGRGIINKPLFEVKEYIRDGRLVPILESTPPAPIQLAAIYPHKRFQD
FT                   PKVRLIIDFMTERCQRLIREALM"
FT   gene            487438..488673
FT                   /locus_tag="Oant_0455"
FT   CDS_pept        487438..488673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0455"
FT                   /product="protein of unknown function DUF989"
FT                   /note="PFAM: protein of unknown function DUF989; KEGG:
FT                   bme:BMEI1572 hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13186"
FT                   /db_xref="GOA:A6WW32"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010389"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW32"
FT                   /protein_id="ABS13186.1"
FT                   /translation="MYDFAVAWDWLGFAARWLHVITAIAWIGSSFYFIALDLGLRQRPG
FT                   LPVGAHGEEWQVHGGGFYHIQKYLVAPAEMPEHLTWFKWESYATWLSGFTLLCIVYYAG
FT                   ADLYLIDPNVLDVSVPVAIAISIGSLAFGWIAYNTICKLMLGKSDTLLMVILYCILVVV
FT                   AWGYTHLFTGRAAFLHLGAFTATIMSANVFMIIIPNQKIVVADLIAGRKPDPKYGKIAK
FT                   QRSTHNNYLTLPVLFLMLSNHYPLAFGTQFNWIIASLVFLMGVTIRHWFNTQHARKGSP
FT                   TWTWLVTVILFIIIIWLSTVPKVLTGEPEEQKVSALQQSFISDPHFEKVRDTVLGRCAM
FT                   CHAKEPGWEGIIAPPKGVVLDTDRDIAAHAREIYLQAGRSHAMPPANVTGVSEEERQLL
FT                   ASWYQSATQGPK"
FT   gene            488688..489992
FT                   /locus_tag="Oant_0456"
FT   CDS_pept        488688..489992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0456"
FT                   /product="Guanine deaminase"
FT                   /note="TIGRFAM: Guanine deaminase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; KEGG: bms:BR0354 chlorohydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13187"
FT                   /db_xref="GOA:A6WW33"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW33"
FT                   /protein_id="ABS13187.1"
FT                   /translation="MTKLLIRGRVLTFRDEPQSLDDNAAYRYIEDGAVLVEDGRILRLG
FT                   DYAEVSSMAGRDVNVADHRPHLILPGFIDTHIHYPQTQVVASYAANLLEWLNTYTFVAE
FT                   QKFADEQHAEFIAERFLDELIRHGTTTAVAYCSVHPQSVDAYFRASQHRNMRMLGGKVM
FT                   MDRNAPPALCDTAKSGYDDTKALIARWQGKGRLDYVITPRFAITSTPEQLEASQALVRE
FT                   HPGSYIQTHLSENHDEISFTKSLYPDAPDYLGIYEHYGLLGDKTLLGHSIHLEPREVRV
FT                   MAETGSIAVFCPTSNMFLGSGLFDRDRLKASGVRMAVATDVGGGTSFSMLRTMDEGYKV
FT                   LQLREQRLNPFQSFYMMTLGNARALSMEDKIGTLDEGTEADIVVLDSSATSPMRLRMAA
FT                   GATLEQELFLLQTLGDDRAIVETYVAGKPLKAELA"
FT   gene            complement(490053..490940)
FT                   /locus_tag="Oant_0457"
FT   CDS_pept        complement(490053..490940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0457"
FT                   /product="Transcriptional regulator IclR"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: sme:SMb20682 putative acetate operon
FT                   repressor IclR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13188"
FT                   /db_xref="GOA:A6WW34"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW34"
FT                   /protein_id="ABS13188.1"
FT                   /translation="MSFRVAMDAIVVIREFRRDSETVMEQAKVKRGRKAAENAAPSSVQ
FT                   VLDRSLKLLALIAENDGSTLTDLADESGMAPSTVHRLLSSLANHGMVSHDLESGDWTIG
FT                   VKAFEIGNAFRRFRKLGILARPYLKTLMETSGETANIGVEDGGDVVFISQIESHAPMRA
FT                   FFRPGRRGPIHASGIGKAILSTWSDKEIAHALSGRTLEHFTQRTLDSLPALLKDIQATR
FT                   TRGWSVDDEEHTLGMCCIAAPIFNEYGEAIAGISVSGPAVRLPKKRLEEFGPLIRSTAD
FT                   ELTRAMGGKRPEEF"
FT   gene            491054..492838
FT                   /locus_tag="Oant_0458"
FT   CDS_pept        491054..492838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0458"
FT                   /product="glyoxylate carboligase"
FT                   /note="TIGRFAM: glyoxylate carboligase; PFAM: thiamine
FT                   pyrophosphate protein domain protein TPP-binding; thiamine
FT                   pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   sme:SMb20681 putative glyoxylate carboligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13189"
FT                   /db_xref="GOA:A6WW35"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW35"
FT                   /protein_id="ABS13189.1"
FT                   /translation="MARMRAVDAAVLVLEREGINCAFGVPGAAINPFYSAMKARGSIRH
FT                   ILARHVEGASHMAEGYTRAKHGNLGVCIGTSGPAGTDMITGLYSASADSIPILCITGQA
FT                   PRARLDKEDFQAVDIAKIAAPVTKWAVTVMEPALVPFVFQKAFHIMKSGRPGPVLIDLP
FT                   IDVQLAEIEFDIDTYQPMEAYKPAATRAQAEKALAMLNEAERPLIVAGGGIINADASDL
FT                   LVELAEITGIPVIPTLMGWGVIPDDHRLMAGMCGLQTSHRYGNANLLASDVVIGIGNRW
FT                   ANRHTGNVDTYKKDRKFIHIDIEPTQIGRVFAPDFGIVSDAGKALKLLLDVATEWKSAG
FT                   KLRDWSDWAKECGERKRTMLRKTHFDQTPLKPQRVYEEMNKAFGRDTCYVTTIGLSQIA
FT                   GAQFLHVYRPRNWINCGQAGPLGWTLPAALGVRAADPDRPIVALSGDYDFQFMIEELAV
FT                   GAQHKLPYIHVVVNNSYLGLIRQAQRGFNMDFEVSLAFDNINANGDAEKGYGVDHVAVA
FT                   EGLGCKAIRVRSPNQFTESFEQAKALMAEHQVPVVLEFILERVTNISMGVDIDQVVEFE
FT                   ELAERGEDAPTAIAALLD"
FT   gene            493077..493871
FT                   /locus_tag="Oant_0459"
FT   CDS_pept        493077..493871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0459"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sme:SMb20680 putative hydroxypyruvate isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13190"
FT                   /db_xref="GOA:A6WW36"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW36"
FT                   /protein_id="ABS13190.1"
FT                   /translation="MPRFAANLTMLFNEVPFMDRFALAAKAGFTGVEYLFPYEFNRHEL
FT                   KAALTKHNLAQVLHNLPAGNWAGGERGIAVLPDRVDDFRRGVADAIDYATTLNCSQVNC
FT                   LSGIAPQGVDPDVLRATFVSNLRLAAKELGKHGIRLLIEPINHYDIPGFYLNTVEQAVS
FT                   IIDEVGSNNLFIQYDLYHQQRTRGELVATYERYRPLIAHVQLADNPGRNEPGTGEINYP
FT                   NVFEALKNAGYKGWIGCEYKPKTTTEEGLGWFKNHEAERLTA"
FT   gene            493995..494879
FT                   /locus_tag="Oant_0460"
FT   CDS_pept        493995..494879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0460"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="TIGRFAM: 2-hydroxy-3-oxopropionate reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   sme:SMb20679 putative tartronate semialdehyde reductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13191"
FT                   /db_xref="GOA:A6WW37"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW37"
FT                   /protein_id="ABS13191.1"
FT                   /translation="MAKIGFIGLGIMGTPMARHLQDAGHQLFTSRFNPPPRQELIDNGL
FT                   QILETPKAVAEECDTIILMLPDTPQVAEVIFGEGGAIGGLGKGKLLIDMSSISPIETKE
FT                   FAKKVRATGGEYVDAPVSGGEVGAKNASLSIMAGGSQESFDRALPLLKLMGKNITLVGD
FT                   CGDGQTTKVANQIIVALNIEAVAEALVFASKAGADPAKVREALMGGFASSRILEVHGER
FT                   MIKRTFDPGFRISLHQKDLNLALQGAKALGVSLPNTAMAQELFNSCAAHGDDGLDHSGL
FT                   VRALERMANHEVA"
FT   gene            495008..496282
FT                   /locus_tag="Oant_0461"
FT   CDS_pept        495008..496282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0461"
FT                   /product="Hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /note="PFAM: MOFRL domain protein; KEGG: bmb:BruAb1_0381
FT                   hydroxypyruvate reductase, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13192"
FT                   /db_xref="GOA:A6WW38"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW38"
FT                   /protein_id="ABS13192.1"
FT                   /translation="MTAISDPKKFLTSLFDAAVAAADPELVIRANLPAKPKGRTIVIGA
FT                   GKGSAQMAAAFERAWEAPLEGVVVTRYGYGTPCERIEIIEAAHPVPDEAGLQASKRLFD
FT                   AVSNLTEDDLVVALVSGGGSALLPSPPEGLTLEDEIAVNKILLASGAPISAMNAVRKHL
FT                   STIKGGRLAAAAHPAKVFSLVVSDIPGDNPAFVASGPTVPDETNRDEALKIIERYRLEL
FT                   PDAVLAHIKSEKAHAPKPDDKVFAGNEVRVIASAAVSLEAAVKEAARHGVEAVILSDAM
FT                   EGEAREVAHVHAAIAREVADRDRPFRKPVVILSGGETTVTIRGKGGKGGRNSEFLLSFA
FT                   LDIDGYDNIHALAADTDGIDGSEDNAGAFADGSTVLRLQKAGEDGAARLNANDAWTAFD
FT                   AIGDLFVPGPTGTNVNDLRAILIVA"
FT   gene            complement(496263..496421)
FT                   /locus_tag="Oant_0462"
FT   CDS_pept        complement(496263..496421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0462"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="TIGRFAM: cytochrome oxidase maturation protein,
FT                   cbb3-type; PFAM: cytochrome oxidase maturation protein
FT                   cbb3-type; KEGG: bmb:BruAb1_0382 CcoS, cytochrome oxidase
FT                   maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13193"
FT                   /db_xref="GOA:A6WW39"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW39"
FT                   /protein_id="ABS13193.1"
FT                   /translation="MSGLLFLIPIALFLGLLGLVAFLWSLKNGQYDDLDGAASRILLDD
FT                   ESKPLSK"
FT   sig_peptide     complement(496350..496421)
FT                   /locus_tag="Oant_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.744) with cleavage site probability 0.468 at
FT                   residue 24"
FT   gene            complement(496418..498676)
FT                   /locus_tag="Oant_0463"
FT   CDS_pept        complement(496418..498676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0463"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: bms:BR0357 nitrogen fixation protein
FT                   FixI, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13194"
FT                   /db_xref="GOA:A6WW40"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW40"
FT                   /protein_id="ABS13194.1"
FT                   /translation="MSCCVENAQIATVVQAVSVDEMQVASRALGDGFRQLDLSVPGVHC
FT                   GLCIKNIEETLGKIAGVVYVRVNLTARRVTVRWKDGETPPDVVDPLRRLGYEAHIFDMA
FT                   QDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIALPTLIYSG
FT                   RIFYVSAWNALRARRVNMDVPIALAITLAFGMSVYETMNHGQHAYFDASVTLLFFLLIG
FT                   RTLDYMMRARARSAVRGLAQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAGERVPV
FT                   DAKVEEGRSELDCAIASGESDAVPVGPGSDIRAGTLNLSTPLVIRATAEAKDSFLAEMV
FT                   RLMDVAEGGRAYYRRLADRASELYVPMVHTIAFAAFVGWMIYTGGDWYRSIYIAICTLI
FT                   ITCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAIFDKTGTLTLGQPRL
FT                   INADAIDPHNLEIAAELSLYSRHPLSRALALFSGAKPMTAFTRIEEVPGAGIEAELNGS
FT                   IYRLGKRDWADGTAVMPHADGPETCLSIDGKLVQTFRFEDQPREDAAGAIATLKRNGLK
FT                   LGIISGDRLPAVERLAGYLGVDNFQAQVLPADKSELVQKLSREGSKVLMVGDGLNDAPA
FT                   LVAAHVSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGRLISQNFALSIGYNI
FT                   IAVPIAIFGYVTPLVAALSMSLSSIVVVSNALRLRAGKQKQQTQKTIAPVAIIKEAHK"
FT   gene            complement(498673..499170)
FT                   /locus_tag="Oant_0464"
FT   CDS_pept        complement(498673..499170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0464"
FT                   /product="FixH family protein"
FT                   /note="PFAM: FixH family protein; KEGG: bms:BR0358 FixH
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13195"
FT                   /db_xref="GOA:A6WW41"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="InterPro:IPR018037"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW41"
FT                   /protein_id="ABS13195.1"
FT                   /translation="MSIKSKTSGTFTGWHMLGIMVAFFGVIIAVNLTMAYNAIHSWSGL
FT                   VVKNTYVASQEFNDKAQTGKEQAALQWQSKPAFESGIFTWQLADRDGKAVAMTGGTVEF
FT                   KRPVGDVHDTKVTLTVREPGVLTAPLELGEGAWIMEVNADAGLEDPYRHIIRVLVKDGR
FT                   IL"
FT   sig_peptide     complement(499063..499170)
FT                   /locus_tag="Oant_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.737 at
FT                   residue 36"
FT   gene            complement(499170..500735)
FT                   /locus_tag="Oant_0465"
FT   CDS_pept        complement(499170..500735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0465"
FT                   /product="Cytochrome c oxidase cbb3 type accessory protein
FT                   FixG"
FT                   /note="TIGRFAM: Cytochrome c oxidase cbb3 type accessory
FT                   protein FixG; KEGG: bms:BR0359 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13196"
FT                   /db_xref="GOA:A6WW42"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW42"
FT                   /protein_id="ABS13196.1"
FT                   /translation="MSDDVERIDVQAVNSPKTRPSKIGQSLYAARVKIFPKRVQGEFRR
FT                   FKWIVMLITLGIYYLTPWLRWDRGPYAPDQAVLIDLANRRFYFFFVEIWPQEFYYVAGL
FT                   LIMAGLGLFLVTSVAGRAWCGYTCPQTVWVDLYLVVERAIEGDRNARMKLDKAPWTFDK
FT                   VWKRVAKHSVWIVIGVLTGGAWIFYFADAPKLLMDFVTGQAAPVAYFTVAILTATTYIF
FT                   GGLMREQVCTYMCPWPRIQAAMLDENSLTVTYNDWRGEPRSRHSKKAIAAGETVGDCVD
FT                   CNACVAACPMGIDIRDGQQLECITCALCIDACNSVMDKIDKPRGLISYATLADYDFNMA
FT                   LATNNGTAPIDPARVYKAPNSFSDKVQNLSWKKVLRPRSMFYFAVWALIGLTLIISLSM
FT                   RQRIGINVLHDRTPQYVLLSDGSIRNGYTVKLLNMIPTPRTFRLSIEGLPGATLTVQDE
FT                   TADADGNYDVPVEPDRLKTLRVFVTMPHDAITDHRKDYEIEVRDANGAEHARYMATFMA
FT                   PEGR"
FT   gene            complement(500928..501791)
FT                   /locus_tag="Oant_0466"
FT   CDS_pept        complement(500928..501791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0466"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   III; PFAM: cytochrome c class I; KEGG: bmb:BruAb1_0386
FT                   CcoP, cytochrome c oxidase, cbb3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13197"
FT                   /db_xref="GOA:A6WW43"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW43"
FT                   /protein_id="ABS13197.1"
FT                   /translation="MTDKQIDDVTGVATTGHEWDGIKELDNPMPRWWLWTFYATIFWAI
FT                   AYVIAYPAWPLISSSTGGVLGWSSRGAFWEETAKIDSERQGIIDQIKAKDVHEILADEN
FT                   LRQYAIAGGAAAFRVNCVQCHGSGAQGAPGYPNLNDDDWLWGGSIDDVLTTIRHGVRSK
FT                   DDADTRVSEMPAFVDVLEPQQIRDVAAYVVSLSGTPHNSEMVPEGKKVFAENCAVCHGA
FT                   DAKGLREFGAPNLTDAIWFYGSGEDAIVRQVSHPKHGVMPAWETRLGDATVKQLAIFVH
FT                   SLGGGE"
FT   gene            complement(501784..501942)
FT                   /locus_tag="Oant_0467"
FT   CDS_pept        complement(501784..501942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0467"
FT                   /product="Cbb3-type cytochrome oxidase component"
FT                   /note="PFAM: Cbb3-type cytochrome oxidase component; KEGG:
FT                   bmb:BruAb1_0387 CcoQ, cytochrome c oxidase, cbb3-type, CcoQ
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13198"
FT                   /db_xref="GOA:A6WW44"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW44"
FT                   /protein_id="ABS13198.1"
FT                   /translation="MDYNTMRTFADSWGLLGMALFFLFVVFYAFRPGSKQIADHAKDIP
FT                   FKDDAND"
FT   gene            complement(501958..502689)
FT                   /locus_tag="Oant_0468"
FT   CDS_pept        complement(501958..502689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0468"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   II; PFAM: cytochrome C oxidase mono-heme subunit/FixO;
FT                   KEGG: bmb:BruAb1_0388 CcoO, cytochrome c oxidase,
FT                   cbb3-type, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13199"
FT                   /db_xref="GOA:A6WW45"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW45"
FT                   /protein_id="ABS13199.1"
FT                   /translation="MSILKNHSKLEKNATLLLIASLAVVTVGGIVEIAPLFYLENTIEK
FT                   VEGMRPYSPLELAGRDVYVREGCYLCHSQMIRPFRDEVERYGHYSLAAESMYDHSFQWG
FT                   SKRTGPDLARVGGRYSNEWHVQHLVRPRDVVPESVMPSYAFLKNRPLDASNIAGNLKAN
FT                   VAVGVPYSQEMIDSALDDLKAQATPDADTSGVEARYPKAKLGDFDGNPQMISEMDALIA
FT                   YLQMLGTLVDFSTYDQSPKAR"
FT   sig_peptide     complement(502603..502689)
FT                   /locus_tag="Oant_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.589 at
FT                   residue 29"
FT   gene            complement(502704..504329)
FT                   /locus_tag="Oant_0469"
FT   CDS_pept        complement(502704..504329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0469"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit I;
FT                   PFAM: cytochrome c oxidase subunit I; KEGG: bmb:BruAb1_0389
FT                   CcoN, cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13200"
FT                   /db_xref="GOA:A6WW46"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW46"
FT                   /protein_id="ABS13200.1"
FT                   /translation="MNYAAGTVLSGLGALFAVLLAGFSHDELFRTHMWILFATLAIFTI
FT                   LLMRNADYGLTPKKVDQSTYMDGPIRYGVIATVFWGVTGFLVGVVIAAQLAFPDLNLEP
FT                   YLNFGRLRPLHTSAVVFAFGGNILIASSFYVVQRTCRARLIGGDLAWFVFWGYQLFIVM
FT                   AATGYLLGITQSREYAEPEWYVDIWLTIVWVAYLVVFLGTILKRKEPHIYVANWFYLSF
FT                   IITIAMLHIINNLAIPVSFLGVKSYSAFSGVQDAVTQWWYGHNAVAFFLTVPFLAMMYY
FT                   FVPKQAERPIYSYRLSIVHFWSIIFLYIWAGPHHLHYTAVPDWAQTLGMVFSIMLWMPS
FT                   WGGMINGLMTLSGAWDKVRTDPIIRLMVAAIAFYGMATFEGPMLSIKAVNSLSHYTDWT
FT                   IGHVHAGALGWNGMITFAAVYYLAPKLWNRQRLYSIRMVNWHFWLATLGIVLYAAAMWV
FT                   AGIQQGLMWREYDDQGFLVYSFAETVLAMFPYYVIRTLGGVLYLAGGFVMAWNVYQTIR
FT                   GNLRNEAPMGGAQPATGTTMQPAE"
FT   sig_peptide     complement(504264..504329)
FT                   /locus_tag="Oant_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.316 at
FT                   residue 22"
FT   gene            complement(504535..505896)
FT                   /locus_tag="Oant_0470"
FT   CDS_pept        complement(504535..505896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0470"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rpd:RPD_4242 ATP-binding
FT                   region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13201"
FT                   /db_xref="GOA:A6WW47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW47"
FT                   /protein_id="ABS13201.1"
FT                   /translation="MNSIRSRLTGILIGVTCLVWLFAVVWIHISTQSQLEKVLDARLME
FT                   AARMVNSLLTEHRVEVGPEGDGGQLSLKPMPDFPLYDRQLFCQIWALDGKLVGRSESAP
FT                   GVRLTNVANGFSDTEVAGDRWRVFAVENTQLGLRVMVGDSLSVRERLVQNVVAGLVLPA
FT                   LLMLPVLALMIWLCVRRGLDPLSRLASVLSKRQAQDLRPLPEQNLPKEIAPAVTALNGL
FT                   FHRVEEARERERNFAIFAAHELKTPLAGLKTQAQIAEGAKDEKMRANAVRQIAAGVDRT
FT                   SRLTNQLLDLAALETSDEIEAPAYEPVCQLLVAVSTDMRMLAVQRGISIELPDNMPLVQ
FT                   LPSPHLFTLAARNLIENAVNHSPRDGAVRCRIEAEAGKVRLTVEDNGPGIPDSEMPHVT
FT                   ERFFRGAHRNETGSGLGLAIVKMAAERMGGELQLQNRSQGGLSASIIVPGTIVE"
FT   gene            complement(505893..506558)
FT                   /locus_tag="Oant_0471"
FT   CDS_pept        complement(505893..506558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0471"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rpc:RPC_4906 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13202"
FT                   /db_xref="GOA:A6WW48"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW48"
FT                   /protein_id="ABS13202.1"
FT                   /translation="MRILVVEDDAILLDGLTVGLGLAGFTVDAVSNCGDAEAALAAQNY
FT                   HAVVLDLMLPDGSGLDILRTMRRGRDETPVLLLTARDQVPERIAGLDAGADDYVGKPFD
FT                   LHELAARVRAVARRGAGRANALLEWRGVELDPAEMSVLLHGEPVRLTRREFSILRALME
FT                   RPTATFSKSSLEEALYGWQEEVESNAVEVHIHHLRSKLGSDYIETVRGVGYRLAGASA"
FT   gene            506688..508505
FT                   /locus_tag="Oant_0472"
FT   CDS_pept        506688..508505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0472"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: rpb:RPB_4360 thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13203"
FT                   /db_xref="GOA:A6WW49"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW49"
FT                   /protein_id="ABS13203.1"
FT                   /translation="MRKIVMRFFTGLAGLFISLFLALGPASAANPLPVDQAFRLSVLKD
FT                   TDGRLVLNWQIADGYYLYRDHIEAKDGQGNALAVDTQPGQPKDDPNFGRLEVYYTHATA
FT                   SVKADAQPVELTYQGCQEDGICYRPETRTVDPVTLAISSEMGQKAKALTQASVFAPAAM
FT                   PTVEQNTAFALAPEKGMVEGLLDQGGTGLVIAAFLAFGVLLAFTPCVFPIYPILAGTLA
FT                   REGEKLTAKRGFVLSAVYVVSLALGFAVVGAIAGWSGQNLQMVLQSKWTALALAGLFTL
FT                   LALSMFGLFQIQLPNSWVSAISSRTGPNGQQRTGSKRSAAILGFSSVLIVGPCVTAPLA
FT                   GALLYIAQTANVALGASALFALGIGKGLPLIAFATLGAGTLPRAGAWMETVKQIFGFGF
FT                   LATAIFMAAPLLPPGVDMVLWALLLFGAASFAFLRIPGRSVVARTIGTAAFVYGVILML
FT                   GVASGGKDPLQPLAAFGNRGGNQNLAALQFAPVETVSSLQEKLVEARGDKPTLVYFTAD
FT                   WCVSCSTVERRVLPDASVKKALGDYQLIKADISQLTSGNADLMAKLGVAGPPTMIFFDR
FT                   ISKEPEGTRLVGDVTTASIERSVGLVSAD"
FT   sig_peptide     506688..506774
FT                   /locus_tag="Oant_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 29"
FT   gene            508649..509443
FT                   /locus_tag="Oant_0473"
FT   CDS_pept        508649..509443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0473"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rsp:RSP_1873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13204"
FT                   /db_xref="GOA:A6WW50"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW50"
FT                   /protein_id="ABS13204.1"
FT                   /translation="MVLNEKPDARRSLLRMAVVACLPFAAAACTTASADRPIAVTMPQT
FT                   VAFTPEPVAVEPVSEPAPEVQTAKSEYETMYGAVNDRGNLIPALDLSKIADRNLRREVD
FT                   YATTEPVGTIVVDPYARYLYLVQPGGKAIRYSVGVGRAGLTFKGDAKLAYKSQWPRWTP
FT                   TANMIKRNPEHYAKYANGLEGGIRNPLGARALYLYRDGKDTLYRIHGTNEPWSVGKAAS
FT                   SGCIRLYNQDILDLYKRATAGARVVVLDKSQSGAKAGKGASS"
FT   sig_peptide     508649..508753
FT                   /locus_tag="Oant_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.786 at
FT                   residue 35"
FT   gene            509440..510054
FT                   /locus_tag="Oant_0474"
FT   CDS_pept        509440..510054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0474"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bmb:BruAb1_0392
FT                   twin-arginine translocation signal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13205"
FT                   /db_xref="GOA:A6WW51"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW51"
FT                   /protein_id="ABS13205.1"
FT                   /translation="MMNRRQILAATAAGAATIAISGGESLAQRVPTVAEVLYDKEIPVL
FT                   GNPNGNVTIVEYFDYQCPYCKKGHGELMRVVKNDGNVRLVMKDWIIFGDTSAYAARLVL
FT                   AAEKSGNYVKAMEALMATPGRLTPEQVDTALKKGGLDPAKLNAAYKADSKRINAILERN
FT                   MDQGEAFNFGGTPSFVIGTKLYGGVMKEPELIEAIKEARKA"
FT   sig_peptide     509440..509523
FT                   /locus_tag="Oant_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.666 at
FT                   residue 28"
FT   gene            complement(510241..511218)
FT                   /locus_tag="Oant_0475"
FT   CDS_pept        complement(510241..511218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13206"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW52"
FT                   /protein_id="ABS13206.1"
FT                   /translation="MVKQFTWDPDKSQVFDSSYESQESLCTSAVSFSKDNGSSFEMNAP
FT                   GKTLTLKQSTATDIVSWNPTADQETPVISVTGGEVIFDFAGNAQTLYVYNPFGDETIKI
FT                   LNGRFLVHNVSSFISESGRIYLDENSLTHILTSDVTDLTGSILYINSSSLSIDSENIKF
FT                   GEFSISESILNTNSKVLAFEGNDINITNSKLEFYTTEFYTNGKMAFGQRITILDASFII
FT                   YSQKTSISNSEFDIFNASLLEISGQKDEDFSEGASFRFNFIKDNESGPNTSEIHFNNGS
FT                   AFLASRLGTYGLICINGVPQTGTNWSKNISWEMTSDRVLIVKLR"
FT   gene            511530..512615
FT                   /locus_tag="Oant_0476"
FT   CDS_pept        511530..512615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0476"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; Ada metal-binding domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: bme:BMEI1558 ADA
FT                   regulatory protein /
FT                   O-6-methylguanine-DNA-alkyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13207"
FT                   /db_xref="GOA:A6WW53"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW53"
FT                   /protein_id="ABS13207.1"
FT                   /translation="MNLMTMKTHDPDENRWQKVLDRDKASDGAFVYAVRTTGVYCRPSC
FT                   PSRRGKRENVQFFDGCEDAERAGFRPCMRCKPHLSETLATQNSTRYADMVAAACRFIEM
FT                   AEEVPSLEEIAASVKASPAHFHRVFKEFTGLTPKAYANAHRAKKMRAALDAPEIRVTDA
FT                   IYDAGYNSSSRFYEASDGILGMTPKAYKQGGKNADIRFAIGQSSLGAVLVAASGKGVCA
FT                   ILMGDDPEELIRDLEKRFPQANLIGADRDFENMVAEVVGFVEAPRIGLDLPLDLQGTAF
FT                   QQRVWQALREIPAGKTVSYTDIAERIGAPKSVRAVAQACAANKIAVAVPCHRVVRNDGG
FT                   LSGYRWGVERKRDLLERESQA"
FT   gene            512612..513334
FT                   /locus_tag="Oant_0477"
FT   CDS_pept        512612..513334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr1862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13208"
FT                   /db_xref="GOA:A6WW54"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW54"
FT                   /protein_id="ABS13208.1"
FT                   /translation="MNRNEPMLADNIAAYDWQKIGAELDEFGATILRNIISPQDCRELA
FT                   AGYYNLAAFRTVVSMRKHGFGRGEYKYYANPIPALIWNLRQTLYPQLAPIANRWSERLG
FT                   SDVRFPPTHDEFLDRCHAAGQTRPTPLILQYVEGDYNCLHQDIYGDIAFPLQVAILLSE
FT                   PEKDFTGGEFVLTEQRPRMQSRAEVVPLRQGDGVVFAVNDRPMQGTRGDYRVKMRHGVS
FT                   RIRSGQRHTLGIIFHDSR"
FT   gene            513600..513950
FT                   /locus_tag="Oant_0478"
FT   CDS_pept        513600..513950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0478"
FT                   /product="arsenate reductase and related"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   bms:BR0369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13209"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW55"
FT                   /protein_id="ABS13209.1"
FT                   /translation="MSVTIYGIKNCDTMKKARTWLEDHGIDYAFHDYKKEGLDGETLDH
FT                   FLKSVPWEQLLNRAGTTFRKLPEEERQNVDAAKARALMLAQPSMVKRPVLDKDGKLTVG
FT                   FKPELYESFFKS"
FT   gene            514002..515045
FT                   /locus_tag="Oant_0479"
FT   CDS_pept        514002..515045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13210"
FT                   /db_xref="GOA:A6WW56"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW56"
FT                   /protein_id="ABS13210.1"
FT                   /translation="MRQRANKVVQQWSVSWRDSLIASFAGGVAWLICQLALGQPKPVFA
FT                   MVTAVICLAPNLPNHGKQAIGVMVGVTTGVLVGELSLLLPETVPVFHTSIVTFVAMVLA
FT                   TSFGMAPAIAIQSGVSAILVLAMGPQVAGITRLVDVLVGAGVGLLFSQILMTPSPVLLI
FT                   DKAVRGLLDRLANGLKQSAVALEKQDLVRAQSAINQFTSAHRAVIALGDGIALARSNAR
FT                   WSLRGRLVAREVTEMAGRYDRRGIRLYASALLFGEALGNALRKKEAPPPPWLTEALQVV
FT                   IANCELEEGQEPSRIPPMPKDIPFGWRDSAHRLSSMQDTLLHFLHSDIPDSVPVTRRTT
FT                   EEKPTAA"
FT   sig_peptide     514002..514118
FT                   /locus_tag="Oant_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.727) with cleavage site probability 0.719 at
FT                   residue 39"
FT   gene            complement(515068..515676)
FT                   /locus_tag="Oant_0480"
FT   CDS_pept        complement(515068..515676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0480"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: atc:AGR_C_3003
FT                   ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13211"
FT                   /db_xref="GOA:A6WW57"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW57"
FT                   /protein_id="ABS13211.1"
FT                   /translation="MRETMQLVPMVVEQSSRGERSFDIYSRLLRERIIFLNGEVNDTVS
FT                   ALICAQLLFLEAENSKQPINLYINSPGGVVTSGLAIYDTMRYVRAPVHTLCMGTARSMG
FT                   SFLLMAGEPGHRAALPNANLLVHQPSGGFQGQASDIFIHAEEAQRTKRLMTRLYAEHCG
FT                   RTYEEVERALDRDNFMTAEAGLEWGLIDRILERREVSAA"
FT   gene            complement(515719..516078)
FT                   /locus_tag="Oant_0481"
FT   CDS_pept        complement(515719..516078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0481"
FT                   /product="conserved hypothethetical protein"
FT                   /note="KEGG: rle:RL1169 conserved hypothethetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13212"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW58"
FT                   /protein_id="ABS13212.1"
FT                   /translation="MTDRQEEPREKGIELEYELDAAPQKVWRAISIPEFRENWLPSEAL
FT                   ADPEPASCKPGEEISYRMRESEPPFLESMVTFRIVPGVSGGTFLRVIHELNDTRLKRTA
FT                   AVAANSNRAPMMRAA"
FT   gene            complement(516075..516401)
FT                   /locus_tag="Oant_0482"
FT   CDS_pept        complement(516075..516401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0482"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: ret:RHE_CH01412
FT                   probable transcriptional regulator protein, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13213"
FT                   /db_xref="GOA:A6WW59"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW59"
FT                   /protein_id="ABS13213.1"
FT                   /translation="MNENDIFHDIFRALADPTRRMIFEKLASGSMNASALRQGMEISQP
FT                   AMSQHLAVLRSAGLVREEREGRFVNYEVDPNGLTLIANWLAKYRAYWPERIDALKTLLK
FT                   DMDQ"
FT   gene            complement(516464..516832)
FT                   /locus_tag="Oant_0483"
FT   CDS_pept        complement(516464..516832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll3729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13214"
FT                   /db_xref="InterPro:IPR014587"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW60"
FT                   /protein_id="ABS13214.1"
FT                   /translation="MNRSGISACLLAVVAVASAGGVQAKELTTMNEVRDALNACWSPLS
FT                   DSKNSSVTLRFSFKRDGNLKGPPCASAINVQGDDKTRKAFVIAAIEAVERCTPLKLAPS
FT                   LAHSISGSVFTMRFHSSD"
FT   sig_peptide     complement(516758..516832)
FT                   /locus_tag="Oant_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            517013..518215
FT                   /locus_tag="Oant_0484"
FT   CDS_pept        517013..518215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0484"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: bmf:BAB1_0401
FT                   tetracycline resistance protein:major facilitator
FT                   superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13215"
FT                   /db_xref="GOA:A6WW61"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW61"
FT                   /protein_id="ABS13215.1"
FT                   /translation="MTETSLEMTKPASPQHRTAVRYAFGGFLAMAAAMGIGRFIYTPIL
FT                   PGMMADIGFTAADAGFIASANYIGYLLGAVVAGYGWSAGIERKSVIAGLIISGLLCAAM
FT                   AFFDGVWLFSIIRFAAGFISAVTMILCTAIVLSHVTAAERAGLGALHFGGVGSGIALSA
FT                   VLVALIRFAGLDWRADWIGAAVLTIVMVVLVGAFVREGPVGGNSGTREPPLPKSFAFNA
FT                   LALAYGIFGFGYVITATFLIAIVRATDGGPLMEAAVWVVTGLTAAPSIWLWAPAARKFG
FT                   LFNAFALTAILEAVGVAASVVLAPPLGPLVGGALLGITFMALTAFGLQIARTLAPASPK
FT                   RALARMTVCFSIGQIIGPLVAGFMAQRSGSFTSASLAAALSLVVVAVLGIMAGRAARTS
FT                   G"
FT   gene            518299..519549
FT                   /locus_tag="Oant_0485"
FT   CDS_pept        518299..519549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0485"
FT                   /product="SbmABacA family protein"
FT                   /note="PFAM: SbmABacA family protein; ABC transporter
FT                   domain protein; KEGG: bmb:BruAb1_0398 BacA, bacteroid
FT                   development protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13216"
FT                   /db_xref="GOA:A6WW62"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW62"
FT                   /protein_id="ABS13216.1"
FT                   /translation="MFVSFFPRPKLFFWSALVWSLLAVLGWYEGGERLGAIFGLPPLAQ
FT                   DAAPIIGASLFWSAPFLWFYIYFAVATFAFYLFWAWFSPHPWQRWSILGSALILFTTYF
FT                   GVQVSVAVNAWYGPFYDLVQKALTSPGAVSASDFYWGMVTFAEIAFIGVTVGVLSLFFV
FT                   SHYIFRWRSAMNEYYVSHWPKLRSIEGAAQRVQEDTMRFSTTLEQLGVSLVKSVMTLIA
FT                   FLPVLFSFSEKVSELPVVGMVPHALVVAAIFWAAFGTGFLALVGIKLPGLEFNNQRVEA
FT                   AYRKELVYGEDHADRAQPVTLGELFRNVRHNYFRLYFHYVYFNVARIFYIQADNIFPTL
FT                   ILVPSIVAGKLTLGLMNQITNVFSQVQGSFQYLVNSWTTIIELLSIYKRLRAFEAVIRD
FT                   EPLPWLDQANLDATPSA"
FT   gene            complement(519558..520553)
FT                   /locus_tag="Oant_0486"
FT   CDS_pept        complement(519558..520553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0486"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bmb:BruAb1_0399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13217"
FT                   /db_xref="GOA:A6WW63"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW63"
FT                   /protein_id="ABS13217.1"
FT                   /translation="MRILSPRPVLLSALVLATCAAQAEPVSTKPQYVLISFDGAHDNAL
FT                   WTRSRELAKKNNAHFTYFLSCVFLMTKQDRRDYKPPHKRAGSSNVGFALSRDEVVARLG
FT                   NIWQAHLEGNEIASHGCGHFDGTDWSTADWDKEIKEFRRITADAYKNNGISGEPEGWRD
FT                   LALKGIDGFRAPYLAASKPVQDALKANGFRYQASSITRGPEEPTLAGQFASFGLPLVPE
FT                   GPSQRPIVAMDYNLYVRHSKGKEAPQQSAAFEERAYKAFRTAFDKQYTGERIPLQLGFH
FT                   FVLMNDGAYWRAMERLVTEVCTKPDVKCTTYSDYLDSLDKDAVHASQNRS"
FT   sig_peptide     complement(520482..520553)
FT                   /locus_tag="Oant_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            520757..521440
FT                   /locus_tag="Oant_0487"
FT   CDS_pept        520757..521440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13218"
FT                   /db_xref="GOA:A6WW64"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW64"
FT                   /protein_id="ABS13218.1"
FT                   /translation="MADDSFIREVNEEIRSERAKQIWRNFGPLLIGGAVAIVLGTAGWV
FT                   GYQHWVDSKASASGDKFLAALDLASEGKNDEALTALDDLEKTGYGSYPVLARLRAASVI
FT                   ADKGDAAGAVKAFDEVAADNAVPAPLRDVARLRAGYLLVDSGSYDDVAKHVETLSADGN
FT                   PMRSSAREALGLAAWKAERFDDAVKLFQQIANDSLAPANIRQRANTMLDLMRSAGVNVP
FT                   DAQST"
FT   gene            521625..523076
FT                   /locus_tag="Oant_0488"
FT   CDS_pept        521625..523076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0488"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   KEGG: bms:BR0375 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13219"
FT                   /db_xref="GOA:A6WW65"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW65"
FT                   /protein_id="ABS13219.1"
FT                   /translation="MGFTVAIVGRPNVGKSTLFNRLVGRKLALVDDLPGVTRDRRIHDA
FT                   KLYDLKFQVIDTAGLEEAANDSLEARMRAQTEAAIQEADVILFVVDAKNGLTPTDSTFA
FT                   EVVRRSGKPVVLVANKAEARGAQSGMYDAFQLGLGEPCPISAEHGQGMPDLRDAIVELL
FT                   GEERVFADEKEEETADEVFTPKAVGELIGDDIEDPDEEEIPAYDATKPLRIAIVGRPNA
FT                   GKSTLINTMLGEDRLLTGPEAGITRDSISVDWEWRGRKIKLFDTAGLRRKSRVQEKLEK
FT                   LSVADGLRAIRFAEVVIIVLDATIPFEKQDLQIADLIIREGRAPIIAFNKWDLIEDRQM
FT                   VLADLYEKTARLLPQVRGLRAVPISGERGQGIDKLMENVVKTHEIWNRRVSTGRLNRWL
FT                   AGVIAHQPPPAVSGRRLKVKYMTQVKTRPPGFVVSCSRPDAMPQSYVRYLINGLRETFD
FT                   MPGVPIRLSLRTSDNPFAGRAKKKK"
FT   gene            complement(523127..523819)
FT                   /locus_tag="Oant_0489"
FT   CDS_pept        complement(523127..523819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13220"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW66"
FT                   /protein_id="ABS13220.1"
FT                   /translation="MSTKPTIVLAHGFWGGAAHWSKAILALSRMGHDKIRAVEMPLTSL
FT                   ADDAERLSKMTVQQEGPVLLVGHSYGGAVITQAGDLPNVVGLVYIAAFAPDAGESPGGI
FT                   SQEHPPAAFPNLAPDSDGYLWIKYDKFHESFCQDLSADEALVMAITQKAPIANTFGDTI
FT                   TAPAWKKKPTWYQISSQDHMIAPENQKRMAERMNPRKTITLDASHASLASRPDEVAGLI
FT                   AEAANSVS"
FT   gene            complement(523976..524578)
FT                   /locus_tag="Oant_0490"
FT   CDS_pept        complement(523976..524578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0490"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bpa:BPP2398
FT                   putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13221"
FT                   /db_xref="GOA:A6WW67"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW67"
FT                   /protein_id="ABS13221.1"
FT                   /translation="MTNQIKGCIALGLALLCLPSVATAQNTSADNSAYIRDLVPEIRDL
FT                   VSASGSTDGKARGLSGAAQEIVEKSGNITMRETEDSIVLSVTSDVLFDFDSAKLTGKAK
FT                   ATLTDIAKILESMPDSAVRVVGYTDSKGADSYNDKLSKSRADAVTKFLVNNGVQSARLK
FT                   PEGRGESEPVAPNEIKGKDNPDGRAQNRRVEFVLPKT"
FT   sig_peptide     complement(524504..524578)
FT                   /locus_tag="Oant_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 25"
FT   gene            complement(524588..525076)
FT                   /locus_tag="Oant_0491"
FT   CDS_pept        complement(524588..525076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpe:BP2020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13222"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW68"
FT                   /protein_id="ABS13222.1"
FT                   /translation="MKAILMAFLSRTVLATVLLSTSALPHAANAQETANQPIASGYHSS
FT                   GQATAEVSGVVADGDKLTVKVRFINAKEGGSVSTTLYTALSDKDYENDYYLLAGDKKYL
FT                   LLKDSEGKPLAPASVSLFGNGHVVGVWHGVFPAPPKGQKVTLYIKGVEPLGPFAVPAE"
FT   sig_peptide     complement(524984..525076)
FT                   /locus_tag="Oant_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 31"
FT   gene            525411..526733
FT                   /locus_tag="Oant_0492"
FT   CDS_pept        525411..526733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0492"
FT                   /product="heat shock protein, Hsp70 family"
FT                   /note="KEGG: bmb:BruAb1_0402 heat shock protein, Hsp70
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13223"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW69"
FT                   /protein_id="ABS13223.1"
FT                   /translation="MTKADQSRFDGVTLGIDFGTTNTVLSVAAPDGTTVVLSVPKDGVD
FT                   ITGYRSILCFWQDRETGERTVESGPWAMDAFVNAPHSTRMLQSFKTFAASKSFTDTPVF
FT                   GKRFKFEDILATFLETVAARLGDRLPPKGNRVVIGRPVIFAGASPDEALAMQRYEKAFR
FT                   AFGFTDIHYVYEPVAAAYFYAQELNAASTVLVADFGGGTSDFSIVRFEVGKNGLSFTPL
FT                   SQTGLGIAGDTFDYRIIDNAVSPLLGKGTEYQSFGKRLTIPNHYYANFARWNTLFLMNS
FT                   PATIRDLDELARQAVDPKPLEHFINLIENDYGYEIYRAVSDLKVRLSSQRMSELHFKAD
FT                   DFEIRSDITRNDFENWIADDVRQIEQSVQQAVDKAELETSSIDRVFLTGGTSFVPVIRT
FT                   VFENRFPDAVVTSSNQFDSIANGLALIGQSADIERWSVKHD"
FT   gene            complement(526752..527435)
FT                   /locus_tag="Oant_0493"
FT   CDS_pept        complement(526752..527435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0493"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24
FT                   S26A and S26B; KEGG: rpa:RPA2696 putative signal peptidase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13224"
FT                   /db_xref="GOA:A6WW70"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW70"
FT                   /protein_id="ABS13224.1"
FT                   /translation="MQFTKAFIAGFAGVISSLLTCNTATAELMNLRVSSTSMMPVFGPG
FT                   DVVAATSYRPQEKIERGDLVVYTVDYVSKELSGDVPIKAEFLGRVIGLPGETVKIENGI
FT                   PLINGKALATTKITSTIDDGCPEETVSNSYYQCRFVRETIPEGKSYVLLNTVDHGFIDN
FT                   VKEKALARGQYYIMGDNRDNANDSRGKYVGLVSKDRIKGKIRMVSASVRKPDREWRLEG
FT                   FPGLK"
FT   sig_peptide     complement(527355..527435)
FT                   /locus_tag="Oant_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.958 at
FT                   residue 27"
FT   gene            complement(527562..527984)
FT                   /locus_tag="Oant_0494"
FT   CDS_pept        complement(527562..527984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMb21025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13225"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW71"
FT                   /protein_id="ABS13225.1"
FT                   /translation="MNTYFSPARAALLLAVAIALPAGSAFAKSACDGVTTTLTKQQKTD
FT                   YRSFIAQSLGKKVKPASVSIESFMQYGNWSVVYADVPVADPGYFFFDLSSKPPKLKDIW
FT                   GGMAERNEIPDLVKWAEKLGANKEIAACFADTATAS"
FT   sig_peptide     complement(527901..527984)
FT                   /locus_tag="Oant_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            528130..528792
FT                   /locus_tag="Oant_0495"
FT   CDS_pept        528130..528792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0495"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: ppu:PP_3185
FT                   pet18 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13226"
FT                   /db_xref="GOA:A6WW72"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW72"
FT                   /protein_id="ABS13226.1"
FT                   /translation="MPSDVKAGRFTDNLRQDAEPFWSQAVGHRLVGEIYTGTVAPDVMT
FT                   RYLVQDHRFIDCFLSLLGGTLVNCDRMEAKLTLGRFIGMISSDENSYFERSFAKLAVAD
FT                   AERFDTPDATPTAAFKELMLEAARSGSYAVCLSVLTVAEWLYLDWAEKAPKPLPDDFIF
FT                   AEWIVLHDNPYFVEFVGFLRSELDRVGPAAAEQCQQFFRRAVELEKAFFDAAYESRN"
FT   gene            complement(528793..529203)
FT                   /locus_tag="Oant_0496"
FT   CDS_pept        complement(528793..529203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0496"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   pde:Pden_3085 protein of unknown function DUF1311"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13227"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW73"
FT                   /protein_id="ABS13227.1"
FT                   /translation="MQVLKIGVIGVAFSAFAIIATAQADDCQNASSQSALNECYGKAYK
FT                   KSDAELNKIFKTLQRRADDADLKKKLVQSQRTWIAFRDAECDMQTVGGGSISGMAYSIC
FT                   LSDLTAERVSDLKKYLKCEEGDSNCPFPTASN"
FT   sig_peptide     complement(529129..529203)
FT                   /locus_tag="Oant_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.841 at
FT                   residue 25"
FT   gene            complement(529438..529830)
FT                   /locus_tag="Oant_0497"
FT   CDS_pept        complement(529438..529830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0497"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: pau:PA14_28950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13228"
FT                   /db_xref="GOA:A6WW74"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW74"
FT                   /protein_id="ABS13228.1"
FT                   /translation="MDKVTGGCLCGNVRFEATGQPYRVGICHCLDCRKHHGALFHASAI
FT                   FPEAAVTVEGETRDYAGRFFCPRCGSPVFGRSADEVEINLGSLDAPDQFKPTYELWTIR
FT                   RESWLPPFPDMKGYERDRDGSSRFED"
FT   gene            530032..531321
FT                   /locus_tag="Oant_0498"
FT   CDS_pept        530032..531321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0498"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: cell wall hydrolase SleB; KEGG:
FT                   bmb:BruAb1_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13229"
FT                   /db_xref="GOA:A6WW75"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW75"
FT                   /protein_id="ABS13229.1"
FT                   /translation="MRLVSLRALFGRRKAVAEPVWHYPVTGYCPEEGRYYAVRAKPRQT
FT                   VHKPHRLVPLVLAAMTYLFNSNAIAFQDMASLVPSADLGSHRWTAFVAKAPVGSVHQAE
FT                   MPFVDATTVTGSIATNGIEVPGIGRVALSGGKKTAKLGPDDPNPDENRINRSDKTGRLV
FT                   SVKPKAPAKAFTAGSMFDKISMITRPPEKTDAKMAFSNKLEGKEVAITMAFHAVKPPKP
FT                   RSEMPTQLAKLITNDQPDALALGYAPATPDYGKTSPFESILKPQPDEGRFVPPIGEKDH
FT                   EWAATPLPPSAFSKGEQKCLAEAVYYEARGETVKGQVAVAQVVLNRVRNPAYPGSICGV
FT                   VYQNRDWLNACQFSFACDGQKHRVTEMPQWRMAQQVAKTVSAGQIWLPEVGSATHYHAT
FT                   YVRPFWAPTMKKVAKIGLHIFYRTYGGGWS"
FT   gene            531664..532062
FT                   /locus_tag="Oant_0499"
FT   CDS_pept        531664..532062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0499"
FT                   /product="ATP sythase protein I, hypothetical"
FT                   /note="KEGG: bmb:BruAb1_0406 ATP sythase protein I,
FT                   hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13230"
FT                   /db_xref="GOA:A6WW76"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW76"
FT                   /protein_id="ABS13230.1"
FT                   /translation="MARGTEPGKPSGAIKNAKNEPGSGELDQRLNRLEAELAKKGVLKQ
FT                   PASEDERSATASSVAQAMKISSEFIAGVLVGALIGWFIDRVAGTSPWGLIVFLLLGFGA
FT                   GVLNVLRSAGYVAEQANIKSSAEKNDKK"
FT   gene            532229..532978
FT                   /locus_tag="Oant_0500"
FT   CDS_pept        532229..532978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0500"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   bme:BMEI1546 ATP synthase A chain"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13231"
FT                   /db_xref="GOA:A6WW77"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW77"
FT                   /protein_id="ABS13231.1"
FT                   /translation="MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVVASGFLY
FT                   LTSSGRGLIPTRLQSVSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFLGLF
FT                   PYFYTVTSQIIVTFALAVLVIGTVIVYGFFKHGLGFLKLFVPSGVPGIIVPLVVAIEII
FT                   SFLSRPISLSVRLFANMLAGHITLKVFAGFVVSLAALGPIGIGGAVLPLIMTVAITALE
FT                   FLVAFLQAYVFTVLTCMYINDAVHPGH"
FT   gene            533046..533273
FT                   /locus_tag="Oant_0501"
FT   CDS_pept        533046..533273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0501"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: bmb:BruAb1_0408 AtpE, ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13232"
FT                   /db_xref="GOA:A6WW78"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW78"
FT                   /protein_id="ABS13232.1"
FT                   /translation="MEAEAAKYIGAGLACFGMAGTALGLGNIFGQYLSGALRNPSAADS
FT                   QFGRLVFGFAVTEALGIFSLLIALLLLFAV"
FT   gene            533412..534029
FT                   /locus_tag="Oant_0502"
FT   CDS_pept        533412..534029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0502"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   ATPase F0 complex subunit 8; KEGG: bmb:BruAb1_0409 ATP
FT                   synthase F0, B subunit, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13233"
FT                   /db_xref="GOA:A6WW79"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW79"
FT                   /protein_id="ABS13233.1"
FT                   /translation="MFVSTAFAQTATESQPAPAAGEHGAADAVHTETGVANDAGHGSGV
FT                   FPPFDSTHYASQILWLAITFGLFYLFMSRVVLPRIGGVIETRRDRIAQDLEQAARLKQD
FT                   ADNAIAAYEQELTQARTKAASIAEAAREKGKGEADAERATAEAALERKLKEAEERIAAI
FT                   KAKAMNDVGNIAEETTAEIVEQLLGTKADKASVTAAVKASNA"
FT   gene            534040..534519
FT                   /locus_tag="Oant_0503"
FT   CDS_pept        534040..534519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0503"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   bms:BR0385 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13234"
FT                   /db_xref="GOA:A6WW80"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW80"
FT                   /protein_id="ABS13234.1"
FT                   /translation="MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEA
FT                   RTLREEAQQLLAEYHRKRKEAEKEAGDIVASAEREAKALLEDAKRATEEYVARRNKLAE
FT                   QKIATAEVDAINAVRASAVDLAVAAAGKIVADKVDTKVAGNLFKDALSQVKSNLN"
FT   gene            complement(534707..535012)
FT                   /locus_tag="Oant_0504"
FT   CDS_pept        complement(534707..535012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0504"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rle:RL2925 putative
FT                   mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13235"
FT                   /db_xref="GOA:A6WW81"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW81"
FT                   /protein_id="ABS13235.1"
FT                   /translation="MPDIVNAVLVGSQGVLLGRRSPDRRAYPNRWSFPGGHVEAGESFE
FT                   RALQREIQEELGLTLHSFSFLTTIEIASPAASFHLFTVTAWGGRPAIRDQEHTELR"
FT   gene            complement(535041..535586)
FT                   /locus_tag="Oant_0505"
FT   CDS_pept        complement(535041..535586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0505"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   pfl:PFL_6201 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13236"
FT                   /db_xref="GOA:A6WW82"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW82"
FT                   /protein_id="ABS13236.1"
FT                   /translation="MLRLCGTFCQHNNYDCRIMPTLKLDAIDRKILTALQDDARLSNVQ
FT                   LAEKIGLSPSPCLRRVKMLEKAGVIQGYHAALDRNAVGLGLTVFVGIRVERHHEETATA
FT                   FRTSVQNLPEVFSCHLVSGESDFLLQVVVPDLAAYERFLTGTLLRLPGVIDIRSNFAIQ
FT                   TVKSQGELPLAHLTGLKD"
FT   gene            535744..536361
FT                   /locus_tag="Oant_0506"
FT   CDS_pept        535744..536361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0506"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pfo:Pfl_5673 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13237"
FT                   /db_xref="GOA:A6WW83"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW83"
FT                   /protein_id="ABS13237.1"
FT                   /translation="MSEMWLYAGALAAAFLIPGPDMLLLLQTGAAQGRTHALAAAAGLA
FT                   IARACHVALAALGLAALLHAFPVAFQFVRIIGACYLVWIAIGILRHPLPTVDAAGGVRE
FT                   RRSYLASARKGLLTNLLNPKALLFCSVLLPQFVHPENGSITLQFALLGTVMTIVGLSFD
FT                   TIYAFTGSSLGSLFKRYPAIQSVQRWGFAALLFGFAAKLATV"
FT   gene            complement(536358..537020)
FT                   /locus_tag="Oant_0507"
FT   CDS_pept        complement(536358..537020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0507"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: bms:BR0386
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13238"
FT                   /db_xref="GOA:A6WW84"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW84"
FT                   /protein_id="ABS13238.1"
FT                   /translation="MKRSASDSPLLFDIPLAPDFSEEKRLLARGLKHIVGIDEAGRGPL
FT                   AGPVVAAAVVLDIDNLPNGLDDSKRLTAVKREALYETILEKAITVSVASLSARSIDASD
FT                   IRKAALEAMRRASVGLTLQPCHALIDGRDVPPGLPCPGSALVKGDQRSVSIAAASIVAK
FT                   VTRDRMMIRAGAAHPPYGLEIHAGYATVKHRAAIETTGPVPGIHRYTFAPIKGRYSV"
FT   gene            complement(537217..538389)
FT                   /locus_tag="Oant_0508"
FT   CDS_pept        complement(537217..538389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0508"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: bms:BR0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13239"
FT                   /db_xref="GOA:A6WW85"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW85"
FT                   /protein_id="ABS13239.1"
FT                   /translation="MEVIQQADIIKQADMAAFGSGRADHANAMIGEAGLRIDHARRRGR
FT                   GAGINPTGRFEPTTRHDFDDGWTTLEELPPFKTDVQIEKPRTIITRNDSPDINFDRSIN
FT                   PYRGCEHGCIYCFARPTHSYMGLSAGLDFESRLFAKPDAARLLERELAKPNYQPRTIAI
FT                   GTNTDPYQPVEKKWRIMREILEVLEAANHPVGIVTKSALVVRDIDILSRMAEKGLAKVA
FT                   LSVTTLDAHLSRTMEPRASTPTLRLQAIRKLADAGIPASVMMGPVIPGINDHEIERILD
FT                   AAYAQGAREAGYVLLRLPLEVAPLFKDWLLRNYPDRYRHVMSLVRSMRDGKDYDAEWGK
FT                   RMRGTGPYAWQIGRRFEITARKLGFNARRLQLRTDLFEPVEKGGKQLSLF"
FT   gene            538610..539116
FT                   /locus_tag="Oant_0509"
FT   CDS_pept        538610..539116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13240"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW86"
FT                   /protein_id="ABS13240.1"
FT                   /translation="MLSVVIETLNSERALAHTLSALVPAVVEGLLRRVTVIDRGSSDET
FT                   ALVALGAGCSFYAEMDIEAALAEIRTPWVLLLKPGAIPQEGWEEVLRRHMDSDGGTARF
FT                   SLPEDSGLGTVRKIFGHKATLDAGLLVRLDLLKPLLLDGVAFDLLPQHLRPVRLKHPIL
FT                   PPDED"
FT   gene            complement(539205..539438)
FT                   /locus_tag="Oant_0510"
FT   CDS_pept        complement(539205..539438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13241"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW87"
FT                   /protein_id="ABS13241.1"
FT                   /translation="MKKFALAAVAVALSAGAAFAENPHVGEPADLYENDRTPVATQSQK
FT                   LDYTAPASIKAPVYQDGSAHRFGDASPSSYQN"
FT   sig_peptide     complement(539376..539438)
FT                   /locus_tag="Oant_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(539634..539861)
FT                   /locus_tag="Oant_0511"
FT   CDS_pept        complement(539634..539861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13242"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW88"
FT                   /protein_id="ABS13242.1"
FT                   /translation="MKKIVLAAAALALSAGAAFAENPRVGEPADLYANDRTPVASQKVD
FT                   YTAPASISQSSFQDGSAHRFGDASPSSYQN"
FT   sig_peptide     complement(539799..539861)
FT                   /locus_tag="Oant_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(540181..541050)
FT                   /locus_tag="Oant_0512"
FT   CDS_pept        complement(540181..541050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0512"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: bmb:BruAb1_0418 IspE,
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13243"
FT                   /db_xref="GOA:A6WW89"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW89"
FT                   /protein_id="ABS13243.1"
FT                   /translation="MTRLAPAKINLALHVTGRRDDGYHLLDMLVVFARYGDIIRIEHAE
FT                   KDSFTVSGPFAKGIPLDGGNLVLKAREALRDHTQRALPPVAVHLEKNLPIASGIGGGSS
FT                   DAAATLLALDELWGLDLGLEQLAAMGLTLGADLPMCLHGASKGTPLAARGIGEDLSPVV
FT                   GFPALPMLLVNDGTAVATPDVFRALDKRDHPALNLGSHADIAPLCAYLQTTRNDLLPPA
FT                   LKLAPQIGDKLDLLRASGSLYAQMSGSGATCYAIYEDMAATERAAALLLAERPDWFVVA
FT                   TQTAPSQK"
FT   gene            complement(541301..541486)
FT                   /locus_tag="Oant_0513"
FT   CDS_pept        complement(541301..541486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13244"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW90"
FT                   /protein_id="ABS13244.1"
FT                   /translation="MPQLIFLLLIIAAAWYGYRSFKREASRVSQRVRQAEKEAQNRAQG
FT                   TLVQDPKTGEYYVKKD"
FT   gene            complement(541665..542537)
FT                   /locus_tag="Oant_0514"
FT   CDS_pept        complement(541665..542537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0514"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: bms:BR0396 protease IV,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13245"
FT                   /db_xref="GOA:A6WW91"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW91"
FT                   /protein_id="ABS13245.1"
FT                   /translation="MPGLLTRLVPRRFRPVSIEIPVVRLHGAIMSGGSAFRPMLSLAST
FT                   AAVLEKAFTDKETPAVAISLNSPGGSPVQSRLIYRRIRDLAAEHQKKVFIFVEDVAASG
FT                   GYMIALAGDEIIADPSSIVGSIGVVSASFGFPELLKKIGVERRVYTAGSNKVTLDPFQP
FT                   EKKTDIERLKSLQLEIHETFIDMVKERRGTKLAEDKDLFTGLFWTGIKGHELGLIDGLG
FT                   DMRSFLRKTYGDKVKLKLVEQKRGLLGRKMPGIDMALGNLEPASIAAHLGDGLLSVAEE
FT                   KALWGRYGL"
FT   gene            complement(542656..543837)
FT                   /locus_tag="Oant_0515"
FT   CDS_pept        complement(542656..543837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0515"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na?
FT                   antiporter NhaA; KEGG: bms:BR0397 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13246"
FT                   /db_xref="GOA:A6WW92"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW92"
FT                   /protein_id="ABS13246.1"
FT                   /translation="MNHSPNQSRPVSIMRRFLDSESAGGVSLMVAAALALIVANSPFSQ
FT                   AYFDILHTHIGPLSLTDWINDALMAVFFLLVGLEIKREFLDGQLASWPNRMLPGIAAAG
FT                   GVILPAIIFTAFNWHDPAKVRGWAVPSATDIAFALGVLSLLGSRVPSSLKVFLATLAIL
FT                   DDLAAVVIIAIFYTAEISMPYLGGAFAAAIVLFVMNRMGVMKLLPYLIGGAALWFFVLN
FT                   SGVHATVAGVVTALMIPLKAAPGRPDDMTSPLHVLEHALAKPVAFIIVPIFGFANAGIS
FT                   FAGLDASVMRDTLTLGIMLGLFIGKQLGVFGAAWLAIKTGLAQKPLGATWIQLYGVAVL
FT                   CGIGFTMSIFIGLLSFPSDLMQAETKIGVLAGSGLSAICGYILLRLVTKPKNT"
FT   sig_peptide     complement(543697..543837)
FT                   /locus_tag="Oant_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.428 at
FT                   residue 47"
FT   gene            544049..544390
FT                   /locus_tag="Oant_0516"
FT   CDS_pept        544049..544390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_PE00140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13247"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW93"
FT                   /protein_id="ABS13247.1"
FT                   /translation="MVLTAIFAQLNCSDLERSTEWFATIFDRNPDARPMQGLAEWHHGL
FT                   SAGFQLYQNPAEAGHGTLTLIVHDVRAEHARLSFDGIRPGNVEIADYTTILRLHDPDRN
FT                   LVVLAQPRF"
FT   gene            complement(544387..545181)
FT                   /locus_tag="Oant_0517"
FT   CDS_pept        complement(544387..545181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0517"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: bme:BMEI1534
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13248"
FT                   /db_xref="GOA:A6WW94"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW94"
FT                   /protein_id="ABS13248.1"
FT                   /translation="MTSEASFETEDEAGETLDVFHRGAFHLIQPALKGHRSGVDAMILA
FT                   SSVPNGFAGRVADLGSGAGAAGLAVASRCPDANITLVERSAFMAGFARRSVAHPLNAAL
FT                   AGRISVIEADVGLRGKARIAAGLVDNSFDFVIMNPPFNEARDRSTPDPLKAEAHVMPEG
FT                   MFEQWVRTAAAIVKPGGGIAIIARPGSISSILEALSGRFGGLRIIPVQPRPEAAAIRIV
FT                   VTGTRGSRAGLSLMPALVLHGSDGHGFTPRANGINNGLDALI"
FT   gene            complement(545178..545402)
FT                   /locus_tag="Oant_0518"
FT   CDS_pept        complement(545178..545402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13249"
FT                   /db_xref="GOA:A6WW95"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW95"
FT                   /protein_id="ABS13249.1"
FT                   /translation="MIELIRTNDSVLLSFAEALMKEAGIAYFIADTNMSIIEGSLGVLP
FT                   RRLLVSEEQLEEARQILIDAEIEHELRDR"
FT   gene            545508..546578
FT                   /locus_tag="Oant_0519"
FT   CDS_pept        545508..546578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0519"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: bme:BMEI1532
FT                   farnesyl pyrophosphate synthetase /
FT                   geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13250"
FT                   /db_xref="GOA:A6WW96"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW96"
FT                   /protein_id="ABS13250.1"
FT                   /translation="MSNPVRFNNVAGQLGEMALGVVLNLDGKKKQEGSVQPLVDLTKAD
FT                   MARVNEMILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLAAARMFGYEGDGHVRLATA
FT                   VEFMHTATLLHDDVVDESDLRRGKSTARMIWGNQASVLVGDFLLGQAFKMMVDVGSLDA
FT                   LDVLATSASVIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALFSAAGEVGPIIAGAQR
FT                   SDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGKITLPVILSYRRGTD
FT                   DERAFWKHAIEDGASDDASLEKAIGLMTKHGAIADTVQRARHFGEIARDALAPLKATPQ
FT                   KDALIEVIDFCISRVN"
FT   gene            546796..548661
FT                   /locus_tag="Oant_0520"
FT   CDS_pept        546796..548661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0520"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bmb:BruAb1_0425 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13251"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW97"
FT                   /protein_id="ABS13251.1"
FT                   /translation="MRQGSKYRPLYGLLLSLLAGIAIPTSGALAKATNDPAPPPVRAGS
FT                   FAGAYLAGRTAESDNNLATAVDFYRQAMAFDPGNAQIKQDLLLVLLTEGRFKDALPLAE
FT                   ELKNVPDIERFSRVALAIDAIDRKQYRKVGQLLMLSLQSDMDRLATGFMSAWVKVGQGN
FT                   PKQALADIQKMQGPEWYGLFRTYNSALIADLAGQKQEARDFYQQAIDDRPGGSAAPDTY
FT                   ERIVMAYASFKLRQGDKEGAIKTLNDAAELLNGRMTITEMREKIEAGEKYGRLIKTAQE
FT                   GTAEALYTLGTAINRSGAEAFAKLYLQMSLPLRPDNDATLYQLGDISAKLRQPEKAIDY
FT                   YGRVPEKSPYRRDAEMQRALNLAENDQSADAVKQLRVLLDRDKTDMRTYLALGGVYAQD
FT                   KNFADAAKIYDAAVEQIKTPERKDWPVFYQRGIAYERLKQWDKAEPNFRKALELYPDQP
FT                   QVLNYLGYSWVDRGENLDEALGMIKKAVELRPQDGYIVDSLGWAYYMLGRYDEAVVELE
FT                   KAVKLRPEDPTINDHMGDAYWRVGRLLEATFQWNHAIAGKPEPEDLVKIEAKLKKGLPD
FT                   IPGQSSADAAKPDEKKPVEQKPEAPEQSPAPAAPSDKAPEKPATD"
FT   sig_peptide     546796..546888
FT                   /locus_tag="Oant_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 31"
FT   gene            548802..549737
FT                   /locus_tag="Oant_0521"
FT   CDS_pept        548802..549737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0521"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit; KEGG:
FT                   bms:BR0403 glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13252"
FT                   /db_xref="GOA:A6WW98"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WW98"
FT                   /protein_id="ABS13252.1"
FT                   /translation="MHPTRSFQGLILTLHNYWAEHGCAILQPYDMEVGAGTFHPATTLR
FT                   SLGPKPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVIIKPSPPNLQDLYLGSLRAIG
FT                   LDPTLHDVRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVSGELTY
FT                   GLERLAMYVQGVDNVYDLNFNGLEGDEKVTYGEVFLQAEQEYSRYNFEMANTEALRQHF
FT                   IDAERECEAILKAGAPGPNANHQMHKSVFPAYDQCIKASHVFNLMDARGVISVTERQSY
FT                   ILRVRNLARQCGEAFLLTDAGGFNFKREGE"
FT   gene            549743..552037
FT                   /locus_tag="Oant_0522"
FT   CDS_pept        549743..552037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0522"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, beta subunit; KEGG:
FT                   bme:BMEI1529 glycyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13253"
FT                   /db_xref="GOA:A6WW99"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A6WW99"
FT                   /protein_id="ABS13253.1"
FT                   /translation="MPDLLLELFSEEIPARMQRKAAGDLKKMITDGLVEAGLTYEAATP
FT                   YWTPRRLTLDIRGLTVRSKDVHEDIKGPSVTAPEQAIQGFLRKAGLTDVAQAHVHSDPK
FT                   KGDFYVAHLTKPGRAAEEIVAELVPQTIRNFPWPKSMRWGAASARPGSLRWVRPLQSIL
FT                   CTFGPETEETVVIDFDVDGIKSGNVTYGHRFLSDGQPIKVRRFEDYVEKLEKAFVVLDA
FT                   ERRKEIISQDAHNLAFASGLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIR
FT                   LTIRANQKCFVTRKQGEAEALSNKFILVSNIAARDGGTEIAYGNGKVVRARLSDALYFW
FT                   HTDQHDLPDLDKLVASAEKFGLDLKKPLDQRMARLDALNVTFHAKLGTQGARVERIREL
FT                   AAQIAPLVGADPKLAARAAVLAKADLTTEVVGEFPELQGAMGRKYALLQGEDEAVAAAI
FT                   EEHYKPQGPSDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPFALRRAALGVIR
FT                   LLLSQEWKFPLLPLFRSAFAALKEGQVQRKLREFETKLAGENSGDIDGEQDVDNALASY
FT                   EKQVRAEAEASSEPVLADLLSFLHDRFKVHLKEEGARYDAIDAVLSPEADNLLLVARRL
FT                   EALIVFINEEDGKNLLAGTKRAANILAAEEKKGTKVADSVSASLLHEAEEKALFEAVTL
FT                   ASQDAEAAIAREDFNGAMLALAKLRGPVDTFFEKVLVNDEDENVRANRLALLDQIRAAT
FT                   GKVADFSKIAG"
FT   gene            complement(552087..552494)
FT                   /locus_tag="Oant_0523"
FT   CDS_pept        complement(552087..552494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13254"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA0"
FT                   /protein_id="ABS13254.1"
FT                   /translation="MLSRFIAISLTAIGLPAIASANGGERAALTYQVGSIDYIGYDKIG
FT                   ANGLPVCGTCAQKQAAELDAQKEIEARRKRARAYMARMQGQPVPDDLLEPAAAPAEDFD
FT                   PTKPVRVVGDPWAGASDEIDLSSLELRPSLK"
FT   sig_peptide     complement(552429..552494)
FT                   /locus_tag="Oant_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.700 at
FT                   residue 22"
FT   gene            552767..553765
FT                   /locus_tag="Oant_0524"
FT   CDS_pept        552767..553765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0524"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   bmb:BruAb1_0428 Sua5/YciO/YrdC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13255"
FT                   /db_xref="GOA:A6WWA1"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA1"
FT                   /protein_id="ABS13255.1"
FT                   /translation="MGRSRGGKPVSDIVKFDDEAVQRAVEVLRRGGLVAIPTETVYGLA
FT                   ADAANGEGVAGIFAAKGRPQFNPLIAHVSGIAMAERYVTFDALSRKLAEMFWPGPLTIV
FT                   LPLKDRQDTDRPIHPLVTAGLSTLAIRMPLGRVRDIIEGLDSPVAAPSANTSGRISPTS
FT                   ARAVADDLGNKLDLILDAGPCGVGVESTIVKVDGNKVHLLRPGGLAAEEIEAVIGEKLV
FT                   RADHTSAIQAPGMMASHYAPDAAMRLGVGSVQPGEALLAFGPQRVAGADTAKVIMNLSA
FT                   DGNLREAAANLFDFMRRLDATGATTIAVEPIPFEGLGEAINDRLKRAAAPR"
FT   gene            553791..555203
FT                   /locus_tag="Oant_0525"
FT   CDS_pept        553791..555203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0525"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bms:BR0406 oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13256"
FT                   /db_xref="GOA:A6WWA2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA2"
FT                   /protein_id="ABS13256.1"
FT                   /translation="MLDTALIERFSAIVGEKNALTAPEDLAAYLVEQRDLYHGRTPLVL
FT                   RPGSTEEVAAIMKLASETKTPVVPQGGNTGLVGGQQPDESGAAITLSLGRMNRIRNLDT
FT                   VGNLVTLEAGVILKNLQEAAEKAGRLFPLSLGAEGSCQIGGNLGSNAGGTAVLAYGNMR
FT                   ELCLGLEVVLPTGEILNDLRYVKKDNTGYDLKDLFIGSEGTLGVITAAVLNIFPQPKGK
FT                   GVAYAGLRNPEDVLRLFQLATEHAGPSLTGFELMPRVGVEFTVRHVDGVRDPLESPHDW
FT                   YVLIDISSTRSEEDARTTLETILTEAFENDIIQDAAIGESVAQAQSFWKMREEMSWAQK
FT                   PEGGSIKHDISVPVASIPAFIHEANAATLEMIPGARIVCFGHIGDGNLHYNVSQPVGAD
FT                   KEAFLARWHELNHRIHTIVASYTGSISAEHGIGQLKREELAFFKQDVALDLMRRIKSAF
FT                   DPAGIMNPGKVL"
FT   gene            555473..556039
FT                   /locus_tag="Oant_0526"
FT   CDS_pept        555473..556039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13257"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA3"
FT                   /protein_id="ABS13257.1"
FT                   /translation="MMSKGLKPDWAGRELRLDPFHFPQVVSYATHDGSSDVTFTINERG
FT                   AVIRQVLPSSGLPMSIALPANAFVGVAARAVEDEFGEITVTLELMHEDPQLSVPLLVAH
FT                   DLTDVAADWRAWAASFNLPMMLVEEDGVARPLYESTGAVRTSQPQARRQGQEPRRRRPR
FT                   FLARRKTGTLGVRLVISGKEIIARN"
FT   gene            complement(556186..556935)
FT                   /locus_tag="Oant_0527"
FT   CDS_pept        complement(556186..556935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0527"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bme:BMEI1522 DBI-related protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13258"
FT                   /db_xref="GOA:A6WWA4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA4"
FT                   /protein_id="ABS13258.1"
FT                   /translation="MSEHILIERKGAIQIIRLNRADKKNAITRAMYATMAKALKDGDAD
FT                   DAVRVHVFLGVPGAFSSGNDMQDFMAAAMGGDLGNDILDFLGALSSAKKPIVSGVDGLA
FT                   IGIGTTIHLHCDLTFATSRALFRTPFVDLGLVPEAASSLLAPPLMGHQKAFALLALGHG
FT                   FTAEAAQEAGIVYQIVAEDALETEVMKAAEEIAVKPPQAMQIARALMRMPAEKVSERIA
FT                   REAKHFAERLTSDEAREAVMAFLSRKK"
FT   gene            complement(556938..558716)
FT                   /locus_tag="Oant_0528"
FT   CDS_pept        complement(556938..558716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0528"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bmb:BruAb1_0435
FT                   acyl-CoA dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13259"
FT                   /db_xref="GOA:A6WWA5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA5"
FT                   /protein_id="ABS13259.1"
FT                   /translation="MYRAPVSEISHTLMKVAGLEKALDDNRFPDFSADLAAAILEEAGK
FT                   FASERVEPLRITGDKHGATVKDGVVTTAPGWKELYRDWIEGGWNSLTGTPEYGGQGLPT
FT                   MMSVAVSEMWNSGTLAFAIAPTLTMGAVEAVEKHASKELKDIYLEKLISGEWMGTMNLT
FT                   EPHAGSDLGVMRTRAERAGDGSYRIFGQKIFITYGEHDLTDNIVHLVLARLPDAPAGTK
FT                   GISLFLVPKFLVNDDGSLGRRNDLFCSGLEHKMGIHASPTCTMIYGDGFVKGEEQGAVG
FT                   YLIGEENRGLACMFTMMNNARLLVGIQGVGVAEAAYQQALAYAKERKQGRAIGADPKQG
FT                   MSPIIEHPDVQRMLLTMKALTQVARSITYSCAHAIDMSHATEGADQQFWSDRAGLLTPL
FT                   AKSFATDAGVDVASLGIQIHGGMGFIEETGAAQLLRDARITPIYEGTNGIQAIDLVARK
FT                   LPLGHGEHIKGFLAELQDDADKAAASNRPELGETGARLSKAINEAREATDWLQKAVAEG
FT                   QLEAALAGASPYQRLLSLVSGGAYLARAALADDDSGRAVLSRFFAENMLAEVSSLKDTV
FT                   ITGAASLAAAKSALEA"
FT   gene            complement(559021..560310)
FT                   /locus_tag="Oant_0529"
FT   CDS_pept        complement(559021..560310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0529"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201; KEGG: bmb:BruAb1_0437 PurD,
FT                   phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13260"
FT                   /db_xref="GOA:A6WWA6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA6"
FT                   /protein_id="ABS13260.1"
FT                   /translation="MRVLLIGSGGREHALAWKLSASPSLTKLYCAPGNPGIATIAELVD
FT                   IGVDDHQALIAFAKDKKIDLVVVGPEAPLVAGLSDEMRAEGIRVFGPSKAAAQLEGSKG
FT                   FTKDLCARFDIPTGAYGRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVIVAMTLDEAL
FT                   DAVDACFEGAFGSAGAEVVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGP
FT                   NTGGMGAYAPAPVMTPEIVERTMRELIEPTMRGMAEIGAPFSGILFLGLMIGKDGPKLI
FT                   EYNTRFGDPECQVLMMRLNSDLLALINAAVDGKLDEVSLDWKNQPALTVVMAAEGYPSN
FT                   VKKGSVIRDLDKLEGIDGVKLFHAGTAEKDGSIVASGGRVLNITAIADTVAEAQARAYE
FT                   AVKLIDWPEGFYRSDIGWRAVERETQADKK"
FT   gene            560342..561370
FT                   /locus_tag="Oant_0530"
FT   CDS_pept        560342..561370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0530"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: bmb:BruAb1_0438 UbiA,
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13261"
FT                   /db_xref="GOA:A6WWA7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA7"
FT                   /protein_id="ABS13261.1"
FT                   /translation="MAAYIKDFAMSQPELHGSIQSRNAQGRVKDAPSGHWVYKLLPHWL
FT                   WPYAQLARWDRPIGWQLLLWPCWWSAALVAGAGAKPGDGAWAVMPSIWHLVLFLIGAIA
FT                   MRGSGCTYNDLVDQDIDDKVDRTRSRPLPSGQVTRGQAKIFLVLQALVGLVVVLQFNWF
FT                   TIGLGIFSLLIVAAYPFMKRITNWPQFVLGLAFSWGALMGWAAVEGSLSLAPVLLYIGA
FT                   ILWTIGYDTIYAHQDKEDDALVGVRSTARLFGKHTKTALMILYGGAIGFFAAAFAVAQV
FT                   PMPALAGLLAAGVHLYRQIIVLDIDNPDQCLKLFKSNNIVGWLIFLGLVLGSLWVAVKP
FT                   LV"
FT   gene            complement(561412..562062)
FT                   /locus_tag="Oant_0531"
FT   CDS_pept        complement(561412..562062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0531"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   KEGG: bmb:BruAb1_0439 PdxH, pyridoxamine 5-phosphate
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13262"
FT                   /db_xref="GOA:A6WWA8"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWA8"
FT                   /protein_id="ABS13262.1"
FT                   /translation="MIRKFRQAFEISKMTNASDDFTESSQPFKLFADWLTDAKASEPND
FT                   PNAVALATVDPDGLPNVRMVLLKDFDEQGFVFYTNYESTKGKEILSAEKAAMCFHWKTL
FT                   RRQVRVRGAVEKVSDAEADAYYASRPRGSRIGAWASKQSRPLESRFALEKAVAEYTAKY
FT                   AIGDIPRPSYWSGFRIRPVSIEFWHDRAFRLHDRVLFTRPAPEGDWNKERLYP"
FT   gene            562231..563433
FT                   /locus_tag="Oant_0532"
FT   CDS_pept        562231..563433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0532"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: nha:Nham_2861 diguanylate cyclase
FT                   (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13263"
FT                   /db_xref="GOA:A6WWA9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWA9"
FT                   /protein_id="ABS13263.1"
FT                   /translation="MPKLDFLTLYIVILLNSLTVCIIWTAIAFSYRKFRPARIWLLSTT
FT                   LLLVGGFVLSLQGNEGAFWPAVTGNTIIIYGFCLAWVGARYFYGHKGGWRLAMGISLAS
FT                   FAVMAAFHSSWQGRNIAYAVGQSVPMGMTVFYLARQKGIGLGGQIAIMAFLLGIIGHAI
FT                   ETSLNIAAWVGEFDQSLYFTIESYALVCVIYSGMIWNFGFIVMAMNRLHGDMAKVAETD
FT                   ELTGLPNRRHFMKRLARAELAFSEDGTAYSVMLIDIDNFKQWNDTYGHALGDQALVHFA
FT                   DVAVDVLNRRGVLARLGGDEFSILLTKMDEQEATEIARDIVRAINDAPLAFNGQKLAMT
FT                   VSIGIASEERDNETSDLDVFARADLALYKVKQAGRNGYATRTATVNAPCSSFSDGQRAA
FT                   G"
FT   gene            563509..564081
FT                   /locus_tag="Oant_0533"
FT   CDS_pept        563509..564081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13264"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB0"
FT                   /protein_id="ABS13264.1"
FT                   /translation="MLRFRFVYLSGTLLVNSSSLIIPASLACKNKGIALAVETLRHKDN
FT                   LWSLSCRANALRKAVIGICILSLAGCAMGGVSIEKAVPDSSTITGSVKQPQPVETDTGK
FT                   LSDQSAIRNVVSALNFTEWGKKPVPWANPDTGSQGTITTIAENSKNNQLCREFETSREA
FT                   FDGVSIYRGETCMQRGGQWTVTSFAPI"
FT   sig_peptide     563509..563592
FT                   /locus_tag="Oant_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.846 at
FT                   residue 28"
FT   gene            564184..565140
FT                   /locus_tag="Oant_0534"
FT   CDS_pept        564184..565140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0534"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: bmb:BruAb1_0441
FT                   chaperone protein DnaJ, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13265"
FT                   /db_xref="GOA:A6WWB1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB1"
FT                   /protein_id="ABS13265.1"
FT                   /translation="MRDPYSVLGVAKTAKPEEIKSAFRKLAKKHHPDQNKDDPKAQERF
FT                   AELNQAYEIVGDKDKRGQFDRGEIDAEGKPAFQGFTGGQGFGGAHGDPFGGFRQGGDGN
FT                   SHFEFRSGPGGFQQGGGFGGADDILNDLFGGAFGGGARAGGGARQRGPAKGADLSASIN
FT                   ITLEQAAGAEKVEAIFPNGKHLKIKLPRFVEDGQTIRLKGQGEPLMGGTAGDALVTIHF
FT                   KAHPRFRLEGRDVHVDMPVELADAVLGGKQEVETLDGRIAVKIPAWSSSDRVLRLKEKG
FT                   LPLKADGRGDLYVHVRIMLPEGGDKELEEFLQKRRVA"
FT   gene            565355..566173
FT                   /locus_tag="Oant_0535"
FT   CDS_pept        565355..566173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0535"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bmb:BruAb1_0443 FabI-1, enoyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13266"
FT                   /db_xref="GOA:A6WWB2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB2"
FT                   /protein_id="ABS13266.1"
FT                   /translation="MTAQSGLLQGKRGLILGVANNRSIAWGIAKAARDAGAELAFTYQG
FT                   DALKKRVEPLAEELGAFVAGHCDVADAASMDAVFETLEKKWGKLDFVVHAIGFSDKDEL
FT                   TGRYVDTSEANFTNTMLISVYSLTAISRRAEKLMADGGSILTLTYYGAEKVMPNYNVMG
FT                   VAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRT
FT                   VTIEEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGMKAVDAPDISVVKD"
FT   gene            566288..566878
FT                   /locus_tag="Oant_0536"
FT   CDS_pept        566288..566878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0536"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bme:BMEI1511
FT                   phosphoglycerate mutase/fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13267"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB3"
FT                   /protein_id="ABS13267.1"
FT                   /translation="MAREIIYFSRHGETDWNVSQRIQGQLDIDINDNGRSQADRNGDML
FT                   RSLIGEGAGFDFVASPLRRTRETMERIRLRMGLDPYEYRTDPQLMEVNFGDWQGFMMED
FT                   IAREREDLLEARARDKWNFVPPGTTAESYMGLSRRIGRWVEAVEWPTICVTHGGCIRTL
FT                   FYLYGDMDGHAAANLSIPQDKILKFANGKLEWV"
FT   gene            566938..567696
FT                   /locus_tag="Oant_0537"
FT   CDS_pept        566938..567696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0537"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rpb:RPB_0631
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13268"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB4"
FT                   /protein_id="ABS13268.1"
FT                   /translation="MPFERFAVISDIHGNNDALAAVLADIDALQIQTIINLGDHLSGPL
FT                   AARETADMLMAREMICIRGNHDRWLVEKPLADMAPSDRVARQQLDDRHIEWLLGMPASQ
FT                   SLVDGRIFICHGTPSSDTTYWMEKVTANGEVVLRTRDEIEAEAEDIAASLIFCGHTHTP
FT                   RIVRLGDGRMLVNPGSVGCPGYDDDHPVPHVVQTGNPNASYAVIEQTGSGWQITLRNIP
FT                   YDTARMVRMAENNGRADWARVVRSGWFQPT"
FT   gene            complement(567741..567992)
FT                   /locus_tag="Oant_0538"
FT   CDS_pept        complement(567741..567992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0538"
FT                   /product="protein of unknown function DUF1344"
FT                   /note="PFAM: protein of unknown function DUF1344; KEGG:
FT                   bmb:BruAb1_0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13269"
FT                   /db_xref="InterPro:IPR009780"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB5"
FT                   /protein_id="ABS13269.1"
FT                   /translation="MHYLVGLILIVASLFSTVAMADDAEGKITGINKDSETITLDDGQT
FT                   YKLPGEFDYSAINKGMKVLIIYDMVDSTRFITDIQEAP"
FT   sig_peptide     complement(567927..567992)
FT                   /locus_tag="Oant_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            568275..569369
FT                   /locus_tag="Oant_0539"
FT   CDS_pept        568275..569369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0539"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: bmb:BruAb1_0450
FT                   AroC, chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13270"
FT                   /db_xref="GOA:A6WWB6"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWB6"
FT                   /protein_id="ABS13270.1"
FT                   /translation="MSHNSFGHLFRVTTWGESHGLALGCVVDGCPPGITFTEAEIQAYL
FT                   DKRKPGQSKYTTQRREPDQVRVLSGVLLGDDGVTMTTTGTPISMMIENTDQRSKDYGEI
FT                   ARQYRPGHADYTYDVKYGIRDYRGGGRSSARETAARVAAGAIARKVVPGLEVKGALVAM
FT                   GVHGIDRRRWNWSEVDNNPFFSPDAGSVELFADYLDGIRKSGSSVGAVIEIIAEGVPAG
FT                   IGAPIYGKLDQDIASLLMSINAVKGVEIGNGFEAARLTGEENADEMRIGNDGKPLFLSN
FT                   HAGGILGGIATGAPVVARFAVKPTSSILTPRRSIDKDGKEVDVMTKGRHDPCVGIRAVP
FT                   IGEAMVACAIADHYLRHRGQTGRV"
FT   gene            569472..570587
FT                   /locus_tag="Oant_0540"
FT   CDS_pept        569472..570587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0540"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; GTP cyclohydrolase II; KEGG: bme:BMEI1505 GTP
FT                   cyclohydrolase II / 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13271"
FT                   /db_xref="GOA:A6WWB7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB7"
FT                   /protein_id="ABS13271.1"
FT                   /translation="MSYNQKQVVDALRAFERGEIVVVMDDDGRENEGDLIVAAVHCTPE
FT                   KMAFIVRHTSGIVCTPMTRDEAKRLNLAPMVAENESAHTTAFTVTVDYRHGTTTGISAE
FT                   DRTLTVRNLANPNAGASDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLANLPPIGV
FT                   ICELVNDDGSVMRGPDVKAFAEKHTLHRVTVADLIAYRQRKETLVKRVGDAPVKTCAGA
FT                   AHAYTYELPWEPMQHVAVVFGDIRDGEEVPVRLHREDVLNDVFGKGGSNLDAIMEKMGK
FT                   EGRGVLVYLREGSVGVRSDHHDTRARDAIQSEHESHAEAVAREEEWRQIGLGAQILKDL
FT                   GITSIVLLASRERHYVGLEGFGIHIARTEII"
FT   gene            570655..571605
FT                   /locus_tag="Oant_0541"
FT   CDS_pept        570655..571605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0541"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   bms:BR0430 histone deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13272"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB8"
FT                   /protein_id="ABS13272.1"
FT                   /translation="MTTRLYWHPIYLEHLTPPGHPERPDRIRALMSELEGPDFYRLDRV
FT                   EAPRGDEASVLLAHPEKHLEAIRAEIPEPASDEAAPAPVVKLDGDTYVSPKSLDAALTA
FT                   IGAATAAVDDVFSGAANNVFVAARPPGHHAERSTAMGFCLFNNIAIAARHAQQRHGAER
FT                   VAIVDWDVHHGNGTQDIFRDDPSVLFCSTHQFPLYPGTGSKDETGVGNIFNAPLSPDTG
FT                   SREFREAFNSRVLPALDNFRPDLILISAGFDAHFRDPLAELNLDEADFDWATGKLMERA
FT                   ERFCDHRLVSVLEGGYDLEGLSQSASTHITRLLKG"
FT   gene            571609..571863
FT                   /locus_tag="Oant_0542"
FT   CDS_pept        571609..571863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0542"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG: bmb:BruAb1_0453
FT                   XseB, exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13273"
FT                   /db_xref="GOA:A6WWB9"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWB9"
FT                   /protein_id="ABS13273.1"
FT                   /translation="MVTEPSNADIAVMSFEDALKQLEKIVDDLERGDVPLEESIRIYER
FT                   GEALKKHCDTLLKSAEDKVEKIRIGRDGQPVGTEPLDPE"
FT   gene            complement(571883..572401)
FT                   /locus_tag="Oant_0543"
FT   CDS_pept        complement(571883..572401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0543"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   bmb:BruAb1_0454 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13274"
FT                   /db_xref="GOA:A6WWC0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC0"
FT                   /protein_id="ABS13274.1"
FT                   /translation="MSFLEPYIAAYGALALFVIVYFESFGAPLPGESALIASSLLALHG
FT                   TLNIEAVLIAVFIGAVLGDCTGYLIGRFGGRRLILRYGHLVKLTPERLEQFEKLFDSKG
FT                   IYVVATARFVVLLRQLNGIVAGSMKMNPLHFLAANIVAAAGWTLVWGLGPYMLSGILAP
FT                   YVTQLKTLF"
FT   gene            complement(572478..572741)
FT                   /locus_tag="Oant_0544"
FT   CDS_pept        complement(572478..572741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0544"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   bms:BR0433 transglycosylase-associated protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13275"
FT                   /db_xref="GOA:A6WWC1"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC1"
FT                   /protein_id="ABS13275.1"
FT                   /translation="MSVISWIILGLIAGFIGSKIVNKSGQGLFLDIALGIVGAIVGGVI
FT                   SSQLFGRGVTGAFDPISLVIAIIGSIIVLWVYHAITGKRSIG"
FT   gene            572905..573465
FT                   /locus_tag="Oant_0545"
FT   CDS_pept        572905..573465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0545"
FT                   /product="protein of unknown function DUF937"
FT                   /note="PFAM: protein of unknown function DUF937; KEGG:
FT                   bms:BR0434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13276"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC2"
FT                   /protein_id="ABS13276.1"
FT                   /translation="MGSYDDNSGNSPIPGGSLAKPVLIALGALLIGKMLKGNSEETEAT
FT                   QAQPVPVPDQSQAGGGLLGGILGGLGGLLGGAAAGNASAAPSAPGSLGGGLGGLLDQLK
FT                   QAGLGEKVDSWVGQGTNHSIEPGQLGDAIGQKTLSEIAQHAGIDQQELLDQLSQVLPGL
FT                   VDKLTTNGQVPDASSLSKLLQGR"
FT   gene            573589..574509
FT                   /locus_tag="Oant_0546"
FT   CDS_pept        573589..574509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0546"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: bme:BMEI1499
FT                   pirin"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13277"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC3"
FT                   /protein_id="ABS13277.1"
FT                   /translation="MSFFPCPDPVLGDKTSVDSIETLVIPRTSDIGGLEVRRALPTVRR
FT                   RLVGPFIFFDRMGPAVLRDGDALDVRPHPHIGLSTVTYLFDGHIRHRDSLGTEMVIRPG
FT                   DANLMTAGRGIVHSERSPEEERNGPLSISGIQTWLALPDALEEISPEFFHTNAPELPVM
FT                   EDRDFSGRLIMGSMLGLKSPVIQHADTLYADIRIEPNGRFPIPPVAEERAIYTLQGNVG
FT                   IGGEVFPPDRLLAFRPGDDIVVQAGPEGAHIMLFGGATLGSKRYVWWNFVSSSRERIEQ
FT                   AKEEWRSGRFDIVPGDEKDFIPLPE"
FT   gene            574613..576529
FT                   /locus_tag="Oant_0547"
FT   CDS_pept        574613..576529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0547"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   KEGG: bms:BR0436 deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13278"
FT                   /db_xref="GOA:A6WWC4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWC4"
FT                   /protein_id="ABS13278.1"
FT                   /translation="MSRPTTPLLDKAPIPEALRALPESDLPQLAQELRAELIDVVSTTG
FT                   GHLGAGLGVVELTVALHHVFDTPHDRIIWDVGHQAYPHKILTGRRDRIRTLRQTGGLSG
FT                   FTKRTESEYDPFGAAHSSTSISAGLGMAVASDLSGEKRNVIAVIGDGSMSAGMAYEAMN
FT                   NAGALDARLIVILNDNDMSIAPPTGAMSAYLARLVSGKTYRSVREAAKQVAKKLPKFLQ
FT                   DKARKSEEYARAFFTGGTLFEELGFYYVGPIDGHNLDHLLPILKNVRDTQEGPVLIHVV
FT                   TQKGKGYAPAEAAADKYHGVNKFDVITGKQSKPPANAPSYTKIFGTSLIEEARHDDRIV
FT                   AITAAMPSGTGLDLFGEVFPQRTFDVGIAEQHAVTFAAGLASEGYKPFCAIYSTFLQRG
FT                   YDQVVHDVSIQNLPVRFPIDRAGLVGADGPTHAGSFDTGFLAALPGFVVMAASDEAELR
FT                   HMVRTAAEYDEGPISFRYPRGDGVGVDLPERGQLLEIGKGRIVREGTKVALLSFGTRLQ
FT                   ECLAAADELGAAGLSTTVADARFAKPLDHDLIRRLAREHEVLVMVEEGAVGGFASHVLQ
FT                   FLATDGLLDRGLKVRALTLPDTYQDHGKPDAMYAEAGLDRTGIVHAVFAALGREAVAAP
FT                   FSA"
FT   gene            576533..577294
FT                   /locus_tag="Oant_0548"
FT   CDS_pept        576533..577294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0548"
FT                   /product="hemolysin A"
FT                   /note="TIGRFAM: hemolysin A; PFAM: ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; RNA-binding S4 domain protein;
FT                   KEGG: bmb:BruAb1_0459 TlyA, hemolysin A"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13279"
FT                   /db_xref="GOA:A6WWC5"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC5"
FT                   /protein_id="ABS13279.1"
FT                   /translation="MSGETSDKNLRLDQLLVELGLFATRSRARDAIQRGTVKVDGKPVT
FT                   KPGQTVLRTAKIAVDDPASAYVSRAALKLIAALDHFELDVKGRTALDIGASTGGFTQVL
FT                   LERGASHVLAIDVGHDQLHETLRADPRVTNKEGLNARALELSHLDGREIDCVVSDVSFI
FT                   SLKLALPPALAFAQKGAICALLVKPQFEAGREAIGKGGILRDPKDGERIAEELKSWLET
FT                   LPGWRALGLCPSPIEGGDGNREYLLAGKKDQ"
FT   gene            577291..578532
FT                   /locus_tag="Oant_0549"
FT   CDS_pept        577291..578532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0549"
FT                   /product="(Uracil-5)-methyltransferase"
FT                   /note="PFAM: (Uracil-5)-methyltransferase; KEGG: bms:BR0438
FT                   RNA methyltransferase putative, TrmA family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13280"
FT                   /db_xref="GOA:A6WWC6"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC6"
FT                   /protein_id="ABS13280.1"
FT                   /translation="MTTQAMGQITIRSIGAGGDGVANLPDGQIYVPFTLPGEVANVARD
FT                   KNRATVMALLETSPERQAPACQHFEDCGGCALQHWQDEPYRLWKRELVVSALKGRGIDT
FT                   EVAPLVACQPRTRRRAVFAARKTEKGVLLGFNRHLSHEIIDIVECAVTVPEIIARLDDL
FT                   REVGALIAPGSKPFKLAATQTESGLDLAASGCGKLSDEQRRALTALVMKKGFARLSHEG
FT                   EIIVEPKKPLIHFGKVPVPVPPGCFLQATADAEEAMVSLVLSHLGKAKRVADLFCGVGT
FT                   FALRIAEKSAVHAVENDALALAALDRGVRHVQGLKPVSVERRDLFRRPLMPKELLPYNA
FT                   VVFDPPRAGAEEQALELAKSKVEKVVAVSCNPVTLARDLAILVKGGYRVTRVTPIDQFL
FT                   WSPHVEAVATLVKK"
FT   gene            complement(578537..579229)
FT                   /locus_tag="Oant_0550"
FT   CDS_pept        complement(578537..579229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0550"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13281"
FT                   /db_xref="GOA:A6WWC7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC7"
FT                   /protein_id="ABS13281.1"
FT                   /translation="MKTIGLIGGMSWESSQEYYRIINQEIRARLGGTHSAKSLMWSMDF
FT                   GEIEQLQHQGKWEELTRLMIEAAQNLEKGGADFILICTNTMHKMAADVENATSIPLVHI
FT                   ADPTAEKIKAAGLSKVGLLGTAFTMEQDFYKGRLVAKHGLEVLTPDDADRKTVHDIIYQ
FT                   ELVVGEIRDASREKYRAVINRLVERGARAIILGCTEIMLLIGQQDSPVPVFDTTRLHAE
FT                   AAVDWALI"
FT   gene            complement(579308..579961)
FT                   /locus_tag="Oant_0551"
FT   CDS_pept        complement(579308..579961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0551"
FT                   /product="conserved hypothetical protein 730"
FT                   /note="PFAM: conserved hypothetical protein 730; KEGG:
FT                   bme:BMEI1495 lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13282"
FT                   /db_xref="GOA:A6WWC8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC8"
FT                   /protein_id="ABS13282.1"
FT                   /translation="MKSQTLDAERSKAHKKIMSEIRSICVYCGSSTGLNPIYREAGVTL
FT                   GRSIAEHGLRLVYGGGTRGIMGAVAQGVMEAGGEVTGIIPTFLLDKEASLEKAEQLTEL
FT                   IVVGDMHERKHLMFQKSDAFVTLPGGIGTVEEIVEMMTWAQLGKHRKPMVFANINNFWQ
FT                   PMLSLLEHMTTEGFLHTAHQVKPLVINKAEDIVPAIIAANGKAHEGDQKIIEKM"
FT   gene            580045..580422
FT                   /locus_tag="Oant_0552"
FT   CDS_pept        580045..580422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13283"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWC9"
FT                   /protein_id="ABS13283.1"
FT                   /translation="MYSRLRSGLDMKNWVVFLGLTFAASSASAGEINIKLPDDTEVTTN
FT                   SVLYKCGEKNVSVTYYNAGDISLAELELEDETIVASNVISGSGAKYAGGVYIWWTKGET
FT                   ADLYNLMDDPDQSKPTNCVEQ"
FT   sig_peptide     580045..580134
FT                   /locus_tag="Oant_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 30"
FT   gene            580537..581823
FT                   /locus_tag="Oant_0553"
FT   CDS_pept        580537..581823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0553"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   bmb:BruAb1_0463 LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13284"
FT                   /db_xref="GOA:A6WWD0"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD0"
FT                   /protein_id="ABS13284.1"
FT                   /translation="MQKNSLGLLGIGLVAIVAGLGLYWNATRSRVEAPQPNATAPASSN
FT                   APAQPEATPSETKTPDAAKPAGDVAANDAKPQGVQSEEPAKQADAAPAEQASKTPVFDL
FT                   LRVEPDGSVVIAGKSLPNADVEVVAGATVVGKAKAGASGDFAIVLDNPLKAGDHQLVLR
FT                   STGADNNVATSAQTAIVSVPETKSGQVLALVEEPGQASRLITKPETAEKPQDNAEANPA
FT                   AATKADKPEAKPAQDLPIAIEAVEIEGQAVFVAGKAKGGNRVIVHANDTLLGASLISPD
FT                   GRFLVQSKQPLSVGDYIIRADLLDNANQVLATARVPFRREAGENISAVASDTDGQTAAA
FT                   SEAIGDKAASSATPLQKVDGSVIIRRGDNLWTISKRAYGKGTRYTTIYLANRDQIRNPD
FT                   LIWPGQVLNMPKEPLGDGEAKRQLEDRAN"
FT   sig_peptide     580537..580614
FT                   /locus_tag="Oant_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.692) with cleavage site probability 0.386 at
FT                   residue 26"
FT   gene            581985..582329
FT                   /locus_tag="Oant_0554"
FT   CDS_pept        581985..582329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0554"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: mes:Meso_0974
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13285"
FT                   /db_xref="GOA:A6WWD1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD1"
FT                   /protein_id="ABS13285.1"
FT                   /translation="MKIVLDKSSTETVADLAQLGIDDEAAARICAALGHPVRIRIIRQL
FT                   MMEDACCCKDIVGKLDLAQSTVSQHLKVLVQAGLIDYRPERQSSRYSVNWQQLNAVRTH
FT                   FASFKSRCCG"
FT   gene            582517..584403
FT                   /locus_tag="Oant_0555"
FT   CDS_pept        582517..584403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0555"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: bms:BR0442
FT                   ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13286"
FT                   /db_xref="GOA:A6WWD2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD2"
FT                   /protein_id="ABS13286.1"
FT                   /translation="MSSPKTVSADSGETFKTLRNLWPYMWPSDRPDLRMRVVWATFYLV
FT                   ISKIVLILVPYFFKWVTNALTGQLNPPDYIPMFLVGAVMLVLAYNGAKIVQAGLNQLRD
FT                   ALFASVGQYAVRQLAYRTFVHMHQLSLRFHLERRTGGLSRVIERGTKGIETIVRFTILN
FT                   TLPTILEFALTAVIFAFAYGISYLLVVAATVWLYTWFTIKASDWRINIRREMNDSDTDA
FT                   NTKAIDSLLNFETVKYFGNENMEAKRFDASMARYEKAATQTWTSLGWLNFGQAVIFGVG
FT                   MAVVMVMSALEVRAGTQSIGDFVFINAMLMQLSIPLNFIGFIYREIRQGLTDIEQMFDL
FT                   LDVKQEVVDKPNAPALKIDHGAIRFDDVHFAYDANRPILKGISFEVPAGKTVAIVGPSG
FT                   AGKSTISRLLFRFYDVQSGSVSIDGQDVRDVTQESLRKVIGMVPQDTVLFNDTIAYNIR
FT                   YGRPDATTEEVEKAAELAQISGFIKHLPEGYQAMVGERGLKLSGGEKQRVAIARTILKA
FT                   PPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHRLSTVISADEIIVLKDGLIA
FT                   ERGTHRMLLKHKGLYASMWARQREADEAEERLRQVRESDELGIVTRGVPAAE"
FT   gene            584531..585229
FT                   /locus_tag="Oant_0556"
FT   CDS_pept        584531..585229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0556"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase related
FT                   protein; PFAM: phosphatidylserine decarboxylase-related;
FT                   KEGG: bmb:BruAb1_0465 phosphatidylserine
FT                   decarboxylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13287"
FT                   /db_xref="GOA:A6WWD3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWD3"
FT                   /protein_id="ABS13287.1"
FT                   /translation="MSLTDTIRNTFVPIHREGYPFIAGFFVVSLILGWLWDPLFWIGMV
FT                   LTVWCIYFYRDPERVTPMDDDLVISPADGKVSFVGPAVPPAELDLGAEPRMRVSVFMNV
FT                   FSVHINRSPVRGKIEKVVHRPGKFLNAELDKASTENERNSVLIESPHGKIGVVQIAGLV
FT                   ARRIVCWSNEDDDLSVGERFGLIRFGSRVDVYLPADATVRVAVGQTAVAGETVLADYGS
FT                   VRGEPVVRIG"
FT   gene            585234..586085
FT                   /locus_tag="Oant_0557"
FT   CDS_pept        585234..586085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0557"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   bmb:BruAb1_0466 PssA, CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13288"
FT                   /db_xref="GOA:A6WWD4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD4"
FT                   /protein_id="ABS13288.1"
FT                   /translation="METPFPPFEPNGRVDLSRGPKLSQIPLRIVIPNVITVLAICAGLT
FT                   GIRLAFENRFELAVVMVLVAAFLDGIDGRVARMMKGSSKFGAQMDSLADIVNFGVAPAL
FT                   VLYAFMLDQARSFGWIAALLYAIACCLRLARFNVMLEDPNRPAWQSNYFIGVPAPAGAM
FT                   LVLLPVYLGFLGLTPTRALAFGVAIYTVAIAFLLVSRLPVYNGKSAGSLVRRDIVMPLI
FT                   LFVVVYVAFLMSFTWQTLSLTALAYLVFLPFSLAAWNKREAADRKAEEEAGTEEDTPSE
FT                   EN"
FT   gene            complement(586071..586628)
FT                   /locus_tag="Oant_0558"
FT   CDS_pept        complement(586071..586628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bml:BMA10299_A3033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13289"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD5"
FT                   /protein_id="ABS13289.1"
FT                   /translation="MIKDHQRFIIISGGPGSGKSTLIDALERQGFPRTVEAGRAIIQDQ
FT                   VAIGGNALPWSDRALFAELMLSWEMRSHTMAEQQRGTVLFDRGVPDVIGYLMLCNLPVP
FT                   QHMEEAARQFQYNRTVFLAPPWAEIFGQDAERKQDFEEAARTFEAMDKTYKRLGYEIAL
FT                   LPKSSVEERVGFIKQALPSVFL"
FT   gene            complement(586803..587543)
FT                   /locus_tag="Oant_0559"
FT   CDS_pept        complement(586803..587543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0559"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bmb:BruAb1_0467 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13290"
FT                   /db_xref="GOA:A6WWD6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD6"
FT                   /protein_id="ABS13290.1"
FT                   /translation="MSIDLTGRIALVTGASRGIGYFLSLELAKRGAHVIAVARTVGGLE
FT                   ELDDDIRKLGGNATLVPLDITDMEAIDRLGGSIHERWGKLDIMVANAGVLGTISPIGHV
FT                   EAKTFEKLMNVNVTSVWRLIRSTDPLLRASDAGRAILLSSGVAHTCRAFWGPYAASKAA
FT                   VEVMARSWAEETKQMKLKINSVNPGATRTAMRAQAMPGEDPETLPTPQSVAEKIVKLAD
FT                   PNLEVSGKLFDVRQDRFLDYHLPS"
FT   gene            complement(587614..589104)
FT                   /locus_tag="Oant_0560"
FT   CDS_pept        complement(587614..589104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0560"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: bme:BMEI1488
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13291"
FT                   /db_xref="GOA:A6WWD7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD7"
FT                   /protein_id="ABS13291.1"
FT                   /translation="MTSHSSENASFMLDDDTLHEECGVFGILGHEDAAALTALGLHALQ
FT                   HRGQEAAGIVSYHNRRFHSERHMGLVGDHFTDAATLNRLPGDRAIGHVRYSTTGETILR
FT                   NVQPLFAELEVGGIAIAHNGNFTNGITLRKQLIASGAIFQATSDTEVVLHMIARSRHAS
FT                   SSDRFVDAIRQVEGGYAMLALTRTKLIAARDVIGIRPLVMGELDGKPIFCSETCALDII
FT                   GAKYVRDVENGEVIICEIQKDGSITIESIKAENPQPERLCLFEYVYFARPDSVVGGRSV
FT                   YVARKNMGMELAKEAGIEADVVVPVPDGGTPAALGFAQASGIPFEYGIIRNHYVGRTFI
FT                   EPTQQIRALGVKLKHSANRAMIEGKRVVLVDDSIVRGTTSVKIVQMIRDAGAKEVHIRV
FT                   ASPMIYHPDFYGIDTPHADKLLANQHKDLESMCRYIGADSLAFLSIDGLYKAVGGKPRN
FT                   PKAPAFTDHYFTGEYPTRLLDQEGESNVHTLSLLASNG"
FT   gene            complement(589449..590024)
FT                   /locus_tag="Oant_0561"
FT   CDS_pept        complement(589449..590024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0561"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; KEGG:
FT                   bmb:BruAb1_0470 colicin V production protein, hypothetical"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13292"
FT                   /db_xref="GOA:A6WWD8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD8"
FT                   /protein_id="ABS13292.1"
FT                   /translation="MPITMLDGILLGITLVSAVLAMVRGFSREVLSLVSWAAAAAAAYL
FT                   FYQPVLPFVQPYINNETIAKIAAAGAVFLVVLIVVSLITMKIADFIIDSRIGALDRTLG
FT                   FLFGGVRGVLLVVVAMLFFNWLVPTNQPAWVTNAKSKPMLDSFGQQLIDLLPANPDQMI
FT                   DKFKPQHNVPASGEQEEAPVPDDTPAQQ"
FT   gene            complement(590137..591531)
FT                   /locus_tag="Oant_0562"
FT   CDS_pept        complement(590137..591531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0562"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: bms:BR0449 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13293"
FT                   /db_xref="GOA:A6WWD9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWD9"
FT                   /protein_id="ABS13293.1"
FT                   /translation="MAKARVQFICQNCGAVHSRWAGKCDSCGEWNTLVEEGTNSGIGSG
FT                   PGAMLSKRKGRAVALTSLSGDIEDAPRIISGISELDRVTGGGFVRGSALLIGGDPGIGK
FT                   STLLTQAAAALSNRGHRIVYVSGEEAVAQIRLRAQRLGVASSAVELAAETNVEDIIATI
FT                   SDTKRPDLVIIDSIQTLWTDMADSAPGTVTQVRSSAQAMIRYAKQTGSAVVLVGHVTKD
FT                   GQIAGPRVVEHMVDGVLYFEGEGGHHYRILRTVKNRFGPTDEIGVFEMSDGGLREVSNP
FT                   SELFLGERNAKAPGAAVFAGMEGTRPVLVEIQALVAPSSLGTPRRAVVGWDGGRLAMIL
FT                   AVLESHCGVRFGQHDVYLNVAGGYRISEPAADIAVAAALVSSMAGIALPPDCVYFGEIS
FT                   LSGAVRAVTHAVQRLKEAEKLGFRQAEVPGGSGELWKDRNFRLMETSALPDLVARIAAS
FT                   GSGKKQ"
FT   gene            complement(591562..593067)
FT                   /locus_tag="Oant_0563"
FT   CDS_pept        complement(591562..593067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0563"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; SMART: AAA ATPase; KEGG:
FT                   bmb:BruAb1_0472 DnaB, replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13294"
FT                   /db_xref="GOA:A6WWE0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWE0"
FT                   /protein_id="ABS13294.1"
FT                   /translation="MAEAAVRKLDDARDQKDALYREAPHNIEAEQALLGAILINNDAFY
FT                   RVSDFLKPTHFFEPLHRRIYEITTDLIRVGKMANPVTMKTFLPTEGKVGDLTIFQYVTR
FT                   LATEAVTIINAEDYGRAIYDLATRRALIGIGEDMVNVAYDAPVDMAPQEQIEDAERRLF
FT                   ELAETGRYDGGFLPFKDAVTTAVDMANAAFMRDGHLSGVSTGIHTLDGKMGGLQPSDLI
FT                   ILAGRPGMGKTSLATNIAFNIANAYEGEQQADGSVKAINGGVVGFFSLEMSAEQLATRI
FT                   ISEQTEVSSSKIRRGDITETDFEKLVACSQVMQKIPLYIDQTGGISIAQLAARARRLKR
FT                   QRGLDVLVIDYVQLMTGSSKASAQNRVQEITEITTGLKALGKELNVPIIALSQLSRQVE
FT                   SRDDKRPQLSDLRESGSIEQDADVVLFVFREEYYVKNLEPRDEFDPKYEEWKQHFEKVR
FT                   GTADVIIAKQRHGPTGTVKLAFQSEFTRFADLAEGSYLPEQYE"
FT   gene            593329..594342
FT                   /locus_tag="Oant_0564"
FT   CDS_pept        593329..594342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0564"
FT                   /product="purine nucleoside permease"
FT                   /note="PFAM: purine nucleoside permease; KEGG:
FT                   pat:Patl_1764 putative purine nucleoside permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13295"
FT                   /db_xref="GOA:A6WWE1"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWE1"
FT                   /protein_id="ABS13295.1"
FT                   /translation="MRHRTIAAWLLTALALFSSSTASLAASEPIKVKVFIAAMFEIGQN
FT                   SGDRAGEFQRWYEHYWKDARPIEVKGALKPVYCNVDGVCGSVLGMGKVNSSASMQAIML
FT                   DPAFDFSKTYYILSGVAGTPPSRGTIGDVSWATWLVDYDLGHRWAPEEGKPGEPVFIPR
FT                   KGYEEYRVFKLDPDLVAAAMRLGSNAELRDSPEAQAYRMRYPDKAAQAKPALKTGTHMT
FT                   GDTFFHGPGLSKEAQYIAKLYGADDYLATEMEAAALALVIKRQHGTDRILSLRGSVNFD
FT                   QGNPKETTLQHLDPAPGETAGGFAETVENIYLVGAPVVSDIVTHWDKWEAGVPKPE"
FT   sig_peptide     593329..593406
FT                   /locus_tag="Oant_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 26"
FT   gene            complement(594407..595687)
FT                   /locus_tag="Oant_0565"
FT   CDS_pept        complement(594407..595687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0565"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bmb:BruAb1_0473 Cfa, cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13296"
FT                   /db_xref="GOA:A6WWE2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWE2"
FT                   /protein_id="ABS13296.1"
FT                   /translation="MYGMMRTVISHMIKTGDLTVTDSSGALTRYGDRTGEPVHIHFKTK
FT                   HAERAVALDPELKLAECFMDGEIDFLNGNIYTLLQVVFENTGPTAATEPWMKALAKLRI
FT                   FFRRFQQMNTISRSSNNIKSHYDLSGELYDLFLDPDKQYSCAYFDPPNATLAEAQLAKK
FT                   RHIAAKLLVKEGDKVLDIGCGWGGMGLYLARYLKANVTGVTLSEEQHAIANQRAQDEGL
FT                   ADRAKFELTDYRNIDDKFDRLVSVGMFEHVGVGHFAEYFQHVARLMKQDGVFLLHAIGR
FT                   ADGPGATNPFIRKYIFPGGYIPALSEVLPHIEKAGLYVTDIEILRLHYAETLKAWREAF
FT                   MANRDKAKALYDERFCRMWEFYLAASESAFRWQNMMVFHIQIAHKQESVPLTRNYIEAE
FT                   EKRLKRLDSAPKGANSEGRAVKKSMNA"
FT   gene            complement(596016..596585)
FT                   /locus_tag="Oant_0566"
FT   CDS_pept        complement(596016..596585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0566"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: bmb:BruAb1_0474
FT                   RplI, ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13297"
FT                   /db_xref="GOA:A6WWE3"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWE3"
FT                   /protein_id="ABS13297.1"
FT                   /translation="MEVILLERIGRLGQMGETVKVKDGYARNFLLPQGKALRANEANKK
FT                   KFEGQRAQLEAQNLERKNEAQAVAEKLNGESFIVVRSAGETGQLYGSVSTRDIADIISA
FT                   NGFTLHRNQVELNHPIKAIGLHEVSISLHPEVQVQVTVNIARSTEEAERQAKGEDLTSI
FT                   EAIYGIEEQPLSEEVFDEEDEAEDQA"
FT   gene            complement(596615..597586)
FT                   /locus_tag="Oant_0567"
FT   CDS_pept        complement(596615..597586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bme:BMEI1482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13298"
FT                   /db_xref="GOA:A6WWE4"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWE4"
FT                   /protein_id="ABS13298.1"
FT                   /translation="MKFNGTIIGIGILAGLASALMSSGVIAQGGAMAAMAMVLYFLTPL
FT                   PIFVVALGWGSSAGIVAAATATVAVGVVAVPLAALLMALTSFIPAATGAYLSGLARPAE
FT                   ELGGPQDVLVWYPLSDIVFRLAMMVALSFIVIGAILGFGPDMARELANTLIDRVAEADP
FT                   QFTASDDIRSNVTSLLMVALPAIQPATCLAILVGNLYLAQRLISMSGRLRRPRDDWPAT
FT                   LRMPRPALLVFAVALAVAFVPGGAGLIATVVAGALSAGFMMSGLAIMHFRTRGKVWRPV
FT                   ALWLAYFAIILFAFLLFIFMVLGLFDTSRGAPVSKMPGADSQ"
FT   sig_peptide     complement(597503..597586)
FT                   /locus_tag="Oant_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.838 at
FT                   residue 28"
FT   gene            complement(597738..597986)
FT                   /locus_tag="Oant_0568"
FT   CDS_pept        complement(597738..597986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0568"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: bmb:BruAb1_0476
FT                   RpsR, ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13299"
FT                   /db_xref="GOA:A6WWE5"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWE5"
FT                   /protein_id="ABS13299.1"
FT                   /translation="MVDINQIPTRRPFHRRRKTCPFSGANAPKIDYKDIKLLQRYISER
FT                   GKIVPSRITAVSQKKQRELAKAIKRARFLGLLPYVVK"
FT   gene            complement(597989..598444)
FT                   /locus_tag="Oant_0569"
FT   CDS_pept        complement(597989..598444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0569"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: bmb:BruAb1_0477
FT                   RpsF, ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13300"
FT                   /db_xref="GOA:A6WWE6"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWE6"
FT                   /protein_id="ABS13300.1"
FT                   /translation="MALYEHVLLARQDISQQQVDALVEQYKGVLEANGGKVGKVESWGL
FT                   RPLTYRIKKNRKAYYTLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAML
FT                   TRRDDRRERDGDDRPRRREGGFDRGDRGDRGDRGPRRPRDNEAGEGA"
FT   gene            598854..599798
FT                   /locus_tag="Oant_0570"
FT   CDS_pept        598854..599798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0570"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: bms:BR0457
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13301"
FT                   /db_xref="GOA:A6WWE7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWE7"
FT                   /protein_id="ABS13301.1"
FT                   /translation="MAVAFTFPGQGSQAVGMGKALAEQFAEARAVFDEVDAALGEKLSA
FT                   TMFEGPEDVLTLTANAQPALMAVSMAVLRVMEARGFSLKDRVSYVAGHSLGEYSALCAA
FT                   RTFSLADTARLLRIRGNAMQKAVPAGEGAMAAIIGLEHGDVEAVCTEAKASGSVQIAND
FT                   NGGGQLVISGSKAAVELAARLASEKGAKRAIMLPVSAPFHSTLMGPAGEAMREALASVE
FT                   KHNPIVPLIANVRAAPVTDANEIADLLVEQVTGQVRWRETVEWFAANGVTTLYEVGSGK
FT                   VLTGLARRISKDVTGAAVGSAEEIEAALAVLGA"
FT   gene            599868..600605
FT                   /locus_tag="Oant_0571"
FT   CDS_pept        599868..600605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0571"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   bmb:BruAb1_0480 FabG, 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13302"
FT                   /db_xref="GOA:A6WWE8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWE8"
FT                   /protein_id="ABS13302.1"
FT                   /translation="MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKE
FT                   LAAELGDRTFIFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDW
FT                   DAVLNVNLTSVFNLTRELTHPMMRRRKGRIINITSIVGVTGNPGQANYCASKAGLIGFS
FT                   KSLAQEIASRNVTVNCIAPGFIESAMTDKLNEKQKEAIMSNIPMKRMGVGGDIAAAVVY
FT                   LASDQAAYVTGQTLHINGGMAMI"
FT   gene            600882..601118
FT                   /locus_tag="Oant_0572"
FT   CDS_pept        600882..601118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0572"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: bmb:BruAb1_0481 AcpP,
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13303"
FT                   /db_xref="GOA:A6WWE9"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWE9"
FT                   /protein_id="ABS13303.1"
FT                   /translation="MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVM
FT                   AFEEEFGVEIPDDAAETILTVGDAVKFIDKASA"
FT   gene            601398..602657
FT                   /locus_tag="Oant_0573"
FT   CDS_pept        601398..602657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0573"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: bms:BR0461
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13304"
FT                   /db_xref="GOA:A6WWF0"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF0"
FT                   /protein_id="ABS13304.1"
FT                   /translation="MRRVVITGLGLVSPLASGVEETWKRLIAGESGARRITEFEVDDLA
FT                   CQIACRIPVGDGTNGTFNADLHMEPKEQRKVDPFIVYAVGAADQALDDADWHPESDEDQ
FT                   VRTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSIKHGLRGPN
FT                   HSVVTACATGTHAIGDAARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTKRNDD
FT                   PTAASRPYDEDRDGFVMGEGAGVVVLEELEHALARGAKIYAEVIGYGLSGDAYHITAPT
FT                   ESGEGAERCMVAALKRAEITPDQIDYINAHGTSTMADTIELGAVERVVGDAASKISMSS
FT                   TKSAIGHLLGAAGAAEAIFSTLAIRDNIAPATLNLDNPAVSTKIDLVPHKARERKIDVA
FT                   LSNSFGFGGTNASLVLRRYS"
FT   sig_peptide     601398..601454
FT                   /locus_tag="Oant_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.884 at
FT                   residue 19"
FT   gene            602938..604149
FT                   /locus_tag="Oant_0574"
FT   CDS_pept        602938..604149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0574"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG:
FT                   bmb:BruAb1_0484 conserved hypothetical protein TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13305"
FT                   /db_xref="GOA:A6WWF1"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF1"
FT                   /protein_id="ABS13305.1"
FT                   /translation="MNSEAPSGTPPADELPKGVTQETNATSKPFVPKSASEALRPEPGT
FT                   PPPSKRSRHARSQIVVFMNFMLSLVVLVLLGASALFYFGKMQFDGQGPLTAETTFLVKR
FT                   GAGIAEVSNSLENREIVSDARIFRYGMRTLGHENDLKAGEYAIPAGASMRDVMNILISG
FT                   KSIMYPLTIPEGLTVKQIFDRISADPTLVGDMPKDMPPEGSLFTDTLNFTRGTTRSEII
FT                   DRMVASQKKLVDDAWAKRGSDLPIKDKNEFVTLASIVEKETGIASERPHVASVFVNRLK
FT                   KGMRIQSDPTIIYGLFGGAGKPSDRPIFKSDIEKPTPYNTYVINGLPPTPIANPGKAAL
FT                   EAVANPLDTEDLYFVADGTGGHVFSKTLQEHNANVRKWRSVEQQKNIEQQNNSGSNTNQ
FT                   SAGQ"
FT   gene            604274..605173
FT                   /locus_tag="Oant_0575"
FT   CDS_pept        604274..605173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0575"
FT                   /product="domain of unknown function DUF1732"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: bms:BR0463 conserved hypothetical
FT                   protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13306"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF2"
FT                   /protein_id="ABS13306.1"
FT                   /translation="MALQSMTGFARHAVQHAMEGGEARIIWEVRSVNGKGLDLRLRLPQ
FT                   GLEAAEHPVRSMLARHFSRGNFQASLSVERSEAQAGFSINQAMLAEILKLGADLQATHG
FT                   LAPASVDGILSLRGIIDQAQMADDEDERGGLEAAVVSGFEETLKAIADARKQEGKALFT
FT                   ILSAHVDSIERLTVNARRDPSRSTDAIKARLAGQVALLMDSARELDETRLYQEAAFLAT
FT                   KADIQEELDRLETHVASARKLLADGGPVGRKLDFLSQEFNREANTLCSKSNAASITAIG
FT                   LELKAVVDQFREQVQNLE"
FT   gene            605182..605844
FT                   /locus_tag="Oant_0576"
FT   CDS_pept        605182..605844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0576"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region; KEGG: bmb:BruAb1_0486
FT                   Gmk, guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13307"
FT                   /db_xref="GOA:A6WWF3"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF3"
FT                   /protein_id="ABS13307.1"
FT                   /translation="MAISSVENGVARRGLMVVISSPSGAGKSTIARLLLEDKKMNLSLS
FT                   ISVTTRQRRPSEIEGVHYHFKTIREFERLRDNDELIEWAEVHGNFYGTLRETAEIALAD
FT                   GQDMLFDIDWQGADQLQAKMPADVVSIFILPPTMRELQQRLNRRAEDTADVIETRLQNA
FT                   RFEIQKWVKYDYIVINEDLDRSFAAIKSIIEAERLRRDRRPGLFDFVTGLLEENPGT"
FT   gene            complement(605849..606286)
FT                   /locus_tag="Oant_0577"
FT   CDS_pept        complement(605849..606286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13308"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF4"
FT                   /protein_id="ABS13308.1"
FT                   /translation="MARHTLEYPINNQSLTIPLFYLARHSMELALEEALREIAHIGVDD
FT                   ARTDGHDLLKLYDDLQKILKDNGVNDDGRWSNHCRRILTHIHSADPKGEHFRYPAALNG
FT                   NVFPEVTVNIEGLIRAHYHVTLLADCVVTMLQENRNYELPY"
FT   gene            606576..607530
FT                   /locus_tag="Oant_0578"
FT                   /note="ribosomal slippage"
FT   CDS_pept        join(606576..606917,606919..607530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Oant_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO2406 ISSpo6, transposase orf A"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13309"
FT                   /db_xref="GOA:A6WWF5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF5"
FT                   /protein_id="ABS13309.1"
FT                   /translation="MGKPHPIELRERVVAFVNEGNSHREAARHFRVSPRFVNNMMILHR
FT                   SSGCLAAARQGHPPGSVKLLAHGDWVREQMSARGETTLDELCVALAERGIEVHRATVGR
FT                   FLHRLGLSNKKSLKASEQRRPEIAKARDLWINRRKRFFNKALSRLIFIDETSTNTRLTK
FT                   RTGWSAKGRRFAAYAPFGKWKTQTFIAGLRCHGLTAPWIVDAPMNSRIFETWIETQLVP
FT                   TLSAGDIVILDNVGFHKSQKAEQLVKAKGAWFLFLPPYSPDLNPIEMAFSKLKALLRKR
FT                   AARSFDAISKALGDIISLFSINECQNFFKAAGYEAE"
FT   gene            complement(608068..609480)
FT                   /locus_tag="Oant_0579"
FT   CDS_pept        complement(608068..609480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0579"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   bme:BMEI1468 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13310"
FT                   /db_xref="GOA:A6WWF6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF6"
FT                   /protein_id="ABS13310.1"
FT                   /translation="MKSLIDSFDASRDDIERLVAQSLKGSDDGELFVEYREAEALVFDN
FT                   GRLKTGSFNQDQGFGLRSVAGEAIGYAHAGDLSLAALKRASDAVSATLKGYGGNYSAAP
FT                   AGTNRHLYTDENPIGSPTFDSKVQLLQQIDAYLRAKDPKVRQVSVSLAGSWQQVEILRA
FT                   DGHFVRDIRPMVRLSVAVVAGDGDRQESGSHTVGGRKGFGEFITAESWQHAADEALRQA
FT                   LVNLEAIPAPAGTFDIVLANGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGQQVASKG
FT                   VTVVDDGTIAERRGSLTIDDEGTPTNRTVLIEDGKLVNYMQDRQNARLMGMEATGNGRR
FT                   ESYAHAPMPRMTNTYMLSGDKTPEEIIASMKKGIYAVSFGGGQVDITSGKFVFGCTEAY
FT                   MIEDGKVGAPIKGAMLIGNGPDAMQRISMIGNDMKLDTGSGNCGKGGQWVPVGVGQPHL
FT                   RMDQVTVGGTAV"
FT   gene            complement(609561..610175)
FT                   /locus_tag="Oant_0580"
FT   CDS_pept        complement(609561..610175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0580"
FT                   /product="Invasion associated locus B family protein"
FT                   /note="PFAM: Invasion associated locus B family protein;
FT                   KEGG: bmb:BruAb1_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13311"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF7"
FT                   /protein_id="ABS13311.1"
FT                   /translation="MTFRMLARRTISQRLATLATGVSLTLAVATLPSVAQETPAQLQTP
FT                   QEAPAAQSQAAPSSPQQSGKLKSQHGAWSVLCDTPAGAKTEQCALIQNVVAAKRPELGL
FT                   SVVVLKTADNKARILRVLAPLGVLLPNGLGLNVDGKDIGRAYFVRCFEDGCYAEVILED
FT                   ELLKTLRSGKAATFIVFQTPEEGVGIPVDLKGFGEGFDALP"
FT   sig_peptide     complement(610068..610175)
FT                   /locus_tag="Oant_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            610580..611464
FT                   /locus_tag="Oant_0581"
FT   CDS_pept        610580..611464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0581"
FT                   /product="Cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: Cytochrome c oxidase subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; KEGG: bme:BMEI1466
FT                   cytochrome C oxidase polypeptide II"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13312"
FT                   /db_xref="GOA:A6WWF8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF8"
FT                   /protein_id="ABS13312.1"
FT                   /translation="MDKIVATTKSAFGGALAVLWTTGAAFADQPRPWEWRFQDAATGIA
FT                   EQIHWFERYTLWFIIPITLLVLFLLLWVVFRFRASANPEPSKTSHNTAIEVVWTIGPVI
FT                   ILLFLAVPSFQLLTAQYSPEDPTLTVKATGYQWYWGYEYQVDNPVSFDALLLKDGDRAA
FT                   AGKEDRARYPRLLAVDNEVVVPVGETVRLLVTAADVIHSWTIPAFGVKMDAVPGRINEA
FT                   WFKADKEGLYYGQCSELCGKDHGFMPIAVRVVSKEQYQTWIAAAGSDLNGANKALQAAV
FT                   EGGANDKVAAAGL"
FT   sig_peptide     610580..610663
FT                   /locus_tag="Oant_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            611505..613163
FT                   /locus_tag="Oant_0582"
FT   CDS_pept        611505..613163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0582"
FT                   /product="Cytochrome c oxidase subunit I type"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: Cytochrome c oxidase subunit I type; PFAM:
FT                   cytochrome c oxidase subunit I; KEGG: bmb:BruAb1_0490 CoxA,
FT                   cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13313"
FT                   /db_xref="GOA:A6WWF9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWF9"
FT                   /protein_id="ABS13313.1"
FT                   /translation="MAGTAAHEHGAHDDHKPHGWVRWVYSTNHKDIGTLYLIFAIIAGI
FT                   IGGALSIAMRAELQEPGIQIFHGLASMVYGVEGDAALDAGKQMFNVFTSAHALVMIFFM
FT                   VMPALIGGFANWMVPLMIGAPDMAFPRMNNISFWLLPPALLLLMISLFMPSAPGGWGPG
FT                   GGWTLYPPLSTTGQPGPAIDFAILALHISGASSILGAINFITTILNMRAPGMTLHKMPL
FT                   FAWAVLVTAFLLLLSLPVLAGGITMLLTDRNFGTTFFTPDGGGDPILYQHLFWFFGHPE
FT                   VYILILPGFGIVSHIVSTFSRKPIFGYLGMAYAMVAIGVVGFVVWAHHMYTVGLSLDTQ
FT                   RYFVFATMVIAVPTGIKIFSWIATMWGGSITFRAPMLWAIGFIFLFTVGGVTGVQLANA
FT                   GLDRALHDTYYVVAHFHYVLSLGAVFAIFAGWYYWFPKMSGYMYNEFTAKLHFWVTFVG
FT                   VNLVFFPQHFLGLAGMPRRYIDYPDAYAGWNMVSSYGSYISGFAVLIFLYNVFEAFAKK
FT                   REAGANPWGEGATTLEWQLSSPPPFHQWEQLPRIK"
FT   gene            613394..614341
FT                   /locus_tag="Oant_0583"
FT   CDS_pept        613394..614341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0583"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: bms:BR0469 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13314"
FT                   /db_xref="GOA:A6WWG0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWG0"
FT                   /protein_id="ABS13314.1"
FT                   /translation="MSLVEKNAGTDDALALSEATARDYLVLLKPRVMSLVVFTGLVGLV
FT                   VAPGHMNPVLAAISILCVAVGAGASGALNMWYDADIDAVMKRTRNRPIPAGIIAPNQVL
FT                   AFGLTLSAFSVVTLGLMVNWLSAALLAFTIFFYAVVYTMWLKRSTPQNIVIGGAAGAFP
FT                   PMIGWAAATGEITWDSVVLFMIIFLWTPPHFWALSLFSANDYEAARIPMMPNVKGELST
FT                   RRQALFYSIIMAPVGVLPWVLGFAGPVYGAISTLLGLAFVYYAWRMWVAGSQPEMLAAA
FT                   RKLFRFSLLYLSGLFAVLLVEALVMKALIAFGGF"
FT   gene            614341..614526
FT                   /locus_tag="Oant_0584"
FT   CDS_pept        614341..614526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bms:BR0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13315"
FT                   /db_xref="GOA:A6WWG1"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWG1"
FT                   /protein_id="ABS13315.1"
FT                   /translation="MDKTVQKPTDNELELIVPTEQQKRAQRNRSWGLAIALALFVLLVY
FT                   IGTIAKLGVNVLVRPI"
FT   gene            614648..615259
FT                   /locus_tag="Oant_0585"
FT   CDS_pept        614648..615259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0585"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: bme:BMEI1463 cytochrome C oxidase
FT                   assembly protein CtaG"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13316"
FT                   /db_xref="GOA:A6WWG2"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWG2"
FT                   /protein_id="ABS13316.1"
FT                   /translation="MADQQEKDQKLKKQQRSNATIAFACLSFFVCMIGAAYASVPLYRI
FT                   FCQVTGYGGTTQRVEQYSDTILDKTIKVRFDANTANGLAWDFKPVQREVTVRIGETTMI
FT                   KYEARNLFDQPTYGRASFNVAPGRAGAYFNKVECFCFTDTTLQPGEDMEMPVVFFVDPE
FT                   IVNDPDLKDVKTITLSYTFFPIEKPKPVANVKAETPTNGS"
FT   sig_peptide     614648..614764
FT                   /locus_tag="Oant_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.996 at
FT                   residue 39"
FT   gene            615581..616459
FT                   /locus_tag="Oant_0586"
FT   CDS_pept        615581..616459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0586"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   bmb:BruAb1_0494 CoxC, cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13317"
FT                   /db_xref="GOA:A6WWG3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWG3"
FT                   /protein_id="ABS13317.1"
FT                   /translation="MADVHQKNHDYHIIAPSPWPFLSSVGAFVLAVGGIAWMRYINAGE
FT                   LPFFGLNIVTPWIFFIGLAIVLYCMYGWWADTIKEGHEGHHTRVVSLHLRYGMIMFIAS
FT                   EVMFFVAWFWAFFDASLFPNEVHQVARATFTGGVWPPKGIEVLDPLHLPLYNTVILLLS
FT                   GTTLTWAHHALLHNDRKGMITGLAITVALGVLFSFVQAYEYIHAPFAFKDSIYGATFFM
FT                   ATGFHGFHVIVGTIFLLVCLFRAIGGDFTPKQHFGFEAAAWYWHFVDVVWLFLFFAIYV
FT                   WGGWGAPMHAG"
FT   gene            616543..616938
FT                   /locus_tag="Oant_0587"
FT   CDS_pept        616543..616938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0587"
FT                   /product="protein of unknown function DUF983"
FT                   /note="PFAM: protein of unknown function DUF983; KEGG:
FT                   bms:BR0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13318"
FT                   /db_xref="GOA:A6WWG4"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWG4"
FT                   /protein_id="ABS13318.1"
FT                   /translation="MPDQNIYPPVDPIKSGIAGHCPRCGEGKLFDGFLKVAPRCSACGL
FT                   DYAFADSGDGPAAFVILIIGFIVVGLALWMEVNVGPPLWVHFILWVPLAIILSLVAMRW
FT                   AKGILINMQYRNKAAPGRIDSRQDDSK"
FT   gene            616935..617729
FT                   /locus_tag="Oant_0588"
FT   CDS_pept        616935..617729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0588"
FT                   /product="Surfeit locus 1 family protein"
FT                   /note="PFAM: Surfeit locus 1 family protein; KEGG:
FT                   bms:BR0474 SurF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13319"
FT                   /db_xref="GOA:A6WWG5"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWG5"
FT                   /protein_id="ABS13319.1"
FT                   /translation="MTTAQQSHRFPWGVVIASAIALVILLALGTWQVERLQWKEALIAS
FT                   TEQRVHEAPLPLSEMEKIYKQEGSVEYRPVTVSGTFMHQGERHFLATYEGAAGYNVYTP
FT                   LMLEDGRFVLVNRGFVPYEKKDPSTRVEGQVDGLVSVTGLARDPLPAKPGFFLPDNDIA
FT                   KNIFYWKDWTAMAESADLPNLDEVVPFFVDADNKPNPGGLPIGGVTIIDFPNNHLQYAM
FT                   TWYGLALALIGVVGTWLWRYRCLRKSGDRFSVRDSENKNEEG"
FT   sig_peptide     616935..617024
FT                   /locus_tag="Oant_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.610) with cleavage site probability 0.467 at
FT                   residue 30"
FT   gene            617889..618941
FT                   /locus_tag="Oant_0589"
FT   CDS_pept        617889..618941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0589"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="TIGRFAM: hydroxymethylbutenyl pyrophosphate
FT                   reductase; PFAM: LytB protein; KEGG: bmb:BruAb1_0497 LytB,
FT                   penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13320"
FT                   /db_xref="GOA:A6WWG6"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWG6"
FT                   /protein_id="ABS13320.1"
FT                   /translation="MTDQRPSLEIRLCGPRGFCAGVDRAIQIVVLALKKYGAPVYVRHE
FT                   IVHNRYVVEGLQSRGAIFVEELHEIPAEHRDQPVVFSAHGVPKSVPADAEAKNLFYLDA
FT                   TCPLVSKVHKQAMRHQRLGRHVILIGHSGHPEVIGTMGQLPDGAVTLIETVEDARSCHF
FT                   DDENNLGFVTQTTLSVDDTAGIIEELQARFPNLSAPAAESICYATTNRQDAVRSAAPGC
FT                   DLFLIVGAPNSSNSKRLVEVAEKAGARMSMLVQRAADIEWDRIGDISVVGLSAGASAPE
FT                   IIVDEIIDAFKARFNVKIELAETTVETENFLVNREIRDVELTVQDMAFVNGEHRVVGIP
FT                   KLMPKIIQGK"
FT   gene            618947..619927
FT                   /locus_tag="Oant_0590"
FT   CDS_pept        618947..619927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0590"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: aminoglycoside
FT                   phosphotransferase; KEGG: bms:BR0476 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13321"
FT                   /db_xref="GOA:A6WWG7"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWG7"
FT                   /protein_id="ABS13321.1"
FT                   /translation="MAVYTDINEIELGAFLQQYDIGTLTSYKGIAEGVENSNYLLHTTS
FT                   GSFILTLYEKRTNREDLPFFLGLMQHLASRGLECPQPVVRRDGTTIGELAGRPAAIVTF
FT                   LEGMWMRRPTVEHCEAVGEGLAHMHLAGADFSLRRRNGLTLADWRPLWNLSRGRADTVE
FT                   PGLVREAEADLAFLEKNWPADLPQGVIHADLFPDNVFFLGDRLSGFIDFYFACTDTLAY
FT                   DVAVCLNAWCFEKDFSYNRTKGAALLRGYTSVRPLSAAEADALPVLARGAAIRFMLTRL
FT                   YDWLNVPEGSFVVKKDPMEYVRKIRFHRQIETAAEYGLEQQGAAA"
FT   gene            619924..620388
FT                   /locus_tag="Oant_0591"
FT   CDS_pept        619924..620388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0591"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: bmb:BruAb1_0499 RnhA,
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13322"
FT                   /db_xref="GOA:A6WWG8"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A6WWG8"
FT                   /protein_id="ABS13322.1"
FT                   /translation="MKRIEAYTDGACSGNPGPGGWGAILRWNDNVKELKGGEADTTNNR
FT                   MELMAAISALSALKEPCEVDLYTDSVYVRDGISGWIEGWKRNGWKTAAKKPVKNAELWQ
FT                   ALDEARKPHKVNWHWVKGHAGHPENERADELAREGMEPFKYGGRKSLKVQ"
FT   gene            complement(620494..620979)
FT                   /locus_tag="Oant_0592"
FT   CDS_pept        complement(620494..620979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0592"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bms:BR0478 AhpC/TSA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13323"
FT                   /db_xref="GOA:A6WWG9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWG9"
FT                   /protein_id="ABS13323.1"
FT                   /translation="MTIKVGDKLPAATFKVKTADGVKEMTTDEVFKGKKVVLFAVPGAF
FT                   TPTCSLNHLPGYLDNRDAILAKGVDQIAVVAVNDAFVMGAWAQSTGGEGKILYLADGSA
FT                   VFTKAAGLELDATAGGLGIRSKRYSAIVEDGVVTTLNIEEQAGQAVTSAASGILEQL"
FT   gene            complement(621120..621920)
FT                   /locus_tag="Oant_0593"
FT   CDS_pept        complement(621120..621920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13324"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH0"
FT                   /protein_id="ABS13324.1"
FT                   /translation="MNIRTLALAPFLLASLVLPALASTSDWTETPGGRVRVIIEDNSPN
FT                   NATSNERRGALQVELQPGWKTYWRNPGDAGVPPQINIEGEAKAQIDFPAPVRFGGEDEG
FT                   GIGYKQPVSLPIVFHLTAADTRLKGHVFLGVCEKICIPVQATFDFPLNGDGQQDSPQAI
FT                   AARTIIETAFDRLPTAATSTFGISDVKRDGDQAVFDLAVPDPAAPVELFVASDKIRISD
FT                   AVAIESSQPGHRFTAKVHGEADNAVVDYTIVQGGKAVSGQVTLD"
FT   sig_peptide     complement(621852..621920)
FT                   /locus_tag="Oant_0593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            complement(622007..622788)
FT                   /locus_tag="Oant_0594"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(622007..622453,622453..622788))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Oant_0594"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: gox:GOX2729 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13325"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH1"
FT                   /protein_id="ABS13325.1"
FT                   /translation="MSRGDLSESEWRVLKDLLPIEAVNRGRGRRPEQNRAIINGILWRL
FT                   RCGTPWRDVPPKYGNWNTIYRRFRRWSEAGVWEAVSITLAEIMADSGHYSIDSTTVRAH
FT                   ISAAGGKGGIHRRALGRSRGGFTSKLHCLADARGRPLAFHLTVGEAADCKAYDTLISLP
FT                   EQAPQALLADKGYDADAIRDDLASRNIKPVIPGRANRRVKIEYDRTLYKQRNLIERMFG
FT                   RLKINRAIATRYDQLAESFISMVHIATARYWLKFVHAA"
FT   gene            622907..623551
FT                   /locus_tag="Oant_0595"
FT   CDS_pept        622907..623551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0595"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   bme:BMEI1454 transcriptional regulator, AlgH"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13326"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH2"
FT                   /protein_id="ABS13326.1"
FT                   /translation="MTIVILRSLATFIFMTILKAPNKEQGFLNGQFLLAMPGMSDERFA
FT                   RSVVYICAHSDEGAMGFIINQLQPVEFPDLLRQIGVIDEDELIILPDRAQHMMVRNGGP
FT                   VDRTRGFVLHSDDYMVDSTMPVSEEVCLTATVDILRAIYGGRGPSRALMALGYSGWAPG
FT                   QIEVELAENGWLTCDAPLDMLFDSDIEGKYSRLMLHMGIDMSRLVSDAGHA"
FT   gene            complement(623636..626533)
FT                   /locus_tag="Oant_0596"
FT   CDS_pept        complement(623636..626533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0596"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   Diverse 7TM receptor extracellular region 2; Diverse 7TM
FT                   receptor transmembrane region; PAS fold-3 domain protein;
FT                   KEGG: bms:BR0481 sensory box/GGDEF domain/EAL domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13327"
FT                   /db_xref="GOA:A6WWH3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH3"
FT                   /protein_id="ABS13327.1"
FT                   /translation="MTGFADKWFVAGARFLALMVFLTVSVVQASAIEPIKISKEDTALD
FT                   LSRAVELLRNKGESVQVSTAPGPDGIVRRIEVQADQNSKASGDWAAFSIANPTDEQIDR
FT                   LIVAPHFRLVGSGVIWPDLGSPRIASITPSEGFALDRQPSADADVFRITLNPGSVVTFV
FT                   AELSSHNLPQLYLWEPEAYKDAVNSYTLYRGILLGISGLLALFLTILFVVKGTSLFPAT
FT                   AALAWAVLAYICVDFGFWNKLMEITPGNEQIWRAGTEVALAASLVIFLFTYLNLNRWHD
FT                   HFSYGAVTWVLGLLALAGVAVFDPPVASGIARISLALTVVSGVAIIGYLAVKGYDRAVM
FT                   LIPAWLLTLIWLLGAWMTVSGRLDNDIVQPALGGGLVLIVLLIGFTVMQHAFAGGALQQ
FT                   GLLSDMERQALAVIGAGDIVWDWDVPRDRVVTTPDIANYLGNTANSLQGPVRNWLPAMH
FT                   ADDRDRFRSTLDAILENRRGRIGQIFRLRANDGHYHWYALRARPVIGSDGEVVRCVGTL
FT                   VNVTEQKKAEERLLHDAVHDNLTGLPNRELFLDRLSNVMNMARGESNLHPTVFIIDIDR
FT                   FKQVNDSLGMSAGDTILLTISRRLARLMKPQDTLSRLSSDQFGLLLASESDPGRIASFA
FT                   EALRQAVRAPIAYAKREIVLTASVGLITWTKTATTAEDFVKDAELAMYQAKRFGGDRIE
FT                   PFRPAFRAIGSDKLQLESDLRRALERDEISLVYQPIVKLDEGTIAGFEALMRWEHPRRG
FT                   AISPSEFIPIAENSGLIIQLGLFAMQRAAEDLFAWQEQFPKLDLFVSVNLSSTQLIRQD
FT                   LINDVRSVLSRIHLNPGSLKLELTESVLMENPEQSTHVLARLKAMGIGLSLDDFGTGYS
FT                   SLAYLTRFPFDIIKIDRSFVKGDQPQKATLLRSIVSMAHDLGLAVVTEGVESESDALQL
FT                   RQMGCEYVQSFMFGQPTSRDEATRMIREQLNAAAA"
FT   sig_peptide     complement(626444..626533)
FT                   /locus_tag="Oant_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.530 at
FT                   residue 30"
FT   gene            complement(626530..627150)
FT                   /locus_tag="Oant_0597"
FT   CDS_pept        complement(626530..627150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0597"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bmb:BruAb1_0504 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13328"
FT                   /db_xref="GOA:A6WWH4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH4"
FT                   /protein_id="ABS13328.1"
FT                   /translation="MIGLPFRRSNPTVLRGQRIYLREPMMSDFASWASLREQSRAFLAP
FT                   WEPTWPDDDLTKSAFRHRMRRFQDEISAGTGYPFFVFRNSDNKLVGGITLGNIRRGVGQ
FT                   NGMIGYWSGEPYAGKGYMTEALSLVIPFAFDQLRLHRIEAACIPHNERSIRLLEKAGFE
FT                   REGLLRSYLKINGFWQDHLLFALIESDKRMTDSRMINGKVGRS"
FT   gene            complement(627267..628559)
FT                   /locus_tag="Oant_0598"
FT   CDS_pept        complement(627267..628559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0598"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   bmb:BruAb1_0505 processing protease"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13329"
FT                   /db_xref="GOA:A6WWH5"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH5"
FT                   /protein_id="ABS13329.1"
FT                   /translation="MGVEVTRLSNGLTIATDTMSHVESVALGIWVKAGARNEAADRHGI
FT                   AHLLEHMAFKGTENRTAWQIASDIENVGGEINAATSVETTSYYARVLRNDVPLAIDILS
FT                   DILTASKFDEAELEREKQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPET
FT                   VMSFTSADLRQYMDEQYSADRMVVTAAGGVDHDAFVKEVEKRLGGFRAHNTAPTLDLAH
FT                   YVGGDFRENRELMDAQVLIGFEGRAYHVRDFYASQLLSMVLGGGMSSRLFQEVREKRGL
FT                   CYSVYAFHWGFSDTGLFGIHAATGRDELVELVPVLIDELHKAADSISLEEVDRARAQYR
FT                   ASLLMSQESAASRAGQVARQFLLYGRPVENSELMDRLSLITPERLTDLAGRLFLDSKPT
FT                   IAGVGPVGRLMSFDGLSDALSTSAHARKIAV"
FT   gene            complement(628614..630020)
FT                   /locus_tag="Oant_0599"
FT   CDS_pept        complement(628614..630020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0599"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: bmb:BruAb1_0506 ThrC, threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13330"
FT                   /db_xref="GOA:A6WWH6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH6"
FT                   /protein_id="ABS13330.1"
FT                   /translation="MKAQEMKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQDYPQFSP
FT                   EQIRDLRGKSYVDIALAVLTPFVDGEIPHSDFRRMVHEAYGTFRHDAVCPLVQTGANEF
FT                   VLELFHGPTLAFKDVAMQLLARMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNT
FT                   DIFILFPNGRVSPVQQRQMTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLQFRDALSLS
FT                   GVNSINWARIMPQVVYYFTAALSLGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIDQL
FT                   IIATNDNDILSRTLETGAYEMRGVAQTTSPSMDIQISSNFERLLFEAHGRDAAALRGLM
FT                   DSLKQSGGFSISEKPLSAIRSEFSAGRSTVDETAETIKSVLEADGYLLDPHSAIGLKVA
FT                   RENVSNTAPMVVLATAHPAKFPDAVKAASGVEPQLPAWLSDLMERKESFTVLHNDLKIV
FT                   EEYVRRHSRA"
FT   gene            630203..630793
FT                   /locus_tag="Oant_0600"
FT   CDS_pept        630203..630793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0600"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: bms:BR0486 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13331"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH7"
FT                   /protein_id="ABS13331.1"
FT                   /translation="MQTAPQNRSSLFPVFATVLLAALAGCTTSGTDKAADGGSGSSLTT
FT                   PAATGDQRIKESELRAFCPSVSLRDGTAFFNTYEKGGDKDPARVIYQAALTDTTRACQH
FT                   GAGTMTIDVAAAGKVVPGPKYKSGTITMPIRVAVRQGDQVIYSKLHKQAVTIANGDTAT
FT                   QFVFNDKTITVPMADKNNIQIFVGFDEGPYNTK"
FT   sig_peptide     630203..630307
FT                   /locus_tag="Oant_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.767 at
FT                   residue 35"
FT   gene            complement(631059..632087)
FT                   /locus_tag="Oant_0601"
FT   CDS_pept        complement(631059..632087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_4124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13332"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH8"
FT                   /protein_id="ABS13332.1"
FT                   /translation="MIDFIELNNDQRREKVNSDQRYEAFQQASATVKSFRGSLVWHSVG
FT                   GTEHLMRSYYNSAGVRRQKVEGRRSPETEAIKVKWDAARQAAQEVLSARKSQMERQTAV
FT                   NRALRLGRVPHLTARIIRAVDNAGLLGAGIRIVGTNAIFAYEAIAGVFVDPGITATDDI
FT                   DLLMDARRSLKMVVDDDIKNNSLLGLLKKVDKSFERTRSSYRAANREGYLVDLIKPPAK
FT                   PIWRESRESIGNGEDELVAAAIEGLDWLENSPPFEAIAIDEKGEPLRIVAPDPRIFAAH
FT                   KFWISQRGDREPVKRQRDRAQAETVAQLTTTYFKHLPYEASELRALPRNVFENAAPLFI
FT                   DT"
FT   gene            632450..632635
FT                   /locus_tag="Oant_0602"
FT   CDS_pept        632450..632635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb1_0510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13333"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWH9"
FT                   /protein_id="ABS13333.1"
FT                   /translation="MKQKYERILEPTDTWAIFDTSTGEPVIMGTRMLIGLSESEAEELL
FT                   AILNAPPKGRNKQSAA"
FT   gene            complement(632663..633355)
FT                   /locus_tag="Oant_0603"
FT   CDS_pept        complement(632663..633355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0603"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: bms:BR0489 hydrolase, haloacid dehalogenase-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABS13334"
FT                   /db_xref="GOA:A6WWI0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A6WWI0"
FT                   /protein_id="ABS13334.1"
FT                   /translation="MIMAAPSLIIFDCDGVLVDSEIIAAEVESTLLTEAGYQIAADEMA
FT                   ERFAGLTWQDILLTVEREAGIPLSASLLDKSEKILDEKLKNEVQAVEDIVEVVSALKLP
FT                   KCICSNSTSHRLESMLKRVGLYELFAPNIFSAKEVGTKKTKPAPDVFLYAAKQFGVDPK
FT                   DVIVIEDSAHGIQGARAAGMRVIGFTGGAHTYPGHADKLTDAGAETVIHRHKDLPSVIE
FT                   ALSIWTDA"
FT   gene            complement(633455..635248)
FT                   /locus_tag="Oant_0604"
FT   CDS_pept        complement(633455..635248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Oant_0604"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: CBS domain containing protein; Chloride
FT                   channel core; KEGG: bms:BR0490 voltage gated chloride
FT                   channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Oant_0604"
FT                   /db_xref="Ensem