(data stored in ACNUC13327 zone)

EMBL: CP000768

ID   CP000768; SV 1; circular; genomic DNA; STD; PRO; 1845106 BP.
XX
AC   CP000768; AARB02000000-AARB02000011;
XX
PR   Project:PRJNA17163;
XX
DT   23-JUL-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Campylobacter jejuni subsp. doylei 269.97, complete genome.
XX
KW   .
XX
OS   Campylobacter jejuni subsp. doylei 269.97
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Campylobacteraceae; Campylobacter.
XX
RN   [1]
RP   1-1845106
RA   Fouts D.E., Mongodin E.F., Puiu D., Sebastian Y., Miller W.G.,
RA   Mandrell R.E., Lastovica A.J., Nelson K.E.;
RT   "Complete Genome Sequence of Campylobacter jejuni subsp doylei 269.97
RT   isolated from human blood";
RL   Unpublished.
XX
RN   [2]
RP   1-1845106
RA   Fouts D.E., Mongodin E.F., Puiu D., Sebastian Y., Miller W.G.,
RA   Mandrell R.E., Lastovica A.J., Nelson K.E.;
RT   ;
RL   Submitted (12-JUL-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Drive, Rockville,
RL   MD 20850, USA
XX
DR   MD5; 42f0dfa6c048bb47d5b819ec313eeb16.
DR   BioSample; SAMN02604056.
DR   EnsemblGenomes-Gn; EBG00001069818.
DR   EnsemblGenomes-Gn; EBG00001069819.
DR   EnsemblGenomes-Gn; EBG00001069820.
DR   EnsemblGenomes-Gn; EBG00001069821.
DR   EnsemblGenomes-Gn; EBG00001069822.
DR   EnsemblGenomes-Gn; EBG00001069823.
DR   EnsemblGenomes-Gn; EBG00001069824.
DR   EnsemblGenomes-Gn; EBG00001069825.
DR   EnsemblGenomes-Gn; EBG00001069826.
DR   EnsemblGenomes-Gn; EBG00001069827.
DR   EnsemblGenomes-Gn; EBG00001069828.
DR   EnsemblGenomes-Gn; EBG00001069829.
DR   EnsemblGenomes-Gn; EBG00001069830.
DR   EnsemblGenomes-Gn; EBG00001069831.
DR   EnsemblGenomes-Gn; EBG00001069832.
DR   EnsemblGenomes-Gn; EBG00001069833.
DR   EnsemblGenomes-Gn; EBG00001069834.
DR   EnsemblGenomes-Gn; EBG00001069835.
DR   EnsemblGenomes-Gn; EBG00001069836.
DR   EnsemblGenomes-Gn; EBG00001069837.
DR   EnsemblGenomes-Gn; EBG00001069838.
DR   EnsemblGenomes-Gn; EBG00001069839.
DR   EnsemblGenomes-Gn; EBG00001069840.
DR   EnsemblGenomes-Gn; EBG00001069841.
DR   EnsemblGenomes-Gn; EBG00001069842.
DR   EnsemblGenomes-Gn; EBG00001069843.
DR   EnsemblGenomes-Gn; EBG00001069844.
DR   EnsemblGenomes-Gn; EBG00001069845.
DR   EnsemblGenomes-Gn; EBG00001069846.
DR   EnsemblGenomes-Gn; EBG00001069847.
DR   EnsemblGenomes-Gn; EBG00001069848.
DR   EnsemblGenomes-Gn; EBG00001069849.
DR   EnsemblGenomes-Gn; EBG00001069850.
DR   EnsemblGenomes-Gn; EBG00001069851.
DR   EnsemblGenomes-Gn; EBG00001069852.
DR   EnsemblGenomes-Gn; EBG00001069853.
DR   EnsemblGenomes-Gn; EBG00001069854.
DR   EnsemblGenomes-Gn; EBG00001069855.
DR   EnsemblGenomes-Gn; EBG00001069856.
DR   EnsemblGenomes-Gn; EBG00001069857.
DR   EnsemblGenomes-Gn; EBG00001069858.
DR   EnsemblGenomes-Gn; EBG00001069859.
DR   EnsemblGenomes-Gn; EBG00001069860.
DR   EnsemblGenomes-Gn; EBG00001069861.
DR   EnsemblGenomes-Gn; EBG00001069862.
DR   EnsemblGenomes-Gn; EBG00001069863.
DR   EnsemblGenomes-Gn; EBG00001069864.
DR   EnsemblGenomes-Gn; EBG00001069865.
DR   EnsemblGenomes-Gn; EBG00001069866.
DR   EnsemblGenomes-Gn; EBG00001069867.
DR   EnsemblGenomes-Gn; EBG00001069868.
DR   EnsemblGenomes-Gn; EBG00001069869.
DR   EnsemblGenomes-Gn; EBG00001069870.
DR   EnsemblGenomes-Gn; EBG00001069871.
DR   EnsemblGenomes-Gn; EBG00001069872.
DR   EnsemblGenomes-Gn; EBG00001069873.
DR   EnsemblGenomes-Gn; EBG00001069874.
DR   EnsemblGenomes-Gn; EBG00001069875.
DR   EnsemblGenomes-Gn; EBG00001069876.
DR   EnsemblGenomes-Gn; EBG00001069877.
DR   EnsemblGenomes-Gn; EBG00001069878.
DR   EnsemblGenomes-Gn; EBG00001069879.
DR   EnsemblGenomes-Gn; EBG00001069880.
DR   EnsemblGenomes-Gn; EBG00001069881.
DR   EnsemblGenomes-Gn; EBG00001069882.
DR   EnsemblGenomes-Gn; JJD26997_0032.
DR   EnsemblGenomes-Gn; JJD26997_0033.
DR   EnsemblGenomes-Gn; JJD26997_0034.
DR   EnsemblGenomes-Gn; JJD26997_0040.
DR   EnsemblGenomes-Gn; JJD26997_0041.
DR   EnsemblGenomes-Gn; JJD26997_0182.
DR   EnsemblGenomes-Gn; JJD26997_0343.
DR   EnsemblGenomes-Gn; JJD26997_0442.
DR   EnsemblGenomes-Gn; JJD26997_0443.
DR   EnsemblGenomes-Gn; JJD26997_0500.
DR   EnsemblGenomes-Gn; JJD26997_0777.
DR   EnsemblGenomes-Gn; JJD26997_0877.
DR   EnsemblGenomes-Gn; JJD26997_1032.
DR   EnsemblGenomes-Gn; JJD26997_1033.
DR   EnsemblGenomes-Gn; JJD26997_1099.
DR   EnsemblGenomes-Gn; JJD26997_1100.
DR   EnsemblGenomes-Gn; JJD26997_1156.
DR   EnsemblGenomes-Gn; JJD26997_1157.
DR   EnsemblGenomes-Gn; JJD26997_1158.
DR   EnsemblGenomes-Gn; JJD26997_1159.
DR   EnsemblGenomes-Gn; JJD26997_1160.
DR   EnsemblGenomes-Gn; JJD26997_1161.
DR   EnsemblGenomes-Gn; JJD26997_1162.
DR   EnsemblGenomes-Gn; JJD26997_1263.
DR   EnsemblGenomes-Gn; JJD26997_1264.
DR   EnsemblGenomes-Gn; JJD26997_1273.
DR   EnsemblGenomes-Gn; JJD26997_1274.
DR   EnsemblGenomes-Gn; JJD26997_1275.
DR   EnsemblGenomes-Gn; JJD26997_1441.
DR   EnsemblGenomes-Gn; JJD26997_1463.
DR   EnsemblGenomes-Gn; JJD26997_1466.
DR   EnsemblGenomes-Gn; JJD26997_1467.
DR   EnsemblGenomes-Gn; JJD26997_1468.
DR   EnsemblGenomes-Gn; JJD26997_1469.
DR   EnsemblGenomes-Gn; JJD26997_1519.
DR   EnsemblGenomes-Gn; JJD26997_1520.
DR   EnsemblGenomes-Gn; JJD26997_1522.
DR   EnsemblGenomes-Gn; JJD26997_1523.
DR   EnsemblGenomes-Gn; JJD26997_1524.
DR   EnsemblGenomes-Gn; JJD26997_1847.
DR   EnsemblGenomes-Gn; JJD26997_1978.
DR   EnsemblGenomes-Gn; JJD26997_1979.
DR   EnsemblGenomes-Gn; JJD26997_1980.
DR   EnsemblGenomes-Gn; JJD26997_1981.
DR   EnsemblGenomes-Gn; JJD26997_2038.
DR   EnsemblGenomes-Gn; JJD26997_2039.
DR   EnsemblGenomes-Gn; JJD26997_2040.
DR   EnsemblGenomes-Gn; JJD26997_2041.
DR   EnsemblGenomes-Gn; JJD26997_2042.
DR   EnsemblGenomes-Gn; JJD26997_2088.
DR   EnsemblGenomes-Gn; JJD26997_2089.
DR   EnsemblGenomes-Gn; JJD26997_2090.
DR   EnsemblGenomes-Gn; JJD26997_2091.
DR   EnsemblGenomes-Tr; EBT00001672922.
DR   EnsemblGenomes-Tr; EBT00001672924.
DR   EnsemblGenomes-Tr; EBT00001672925.
DR   EnsemblGenomes-Tr; EBT00001672927.
DR   EnsemblGenomes-Tr; EBT00001672929.
DR   EnsemblGenomes-Tr; EBT00001672930.
DR   EnsemblGenomes-Tr; EBT00001672932.
DR   EnsemblGenomes-Tr; EBT00001672934.
DR   EnsemblGenomes-Tr; EBT00001672935.
DR   EnsemblGenomes-Tr; EBT00001672936.
DR   EnsemblGenomes-Tr; EBT00001672939.
DR   EnsemblGenomes-Tr; EBT00001672941.
DR   EnsemblGenomes-Tr; EBT00001672943.
DR   EnsemblGenomes-Tr; EBT00001672945.
DR   EnsemblGenomes-Tr; EBT00001672948.
DR   EnsemblGenomes-Tr; EBT00001672949.
DR   EnsemblGenomes-Tr; EBT00001672952.
DR   EnsemblGenomes-Tr; EBT00001672954.
DR   EnsemblGenomes-Tr; EBT00001672955.
DR   EnsemblGenomes-Tr; EBT00001672957.
DR   EnsemblGenomes-Tr; EBT00001672958.
DR   EnsemblGenomes-Tr; EBT00001672961.
DR   EnsemblGenomes-Tr; EBT00001672964.
DR   EnsemblGenomes-Tr; EBT00001672966.
DR   EnsemblGenomes-Tr; EBT00001672968.
DR   EnsemblGenomes-Tr; EBT00001672970.
DR   EnsemblGenomes-Tr; EBT00001672971.
DR   EnsemblGenomes-Tr; EBT00001672974.
DR   EnsemblGenomes-Tr; EBT00001672977.
DR   EnsemblGenomes-Tr; EBT00001672979.
DR   EnsemblGenomes-Tr; EBT00001672981.
DR   EnsemblGenomes-Tr; EBT00001672983.
DR   EnsemblGenomes-Tr; EBT00001672985.
DR   EnsemblGenomes-Tr; EBT00001672987.
DR   EnsemblGenomes-Tr; EBT00001672989.
DR   EnsemblGenomes-Tr; EBT00001672991.
DR   EnsemblGenomes-Tr; EBT00001672994.
DR   EnsemblGenomes-Tr; EBT00001672997.
DR   EnsemblGenomes-Tr; EBT00001673000.
DR   EnsemblGenomes-Tr; EBT00001673002.
DR   EnsemblGenomes-Tr; EBT00001673004.
DR   EnsemblGenomes-Tr; EBT00001673007.
DR   EnsemblGenomes-Tr; EBT00001673009.
DR   EnsemblGenomes-Tr; EBT00001673010.
DR   EnsemblGenomes-Tr; EBT00001673012.
DR   EnsemblGenomes-Tr; EBT00001673014.
DR   EnsemblGenomes-Tr; EBT00001673016.
DR   EnsemblGenomes-Tr; EBT00001673018.
DR   EnsemblGenomes-Tr; EBT00001673020.
DR   EnsemblGenomes-Tr; EBT00001673022.
DR   EnsemblGenomes-Tr; EBT00001673024.
DR   EnsemblGenomes-Tr; EBT00001673027.
DR   EnsemblGenomes-Tr; EBT00001673028.
DR   EnsemblGenomes-Tr; EBT00001673029.
DR   EnsemblGenomes-Tr; EBT00001673031.
DR   EnsemblGenomes-Tr; EBT00001673033.
DR   EnsemblGenomes-Tr; EBT00001673035.
DR   EnsemblGenomes-Tr; EBT00001673036.
DR   EnsemblGenomes-Tr; EBT00001673038.
DR   EnsemblGenomes-Tr; EBT00001673039.
DR   EnsemblGenomes-Tr; EBT00001673040.
DR   EnsemblGenomes-Tr; EBT00001673042.
DR   EnsemblGenomes-Tr; EBT00001673044.
DR   EnsemblGenomes-Tr; EBT00001673046.
DR   EnsemblGenomes-Tr; EBT00001673048.
DR   EnsemblGenomes-Tr; JJD26997_0032-1.
DR   EnsemblGenomes-Tr; JJD26997_0033-1.
DR   EnsemblGenomes-Tr; JJD26997_0034-1.
DR   EnsemblGenomes-Tr; JJD26997_0040-1.
DR   EnsemblGenomes-Tr; JJD26997_0041-1.
DR   EnsemblGenomes-Tr; JJD26997_0182-1.
DR   EnsemblGenomes-Tr; JJD26997_0343-1.
DR   EnsemblGenomes-Tr; JJD26997_0442-1.
DR   EnsemblGenomes-Tr; JJD26997_0443-1.
DR   EnsemblGenomes-Tr; JJD26997_0500-1.
DR   EnsemblGenomes-Tr; JJD26997_0777-1.
DR   EnsemblGenomes-Tr; JJD26997_0877-1.
DR   EnsemblGenomes-Tr; JJD26997_1032-1.
DR   EnsemblGenomes-Tr; JJD26997_1033-1.
DR   EnsemblGenomes-Tr; JJD26997_1099-1.
DR   EnsemblGenomes-Tr; JJD26997_1100-1.
DR   EnsemblGenomes-Tr; JJD26997_1156-1.
DR   EnsemblGenomes-Tr; JJD26997_1157-1.
DR   EnsemblGenomes-Tr; JJD26997_1158-1.
DR   EnsemblGenomes-Tr; JJD26997_1159-1.
DR   EnsemblGenomes-Tr; JJD26997_1160-1.
DR   EnsemblGenomes-Tr; JJD26997_1161-1.
DR   EnsemblGenomes-Tr; JJD26997_1162-1.
DR   EnsemblGenomes-Tr; JJD26997_1263-1.
DR   EnsemblGenomes-Tr; JJD26997_1264-1.
DR   EnsemblGenomes-Tr; JJD26997_1273-1.
DR   EnsemblGenomes-Tr; JJD26997_1274-1.
DR   EnsemblGenomes-Tr; JJD26997_1275-1.
DR   EnsemblGenomes-Tr; JJD26997_1441-1.
DR   EnsemblGenomes-Tr; JJD26997_1463-1.
DR   EnsemblGenomes-Tr; JJD26997_1466-1.
DR   EnsemblGenomes-Tr; JJD26997_1467-1.
DR   EnsemblGenomes-Tr; JJD26997_1468-1.
DR   EnsemblGenomes-Tr; JJD26997_1469-1.
DR   EnsemblGenomes-Tr; JJD26997_1519-1.
DR   EnsemblGenomes-Tr; JJD26997_1520-1.
DR   EnsemblGenomes-Tr; JJD26997_1522-1.
DR   EnsemblGenomes-Tr; JJD26997_1523-1.
DR   EnsemblGenomes-Tr; JJD26997_1524-1.
DR   EnsemblGenomes-Tr; JJD26997_1847-1.
DR   EnsemblGenomes-Tr; JJD26997_1978-1.
DR   EnsemblGenomes-Tr; JJD26997_1979-1.
DR   EnsemblGenomes-Tr; JJD26997_1980-1.
DR   EnsemblGenomes-Tr; JJD26997_1981-1.
DR   EnsemblGenomes-Tr; JJD26997_2038-1.
DR   EnsemblGenomes-Tr; JJD26997_2039-1.
DR   EnsemblGenomes-Tr; JJD26997_2040-1.
DR   EnsemblGenomes-Tr; JJD26997_2041-1.
DR   EnsemblGenomes-Tr; JJD26997_2042-1.
DR   EnsemblGenomes-Tr; JJD26997_2088-1.
DR   EnsemblGenomes-Tr; JJD26997_2089-1.
DR   EnsemblGenomes-Tr; JJD26997_2090-1.
DR   EnsemblGenomes-Tr; JJD26997_2091-1.
DR   EuropePMC; PMC2147049; 18159241.
DR   EuropePMC; PMC2412886; 18492293.
DR   EuropePMC; PMC2704436; 19304960.
DR   EuropePMC; PMC2869123; 20348308.
DR   EuropePMC; PMC2928727; 20865039.
DR   EuropePMC; PMC3111999; 21677848.
DR   EuropePMC; PMC3289066; 22208406.
DR   EuropePMC; PMC3886934; 24084637.
DR   EuropePMC; PMC4510157; 26025899.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01069; purD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000768.
DR   SILVA-SSU; CP000768.
XX
CC   This strain is available at ATCC BEIR.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1845106
FT                   /organism="Campylobacter jejuni subsp. doylei 269.97"
FT                   /sub_species="doylei"
FT                   /strain="269.97"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:360109"
FT   gene            1..1323
FT                   /gene="dnaA"
FT                   /locus_tag="JJD26997_0001"
FT   CDS_pept        1..1323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="JJD26997_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43355"
FT                   /db_xref="GOA:A7H194"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H194"
FT                   /protein_id="ABS43355.1"
FT                   /translation="MNPSQILENLKKELNENEYENYLSNLKFNEKQSKADLLVFNAPNE
FT                   LMAKFIQTKYGKKIAHFYEVQSGNKAIINIQAQSTKQSNKSTKIDIAHIQAQSTILNPS
FT                   FTFESFVVGDSNKYAYGACKAIAHKDKLGKLYNPIFVYGPTGLGKTHLLQAVGNASLEM
FT                   GKKVIYATSENFINDFTSNLKNGSLDKFHEKYRNCDVLLIDDVQFLGKTDKIQEEFFFI
FT                   FNEIKNNDGQIIMTSDNPPNMLKGITERLKSRFAHGIIADITPPQLDTKIAIIRKKCEF
FT                   NDINLSNDIINYIATSLGDNIREIEGIIISLNAYATILGQEITLELAKSVMKDHIKEKK
FT                   ENITIDDILSLVCKEFNIKPSDVKSNKKTQNIVTARRIVIYLARTLTALTMPQLANYFE
FT                   MKDHTAISHNVKKITEMIENDTSLKAKIEELKNKILIKSQS"
FT   gene            1483..2550
FT                   /gene="dnaN"
FT                   /locus_tag="JJD26997_0002"
FT   CDS_pept        1483..2550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="JJD26997_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44385"
FT                   /db_xref="GOA:A7H195"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A7H195"
FT                   /protein_id="ABS44385.1"
FT                   /translation="MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIR
FT                   ASDYEIGINYKIKKIRVESSGFATANAKSITDVIKNLNNEEIVLETIDNFLFIRQKSTK
FT                   YKLPMFNHEDFPNFPNTEGKNQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGAFLDIKT
FT                   DKINFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKLFYEKIEIFYDQNMLIAKN
FT                   ENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEKMKLHFNKNKI
FT                   IFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKHLLDFLTSIEEEKFTLSVSEPNSAFI
FT                   VKSQGLSMIIMPMIL"
FT   gene            2579..4888
FT                   /gene="gyrB"
FT                   /locus_tag="JJD26997_0003"
FT   CDS_pept        2579..4888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="JJD26997_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43536"
FT                   /db_xref="GOA:A7H196"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H196"
FT                   /protein_id="ABS43536.1"
FT                   /translation="MQENYGASNIKVLKGLEAVRKRPGMYIGDTNIGGLHHMIYEVVDN
FT                   SIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTENMPTLTVVLTVLHAGGKFD
FT                   KDTYKVSGGLHGVGVSVVNALSKKLVATVERNKEIYRQEFSEGKVISEFGVIGKSKKTG
FT                   TTIEFWPDDQIFEVTEFDYEILAKRFRELAYLNPKITINFKDNRVGKHESFHFEGGISQ
FT                   FVTDLNKKEALTKAIFFSVDEEDVNVEVALLYNDTYSENLLSFVNNIKTPDGGTHEAGF
FT                   RMGLTRVISNYIEANASAREKDNKITGEDVREGLIAVVSVKVPEPQFEGQTKGKLGSTY
FT                   VRPIVSKASFEYLTKYFEENPVEAKAIMNKALMAARGREAAKKARELTRKKESLSVGTL
FT                   PGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAILPLRGKILNVEKARLDKIL
FT                   KSEQIQNMITAFGCGIGEDFDLSKLRYHKIIIMTDADVDGSHIQTLLLTFFFRFMNELV
FT                   ANGHIYLAQPPLYLYKKAKKQIYLKDEKALSEYLIETGIEGLNYEGIGMNDLKDYLKIV
FT                   AAYRAILKDLEKRFNVISVIRYMIENSNLVKGNNEELFSVIKQFLETQGHNILNHYINE
FT                   NEIRAFVQTQNGLEELVINEELFTHPLYEEASYIFDKIKDRGLEFDKDILEVLEDVETN
FT                   AKKGATIQRYKGLGEMNPEQLWETTMDPSVRRLLKITIEDAQSANDTFNLFMGDEVEPR
FT                   RDYIQVHAKDVKHLDV"
FT   gene            complement(4936..6582)
FT                   /locus_tag="JJD26997_0004"
FT   CDS_pept        complement(4936..6582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0004"
FT                   /product="cation/acetate symporter ActP"
FT                   /note="identified by match to protein family HMM PF00474;
FT                   match to protein family HMM TIGR00813"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44294"
FT                   /db_xref="GOA:A7H197"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A7H197"
FT                   /protein_id="ABS44294.1"
FT                   /translation="MKVFIFLSLIFNLALSAGFDLGEIHQKPINIIAVSMFLIFVLATL
FT                   FITYYSNKKSKSKSGFYTAGGNITGMQNGMAIAGDYMSAASFLGITALVFTNGFDGLIY
FT                   SIGFLVGWPIILFLIAEKFRNLGKFTFADITAYRLEVKPIRVISAVSALSVIIFYLIAQ
FT                   MVGAGQLIQLLFGLPYTFAVILVGILMICYVTFGGMHATTWVQIIKAILLLAGATFMAV
FT                   MILYLTKFNLKYYFDLAISHHPKGENIMKPGTFLPDTISALSLGLALMFGTAGLPHILM
FT                   RFFTVKDAKEARKSVFYATGFIGYFYILTFIIGFGAIALLLGNSQFTNADGSFNGATNM
FT                   VAVILADVLGGDVFLGFISAVAFATILAVVAGLAISGAGAISHDLYVNVIKDGKIDHKS
FT                   EMRITKIATIVVGIFAILLGIVFEKQNVAFTVGLAFAIAASVNFPILLLCIYWKNLTTK
FT                   GAFWGGLIGLMVVLALVILSPSIWVKSFGFSEAIFPYNHPALFSMPLSFILIYIISKLD
FT                   DSKRAKKDKEGFKAQDFRAQSGVGVSEAVTH"
FT   gene            complement(6579..6938)
FT                   /locus_tag="JJD26997_0005"
FT   CDS_pept        complement(6579..6938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0005"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF04341"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43397"
FT                   /db_xref="GOA:A7H198"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A7H198"
FT                   /protein_id="ABS43397.1"
FT                   /translation="MNLSVEQKNAILRFKKFVSFRNKISLNLSLIVLICYYIFVLGIGL
FT                   MPEILGYKLGPSSITLGIMVGIGLILLCIISTGIYTFIANYFLDKEQEEIIKSLENEGL
FT                   IDVLKDGKINYKELV"
FT   gene            7169..8470
FT                   /locus_tag="JJD26997_0006"
FT   CDS_pept        7169..8470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0006"
FT                   /product="Na+/H+ antiporter family protein"
FT                   /note="identified by match to protein family HMM PF03553;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM PF06808"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44366"
FT                   /db_xref="GOA:A7H199"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:A7H199"
FT                   /protein_id="ABS44366.1"
FT                   /translation="MILLTNPIIISVVLMTLLCLFRFNVLLSLLISALVAGVFSHLELV
FT                   DTMNILISGMKENLKTALSYILLGAIAATISKTNLTAYLIKIVSHFISHKKYLLLLSIA
FT                   LISCFSQNLIPIHVAFIPLLIPPLLGLFNKLKIDRRAVVCALTFGLTTPYMVLPVGFGL
FT                   TFQDLLKDNLNANNVSVSLNDVTNTMYFAAICMITGLFLALFVFYRKPREYQEVEIAKV
FT                   DLENLEMTRKEWGVLAGLVLTLILQILTMNLPLSGLLGFILMVILGGVEFSKVNEVFDD
FT                   GLKMMGFIAFVILVAAGYGEVLKESGSVVELVNSVVPWMEQSKFLAVFFILLIGLIITM
FT                   GIGTSFGTIPIIATLFCPICLELGFSTALIIFILGVAGALGDAGSPASETTMGTTVGLN
FT                   ADKQHDHIKDTCIPTFIFYNGPLLILGSIIAMFL"
FT   gene            8605..13092
FT                   /locus_tag="JJD26997_0007"
FT   CDS_pept        8605..13092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0007"
FT                   /product="glutamate synthase [NADPH] large chain"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01493; match to protein
FT                   family HMM PF01645; match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44167"
FT                   /db_xref="GOA:A7H1A0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1A0"
FT                   /protein_id="ABS44167.1"
FT                   /translation="MDLENILENNQSIGLYHPKNEHDACGIAAVANIRGIASYKVICDA
FT                   LEILMNLEHRGGAGAEENSGDGAGILIQIPHDFFKTQELGFELPKKGDYAVAQMFLSPN
FT                   IDAKEEAKEIFLQGLKDKKLEFLGFREVPFNPSDIGASALKAMPYFLQAFVKKPSKISA
FT                   GLEFERVLYNTRRLIEKRAINVPKFYFSSFSSRTIVYKGMLLSTQLSDFYLDFKDVNMK
FT                   SAIALVHSRFSTNTFPSWERAHPNRYMVHNGEINTIRGNVDSIRAREGLMQSEYFENLD
FT                   EIFPIIAKPSSDSAMFDNTLEFLALNGRTLEEAFMMMVPEPWHKNENMESKKRAFYEYH
FT                   SLLMEPWDGPAAIVFTDGVIMGASLDRNGFRPSRYYLTKDDMLILSSETGALKLDEKNI
FT                   KAKKRLEPGKLLLVDTARGRVVADNEIKEHYANAKPYKKWLKNLVELEKQKSGVYKHQF
FT                   LKKDEVLKLQKAFGWSYDELKMSVAAMAQNGKEAIAAMGVDTPLAILSKTYQPLYNYFK
FT                   QLFAQVTNPPLDAIREEIVTSTRIYLGSEGNLLKPDENNAKRVKIALPVISNEELFEVK
FT                   ALNKFQVKEFSILYDYSKKTLEKALDELCVKIEDEVKKGVSIIILSDKGVDEKNAYIPA
FT                   LLAVSGVHNHLVRKNLRTHTSLIIESGEPREIHHFACLLGYGATVINPYLVYESIQKLI
FT                   ANKDLNLSYEKAVENFIKASSSGIVKIASKMGVSTLQSYNGSVLFECLGLSSKVIDKYF
FT                   TSTTSRIEGMDLEDFEKELIALHKHAFNDTHKALDSKGIHGFRSAKEEHLIDPLVIFNL
FT                   QQACRNKDYKSFKKYSALVDEKQVNLRSLMEFDFSEAISIDKVESVESIVKRFRTGAMS
FT                   YGSISKEAHECLAQAMNKIGAKSNSGEGGEDEKRYEIKEGVDKNSAIKQVASGRFGVDL
FT                   NYLSHAKEIQIKVAQGAKPGEGGQLMGFKVYPWIAKARHSTAGVTLISPPPHHDIYSIE
FT                   DLAQLIYDLKNANKDAKISVKLVSENGIGTVAAGVAKAGANLILVSGYDGGTGASPRTS
FT                   IPHAGIPWELGLAETHQTLILNKLRDRVRLETDGKLMNGRDLAIAALLGAEEFGFATAP
FT                   LIVLGCTMMRVCHLNTCPFGIATQDTELRDRFKGKVDDVINFMYFIAEELREYMARLGF
FT                   ERLDDMIGRVDKLRQKSVQGKAGKLNLDKILKSLPTYNRTAVHFKDYKDNKLEKTIDYR
FT                   ILLPLCKNAVEKKEPIKLSLEVGNQSRTFATMLSSEILKTYGKDALDEDSIHIKAIGNA
FT                   GNSFGAFLLKGIKLEIIGDSNDYLGKGLSGGKIIAKISNEATFSPEENIIAGNACLYGA
FT                   TKGEVYLDGIAGERFCVRNSGALAVVLGTGVHGCEYMTGGQVVVLGDVGANFAAGMSGG
FT                   VVYIFGRHNEAHVNTELVDIKDLNAKDEKELKAVIEKHITYTDSKKAKDILEKFDKKDF
FT                   FKVMPRDYEKMLKMLDLCKNEKDPNLAAFLKITQ"
FT   gene            13114..14805
FT                   /locus_tag="JJD26997_0008"
FT   CDS_pept        13114..14805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0008"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF03235;
FT                   match to protein family HMM PF07510"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43403"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1A1"
FT                   /protein_id="ABS43403.1"
FT                   /translation="MAEMKTERKSVLDYLSKNKFLIPMYQRPYAWTLEECEQLWNDIVT
FT                   FFNDEDRKPEDEYFLGSIVMYKQNNHQNIIDGQQRTISLSLLLKALYVKAFKDRSEETK
FT                   NLVAMLESCLWDIDDISGKADYNASHLESDVITKEDEDILKQILTNEYRLENNDIETKI
FT                   KKVKSNYEKNYLFFLLKSDEFAKENPTKWEKFCVVLLKSCILLPIECEGYDEDSRLENA
FT                   LRIFNTLNNRGIPLSDSDIFKSIIFKSKKTLERRKEFANKWKELEDKKDMDFIFRNYMH
FT                   VIRARNKIKTSEIGLRVFFTKEYKNILQDDNIISEIEQLSKFWNDEFSDLYNNRSYQFY
FT                   EVLNELPNEYWKYLDSAYYMYCQDKKINYYKNHENFLAKIIANFLVKLINKPTIAEVKP
FT                   IVFNAYTSLYSKGELNFQTDSKQILENEILFKEQFFKANKLIPALLTLNLYIKYPNQKT
FT                   DIKAEIEHIFPKTTQWRPSYTGWDKEEAKSYIESIGNKMWLEKRLNIKAGNNYFDEKKE
FT                   KYKESNFLEAQELSKYTKNDWLKEDIEKRNEEIYNRLVDFFKQNID"
FT   gene            14822..16267
FT                   /gene="gltD"
FT                   /locus_tag="JJD26997_0009"
FT   CDS_pept        14822..16267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="JJD26997_0009"
FT                   /product="glutamate synthase, small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01317"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43860"
FT                   /db_xref="GOA:A7H1A2"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1A2"
FT                   /protein_id="ABS43860.1"
FT                   /translation="MGNTRGFLDFKRMDFKKIAPKERILNYKEFITLLDKKEQEIQGGR
FT                   CMDCGVAFCHTGVMSEGKDVGCPLNNLIPEWNDLIYRSLWEEAYERLDLTNPFPEFTGR
FT                   VCPAPCEDSCVCAINGTSVSIKNNELSIIENAFKENLVRVNKPKQYNGKKIAIIGSGPA
FT                   GLACANTLNSLGYKVSVFERSDKIGGLLMYGIPDMKLDKSIVDRRVDLLKKSGIEFKVN
FT                   ENIDSKDKVSKLLKEFDALVLCTGASKPIDLDIEGRKLKGVEFALDFLTQNTKTLLKTG
FT                   KGADAAKGKNVLVIGSGDTSVDCIAVATRQGAKSIVRFERSPKKPLQRSQNNPWPLKAD
FT                   IFTTDYGLEEAIAVYGKDPREYQKMTKKFLGKTYVEGVEANDLKREFKEGKAINVEIPN
FT                   SKKTYKVDLVLLAMGFSGCEEAIAKNFGVKLDEKNNISTENFQTTHKKIFACGDARKGQ
FT                   SLVVWAIKDGIECALSLHQNLAK"
FT   gene            complement(16268..16843)
FT                   /gene="rnhB"
FT                   /locus_tag="JJD26997_0010"
FT   CDS_pept        complement(16268..16843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="JJD26997_0010"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43335"
FT                   /db_xref="GOA:A7H1A3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1A3"
FT                   /protein_id="ABS43335.1"
FT                   /translation="MKTLFDTKELLNEFDINLIGIDEAGRGALAGPMMMAACKLNKKLD
FT                   GLCDSKKLSEKKREELYEIIIKNSNYLILAFSSEQIDTLGLSTCLKTGLKLIKKHFKAE
FT                   NNFLYDGNTNLGINGIKTQIKADTSILQVSAASILAKVSKDKVMNFLAKDFPCYEFEKN
FT                   KAYGTKAHKEVIAKFGICKLHRKSFKLL"
FT   gene            complement(16876..17115)
FT                   /gene="comEA"
FT                   /locus_tag="JJD26997_0011"
FT   CDS_pept        complement(16876..17115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comEA"
FT                   /locus_tag="JJD26997_0011"
FT                   /product="competence protein ComEA"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM TIGR00426"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43661"
FT                   /db_xref="GOA:A7H1A4"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1A4"
FT                   /protein_id="ABS43661.1"
FT                   /translation="MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILE
FT                   YRKEANFTSIDDLKKVKGIGDKLFEKIKNDITVE"
FT   gene            complement(17181..17732)
FT                   /gene="rbr"
FT                   /locus_tag="JJD26997_0012"
FT   CDS_pept        complement(17181..17732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbr"
FT                   /locus_tag="JJD26997_0012"
FT                   /product="rubrerythrin"
FT                   /note="identified by match to protein family HMM PF00301;
FT                   match to protein family HMM PF02915; match to protein
FT                   family HMM PF06397; match to protein family HMM TIGR00319"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44669"
FT                   /db_xref="GOA:A7H1A5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1A5"
FT                   /protein_id="ABS44669.1"
FT                   /translation="MKCITTDLTAVNLMKAFAGESMARNKYDLFADVAEEEGWHAVARH
FT                   FREAAENEKWHARAEFKAYHEIVDGKPLEVTTKNLVSAAEGENYEHTTMYPNFAKIAED
FT                   EGKKAIARLFTAIGKVEIEHEREYLALKKMLEEEEFFNSEVEELWVCEVCGHIHRGKKA
FT                   PAACPLCKAPKEYFKREFLG"
FT   gene            17988..19664
FT                   /gene="ilvD"
FT                   /locus_tag="JJD26997_0013"
FT   CDS_pept        17988..19664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="JJD26997_0013"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44270"
FT                   /db_xref="GOA:A7H1A6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1A6"
FT                   /protein_id="ABS44270.1"
FT                   /translation="MRSDAIKKGHLKAPNRSLLRACGLKDEDFDKPFIGVANSYIDIIP
FT                   GHYFLNDYAKIIKDEIRKNGCVPFEFNTIGIDDGIAMGHEGMLYSLPSREIIANSIETV
FT                   MNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTKKGEKISLSSVFE
FT                   AVGAYEAKKISEEEFKDIECSACPSGGSCSGMFTANSMNTLCEAMGIALEGNGTILALS
FT                   KEREELLRKAARRICEIALDERFKIRNIITQKAVRNAMIVDMAMGGSSNTVLHMLAISR
FT                   EAGVALDIKDLNFISSKVAHIAKIAPSLNSVYMDDIHKAGGVSAVMAEISSRQGHILEL
FT                   DALTITGESLEERLKNAKIKDENIIRKVDNAYSKVGGLAILFGNLAEQGCVIKTAGIIG
FT                   ERKFKGKAVCFNSQDEAIKGIIKGKVQKGNVCVIRYEGPKGGPGMQEMLSPTSLLMGMG
FT                   LGADVALITDGRFSGATRGLSIGHISPEAAEGGLIGLLKDGDEIEIDVDAYTIHANLSE
FT                   KEITQRKKEFVLPQKEVPSRWLRMYQKLVSNASKGAVLDME"
FT   gene            complement(19676..19825)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0014"
FT                   /note="putative membrane protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(20162..21388)
FT                   /locus_tag="JJD26997_0015"
FT   CDS_pept        complement(20162..21388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44047"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1A7"
FT                   /protein_id="ABS44047.1"
FT                   /translation="MINIKLIEHIFKAASISRWNDYPRMANLVELDKQAHKFIIAYFIA
FT                   KMEKDVDMRVIIEGGIFEFLSRVVVTDIRPDVYHEIVRQKKAEVNAWVLSKIEPMIEDI
FT                   EDGEFLKRFEAYLNGNAYAKERLILKAASYFATRWEFNIVYQTSAFLNDIDEIKNKVEE
FT                   ELEDYYELIGARKIALNQKIAKIIDLSGRLRFQKRWAQTPRIPETAVLGHMLVVAILGY
FT                   FYSLKIKACDKRLENNFYCALFHDLPESLTRDIISPVKYGIDGLHDIINDYEMKLINEK
FT                   ILPFVPEGLRAEFSYILGIREGRNDESNFVKNEFENRTYKNAKIELCSGSLSSFNENEF
FT                   GAIDGKALKYCDKIAAYIEAGLSISYGVKSKELESGFLGMHEFFKENPTIDGVNFFEIC
FT                   ESLREYFKI"
FT   gene            21465..22139
FT                   /locus_tag="JJD26997_0016"
FT   CDS_pept        21465..22139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0016"
FT                   /product="exsB protein"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43180"
FT                   /db_xref="GOA:A7H1A8"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1A8"
FT                   /protein_id="ABS43180.1"
FT                   /translation="MSKKALCIISGGMDSTLCAYLAKKEGYEIIALHFDYEQRTQEKEK
FT                   ECFKQICKALKVEKSYILDVSFIKDIGGNALTDKSIDIPKNELCISDIPPITYVPFRNG
FT                   IFLSIAGSLAEKENCESIFIGVVEEDGSGYPDCTDEFIQKAQEFINEGTSKNFKVCIKT
FT                   PLVRLNKAKIVELALKENVPLELTWSCYESEDEACGECDSCLLRLRGFEKAGFKDKIKY
FT                   KS"
FT   gene            complement(22160..23686)
FT                   /locus_tag="JJD26997_0017"
FT   CDS_pept        complement(22160..23686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0017"
FT                   /product="disulfide bond formation protein, DsbB family"
FT                   /note="identified by match to protein family HMM PF02600"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43164"
FT                   /db_xref="GOA:A7H1A9"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1A9"
FT                   /protein_id="ABS43164.1"
FT                   /translation="MNEINKTKNFYALMCLAGFLIILLPVGIANFVFGYMLGDSPCTLC
FT                   WGQREAMIFIGVMALFIVRYGMKGKYLAALLIMTAVGLYQSFAHYGNHAHRDLDQGFGL
FT                   AVFGIHTYFWAEVVFWAVVLLLGVIFAFAPKFNAFETELNGEKFRKYTKFSFTAVLISA
FT                   IIVASNVFQAFVSTGIPPYVGQGDPVRFSLNPKYIIWSTDGWKGLWQNISFLGKRDVKT
FT                   PDYAFAPASEKLGIKFDNDINNAPFAKINDELKITNEQTINFDKAINTLDYINNEFVAS
FT                   SKWDVAFLDNNFSVKEGFELDPYFSASIDPIIGIIPYMNDKFILMGSNKSFLRFAKNPN
FT                   ASEEDIAKQYADFVKGNDKFKGQGEGLGRGRLDTVRAKFNHVASMSTDGNYLYLATVPN
FT                   NKDAKTFVISKVSLKDRVLSGEFTPKANLKEGKTLGDLYVTSMTFKDGKIYALSKNHNV
FT                   IAVIDPVKEEVVKTIAFPSSITNARSIFFKDGKINILSYQDGSNKLYALN"
FT   gene            complement(23698..23865)
FT                   /locus_tag="JJD26997_0018"
FT   CDS_pept        complement(23698..23865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43948"
FT                   /db_xref="GOA:A7H1B0"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B0"
FT                   /protein_id="ABS43948.1"
FT                   /translation="MEFLELLLVLIALILIIKKPEKENLAFGLVMVAWLLMVFFYVGHK
FT                   TGALLTIMNL"
FT   gene            complement(24358..25498)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0019"
FT                   /note="methyl-accepting chemotaxis protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00672"
FT   gene            complement(25750..26339)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0022"
FT                   /note="cytochrome c551 peroxidase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            complement(26450..27316)
FT                   /locus_tag="JJD26997_0023"
FT   CDS_pept        complement(26450..27316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0023"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43285"
FT                   /db_xref="GOA:A7H1B1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B1"
FT                   /protein_id="ABS43285.1"
FT                   /translation="MKFVNFIQGQKPGLGVLNSSGKIVSFADLGIETNDMNEFIIYFDK
FT                   FKHKLTDLDSKIAYEVPKENYLAPIIEPRQDIICLGINFLDHAKESAKFKGEKFEEREY
FT                   PVYFGKRCNQATPPFGDIPLHADVTSQLDYECELAFILSKDAYKIKAKDAKDYIFGYTI
FT                   INEISARELQKRHKQFYRAKSLEGSTIMGPYITSVDEISYPPKLQLQSYVNDELRQNSN
FT                   TQLFIFDIACVLEELSAGMLLKTGSIISMGTPSGVGMGLNPPTFLKSGDKVRCVIENLG
FT                   ELCNKVK"
FT   gene            complement(27427..28329)
FT                   /locus_tag="JJD26997_0024"
FT   CDS_pept        complement(27427..28329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0024"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44258"
FT                   /db_xref="GOA:A7H1B2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B2"
FT                   /protein_id="ABS44258.1"
FT                   /translation="MAYIKIKLSNNEKKAFQVLVENLKISINEAQKLIDKKRLFCDGIL
FT                   VEEKNKILKGLVELIVYENNPKGVEIVFENENFAILEKESGILSHPNGRHCKYSLSDEI
FT                   WHLWGKGACVAHRLDKETSGLILVAKNKKAQIDLKSLFEKKLVQKEYLALAHGKIEKNF
FT                   IVDKAINLAKNYDDVKTRMQICKEGKQAITEFKILEYFPKINATLLLCKPLTGRQHQIR
FT                   VHLHYKNHTILGDPLYGLSKEQIESILDEKLSPKERLKLTGALRLCLHSYRLKFQYKNQ
FT                   NFDINSKINIKEIFNNSIK"
FT   gene            28407..29735
FT                   /gene="purB-1"
FT                   /locus_tag="JJD26997_0025"
FT   CDS_pept        28407..29735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB-1"
FT                   /locus_tag="JJD26997_0025"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43478"
FT                   /db_xref="GOA:A7H1B3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B3"
FT                   /protein_id="ABS43478.1"
FT                   /translation="MVERYSREIMAKKWDMQAKYDAWLKVELAAVKAWNKLGLINDTDC
FT                   EKILKNAKFDIARIDEIEKTTKHDVIAFLTSVSESLGEESRFVHYAMTSSDCIDTAVAL
FT                   QIKESLELILEDVSLLLEAIKKRALEHKNTLMVGRSHGIHGEPITFGLVLAIWYDEISH
FT                   AKELLEHAKEVISYGKISGAMGNFAHAPLEFEEEVCKNLGLKAAPVSNQVIQRDRYAQV
FT                   ISAIAILASSCEQIAVAIRHFQRTEVYEAEEYFSVGQKGSSAMPHKRNPVLSENITGLC
FT                   RVLRSFVTPALENVALWHERDISHSSVERFILPDAFITADFMLMRLTNLIDKLLVYPEN
FT                   MMKNLNLTGGLVFSGRVLLELPFKGISREEAYKIVQRNAMKVWADLQNGKAAINEKNES
FT                   LFLLALLGDEDLRKSLSEEDVRKCFDYNYYTKNVDAIFKRTFK"
FT   gene            29751..32120
FT                   /gene="nrdA"
FT                   /locus_tag="JJD26997_0026"
FT   CDS_pept        29751..32120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="JJD26997_0026"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00317;
FT                   match to protein family HMM PF02867; match to protein
FT                   family HMM PF03477; match to protein family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44521"
FT                   /db_xref="GOA:A7H1B4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B4"
FT                   /protein_id="ABS44521.1"
FT                   /translation="MKVIKRNGRTEELDVSKIKKCTSDAVKDLEGVNLSELELDAKIQF
FT                   RDGISTEEIQKTLIKTAVDKIDIDCPNWTFVAARLFLFDLYKKVNGMNRYNHLREYFEK
FT                   GEKEGRILLGLKEKYDLDDLNAYIKPERDMQFTYLGIKTLYDRYLLKDSKGMPIELPQQ
FT                   MFMAIAMFLAQNEFNPQEWAKKFYDLISKFELMLATPTLSNARTTRHQLSSCYIGSTPD
FT                   NIEGIFDSYQEMALLSKFGGGIGWDWSKVRAMGGSIDGHKNAAGGIIPFLKITNDIAVA
FT                   VDQLGTRKGAIAVYIEPWHMDISDFIDLRKNSGEERRRAHELFPALWINDLFMKRVRAN
FT                   DKWTLFDPADTADLCDLYGEAFEKRYEEYEKDESITKEIVEAKELWKKILLNYFETGLP
FT                   FLCFKDSANRANPNAHVGIIRSSNLCTEIFQNTEPNYYQIKVVFENGDELHFDEEQKVV
FT                   IDGGYEKPAKKISTLDSIDGNKVYIVEKYKNDGKTAVCNLASINLSKVYTKEDIERVVP
FT                   TAIRMLDNVIDLNFYPHRKVKDTNLKSRAIGLGVMGEAQMLAEAKIHWGSDEHLNKIDE
FT                   IMEQISFEAINASSNLALEKGSYEDFEGSNWSKGIFPIDVASPKAKALTLREGLFDQSE
FT                   CDWVKLREKVKKDGMRNGYLMAIAPTSSISILVGTTQTIEPVYKRKWFEQNLSGMIPVV
FT                   VPNLSLDTWQYYTPAYELDQKILVKAAAVRGKWIDQGQSLNIFLSLDKASGGYLNEIYQ
FT                   LAWELGVKSTYYLRSESPDSEKVNVADRSIECEGCQ"
FT   gene            complement(32159..33544)
FT                   /locus_tag="JJD26997_0027"
FT   CDS_pept        complement(32159..33544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0027"
FT                   /product="sodium/dicarboxylate symporter"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43577"
FT                   /db_xref="GOA:A7H1B5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B5"
FT                   /protein_id="ABS43577.1"
FT                   /translation="MNKQFFQDFLMLSQAHTIATLAILCVVFYALKKMRDIKINFSLRM
FT                   LFALLMGLGFGFALQYLANFPDAKEVSNILWYGETKHWFAFVSSVFMAFIKMLIVPLVS
FT                   ICIIKAIIEIDKNIKISSLLGISLFWILFSTAIAATLGIFLGYSFDLGSNFAIHEGDKQ
FT                   IREIQTFSNIILGLIPSNIITAINKENIIAIVIFSFFIGISAKKISKKEEYEQAFKSFH
FT                   NFILTFFNIMMNMTATVIRFMPYAVVCMMANVLLSNGFEAIKTAGLFIMLIYIAMFIMF
FT                   GVHFLLLASQGLNPIKYAKKAFPVWLFAFSSRSSLGTLPMTTSTLQNKFGVNSAIANFV
FT                   ASIGTTTGLNGCAGYFPALAAVFVAFATHTHIDFTFALMIVLVAVIGSLGIAGVPGSAT
FT                   MAASIMLAGIGFGNNFVMLSLILAIDPIIDMARTASNVSGAMTSALCTAKNLKALDKEI
FT                   YNS"
FT   gene            complement(33664..34287)
FT                   /gene="thyX"
FT                   /locus_tag="JJD26997_0028"
FT   CDS_pept        complement(33664..34287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="JJD26997_0028"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="identified by match to protein family HMM PF02511;
FT                   match to protein family HMM TIGR02170"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44354"
FT                   /db_xref="GOA:A7H1B6"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B6"
FT                   /protein_id="ABS44354.1"
FT                   /translation="MQITLLFHTPLSVCSHATRTCWQSFEKGDCGGEKDKELIDRVGNK
FT                   FKHASTLEHLNYTFYIQGISRACLQEVARHRHTSPSVKSTRYTLKELRNEAEFKIGDFE
FT                   NASRYLVLCGNEEVDNASIKALENLRTILQKSISLDIAKYCLPESYKTELTLTINARSL
FT                   QNFISLRSSKSALWEIRNLANALFEALPQEHKFIFEYCLHKDIE"
FT   gene            34406..36037
FT                   /gene="pyrG"
FT                   /locus_tag="JJD26997_0029"
FT   CDS_pept        34406..36037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="JJD26997_0029"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43723"
FT                   /db_xref="GOA:A7H1B7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1B7"
FT                   /protein_id="ABS43723.1"
FT                   /translation="MKQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKASILKADPY
FT                   INVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKE
FT                   RRGEYLGKTIQVIPHIVGEIKDRIKKAGEGKDILIVEIGGTVGDIEGLPFLEAIRALRL
FT                   EVGKNNAMNIHLTLVPFIKAAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLK
FT                   DKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILNPIAEILDLKNLKPNMENWDSLV
FT                   KRVIAPSNEVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESA
FT                   EVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLK
FT                   DANSSEFDEKCENPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAK
FT                   VYNEAKSVKERHRHRYEANPKYRVDFEKHGLIVSGESKGLIEAVELNCHPFFLAVQFHP
FT                   EFTSRLEHVNPVICGFIKAAINYEDN"
FT   gene            36024..37595
FT                   /gene="recJ"
FT                   /locus_tag="JJD26997_0030"
FT   CDS_pept        36024..37595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="JJD26997_0030"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM TIGR00644"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44570"
FT                   /db_xref="GOA:A7H1B8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B8"
FT                   /protein_id="ABS44570.1"
FT                   /translation="MKIINKNEIKKILASRFEKDLHTKLCDLPLPCCLKDAYKAANRIK
FT                   EAVEKNEKVAIVGDYDVDGIISCVIMAEFFDDIGFDYIVRIPNRFKDGYGLNAEIINEL
FT                   DVNLIITVDNGIAALEAAKLCKEKNIDLIITDHHMPQDVLPDAFAIINPKQKDCDFPEI
FT                   EICGAQVAWYLIAALKEVCKLKYDMSKFLELLAIAIIADMMELRDLNRALVRRGIDHIN
FT                   KSKRAAFRAIKHYYQKDKFALDNIGFLIAPLINSAGRMDDASISYEFLHTKDFNKALEY
FT                   LEQIVSFNESRKDEEKQLFEDSLNQIDENDSCIVVSGLNWHEGVLGIVASRLAKHFNKP
FT                   AFVFSQNEEHLKGSARSVGKIDILALISKTNSILSNYGGHKGAAGISLNSENFEQFKNK
FT                   IKKECSQISESEFLDTDEILGILEPSEIDFEMLEILESFEPFGHKNPRPFFVLENLCVK
FT                   NKKLLGKDEKHLKLILTKENKTIEALFFNFDKEPELNQNISLLGSISKNEFRGLVTPQF
FT                   VIKEIL"
FT   gene            37681..38727
FT                   /gene="ansA"
FT                   /locus_tag="JJD26997_0031"
FT   CDS_pept        37681..38727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="JJD26997_0031"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="identified by match to protein family HMM PF00710;
FT                   match to protein family HMM TIGR00520"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43997"
FT                   /db_xref="GOA:A7H1B9"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1B9"
FT                   /protein_id="ABS43997.1"
FT                   /translation="MKKLLLCVLVFLSIGACMAEAKPKIAILATGGTIAGSIDSAVATT
FT                   GYTAGVVGVDVLIKAVPQIQDLANISGEQIANIDSSNMRDEIWLKLAKEINKLFAEGVD
FT                   GVVITHGTDTMEETVYFLNLTIKSDKPVVLVGAMRPSTAISADGPKNLYNAVALAADKE
FT                   SKGKGVMVAMNDKILSARGVVKTHSLNVDAFSSPDFGDLGYIIDGKVFFYNNIAKAHTK
FT                   NTPFDVSKLTSLPKVDILYSYSNDGSGVAAKALFEHGTKGVVVAGSGAGSIHEDQKNVL
FT                   KELMKKGLDVVVSSRVVAGHVAVSDSDKKLGFISAEDLNPQKARVLLMLALTKTSDPKK
FT                   IQEYFLKY"
FT   gene            39388..40900
FT                   /gene="rrsA"
FT                   /locus_tag="JJD26997_0032"
FT   rRNA            39388..40900
FT                   /gene="rrsA"
FT                   /locus_tag="JJD26997_0032"
FT                   /product="16S ribosomal RNA"
FT   gene            41005..41080
FT                   /locus_tag="JJD26997_0033"
FT   tRNA            41005..41080
FT                   /locus_tag="JJD26997_0033"
FT                   /product="tRNA-Ala"
FT   gene            41089..41165
FT                   /locus_tag="JJD26997_0034"
FT   tRNA            41089..41165
FT                   /locus_tag="JJD26997_0034"
FT                   /product="tRNA-Ile"
FT   gene            41479..42081
FT                   /gene="rhtC"
FT                   /locus_tag="JJD26997_0035"
FT   CDS_pept        41479..42081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtC"
FT                   /locus_tag="JJD26997_0035"
FT                   /product="threonine efflux protein"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43249"
FT                   /db_xref="GOA:A7H1C0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C0"
FT                   /protein_id="ABS43249.1"
FT                   /translation="MMTFLFIFGIHLSALLTPGPDFFLVSAYALKFSFKEALKAAFGVS
FT                   LAILLWIIFSLTGLKILFDTFPFIQLVLSTLGAMYLFYLAYLLLKNISNEIHFTNSIKI
FT                   SQPFLGGFLTNITNAKAIFYFGSIFSSLNFTGDNFEIFLLVIILGLESLIYFIFIAFLF
FT                   SNLKIKMLYLSHYKKIDLFCAFIFISFACFTLTTIYF"
FT   gene            42090..42452
FT                   /pseudo
FT                   /locus_tag="JJD26997_0036"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            42477..42704
FT                   /pseudo
FT                   /locus_tag="JJD26997_0037"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            42760..42873
FT                   /pseudo
FT                   /locus_tag="JJD26997_0038"
FT                   /note="putative prolyl 4-hydroxylase, alpha subunit; this
FT                   gene contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            43048..43188
FT                   /locus_tag="JJD26997_0039"
FT   CDS_pept        43048..43188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44483"
FT                   /db_xref="GOA:A7H1C1"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C1"
FT                   /protein_id="ABS44483.1"
FT                   /translation="MFFLIIIVKSHKQVLIKTILQDLLKDKTLFIFSLVLLISFSYLYF
FT                   L"
FT   gene            43484..46280
FT                   /gene="rrlG"
FT                   /locus_tag="JJD26997_0040"
FT   rRNA            43484..46280
FT                   /gene="rrlG"
FT                   /locus_tag="JJD26997_0040"
FT                   /product="23S ribosomal RNA"
FT   gene            46701..46820
FT                   /gene="rrfE"
FT                   /locus_tag="JJD26997_0041"
FT   rRNA            46701..46820
FT                   /gene="rrfE"
FT                   /locus_tag="JJD26997_0041"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(47433..49103)
FT                   /gene="ggt"
FT                   /locus_tag="JJD26997_0042"
FT   CDS_pept        complement(47433..49103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="JJD26997_0042"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43340"
FT                   /db_xref="GOA:A7H1C2"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C2"
FT                   /protein_id="ABS43340.1"
FT                   /translation="MRYLAIFAISITLSFGAANPPIQDRTGTGLVLSSHELANKIGKEV
FT                   LDKGGNAIDAAVAVGYALAVVHPAAGNIGGGGFAVIHLANGENTTLDFREMAPLKASRD
FT                   MYLDSKGEVIKDASTIGYLAAGVPGTVKGMSAMLDRYGTMKLKDLMAPAIKLAEKGYLI
FT                   NDRQEQTMLEAKDMFKEFPSSSKYFLKKDGSTYKSGDLFVQKDLAKTLKLIAKEGPDAF
FT                   YKGKIADLIATDMAKNKGIITKEDLAQYQAIWRKPVEGTYRGYDIISMSPPSSGGAHII
FT                   EILNIMENANIENLGFASSKTLHIMAEAMRQAYADRSEYMGDPDFVKIPLDKLTSKEYA
FT                   KEIYAKIPKDKALPSSKVKPGLGKIHEGHNTTHYSVLDSKGNAVSITYTINASYGSGAA
FT                   VEGAGFLLNNEMDDFSIKPGVPNLYGLVGGEANAIEPKKRPLSSMSPTIILKDGKVFMV
FT                   VGSPGGSRIITTVLQVISNVIDHKMDISTAVESPRFHMQWLPDEIRTEPFGIIKDVQNN
FT                   LEKMGYKITKEPYMGDVNAIMVDPKTGKIIGSMDTRKEF"
FT   gene            49333..53091
FT                   /locus_tag="JJD26997_0043"
FT   CDS_pept        49333..53091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0043"
FT                   /product="type II restriction-modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43971"
FT                   /db_xref="GOA:A7H1C3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C3"
FT                   /protein_id="ABS43971.1"
FT                   /translation="MKFEAINEKEFLNPYHRKKPILETELNEFIKTLKDYKINLENNLK
FT                   NNEDSLVANALSKFFENLSFQCEVKSIHKGNSGIDLALKKDGLTQVIIEAKLPNSREFF
FT                   SPSRPNCKALHECVLYYLRERKALNSSLKHIIITDFYSFFIFKADLFEELFNKNKYFKE
FT                   AFENFESKNSLFKGNTDEIYKEFEKILNGDSTLKGLFVDLKPILEQDKLSFSKLKPLFK
FT                   IFSKDCLLSEFNPNDANSLNNAFYKELLYILGLCESKQNSKLIIAKSEESKEEQGTFYT
FT                   AINSKLKEENFETILKLLILWLNRILFLKLIESNLVRFNDDKNLKFLNFKKIPDFDKLS
FT                   ELFFEVLAKEKSTRKKSEFAYLPYLNSSLFEKQSIENTLEISSLSNDLKLFYYKNTVLK
FT                   DDKCKAKKGQVGLLEYLFEFLDSFDFGSDDEQSEILSQKELISSSVLGNVFEKLNGYKE
FT                   GSFYTPSFITSYMCKESITKVVLDKFNAQFDLDAKNISELRNFLRKEDKKAQKELLNSI
FT                   KICDPAVGSGHFLVSALNVMLSIYDELNLFDEEFYLEVQNDEILITGRKGKFIEYKRPN
FT                   TPKDKAHLIQQELFHTKKDIIENNLFGVDINPNSCEITKLRLWIELLKHSFYQSFDDEN
FT                   YHDLKTLPNIDINIKCGNSLVSYFETGKSLSHYPNIKERMGKYKRIVKDYKEGFYTDKS
FT                   HINQEIKNLKISFKNFCFADKFKKEMKGFNDKCEKYSKKYGNFLAVDDENLKFFVSANL
FT                   TLFDFDEKEATKEFANLKKEYDNIFNLESNHPFEWRFEFPEILDDDGNFKGFDLIIGNP
FT                   PYIKEAENKELFANTKKLRTYQGKMDIWYHFVGRGFDMLKNNGYLAFIATNNWITNSGA
FT                   KKLRNIVLEESQILSLVDFSSFMVFDSASIQTMIMQFQKIKPPKNYEFHFAKITTQTPI
FT                   YEDALSLLKNEKTQNNEILKINLTPKKFIDKTLNFTKSDYEELFNKIQKYGKFYLEERE
FT                   VANGIHPHYDFINNRINSNHNFAFKTGQGIFGLSEEEKEKLKLTKLENNLVKPYYDTQN
FT                   FLKFFFKKNNHQWLIYTNSSFKNPNSMDNYPNLKKHLDKFQNVITSDNKPYGLHRARDE
FT                   KFFTGSPRIVALRKCVGEPKFSYVDFDCYVSATFYVIKTQRINVKYLTAILNSKLIAFW
FT                   LKHKGKMQGNNYQIDKEPLLNIPIVTINSKNQKIADEFINLVDEILKAKEQDKNANTQE
FT                   LENKINSLVYKLYNLNEEEIKIIENKE"
FT   gene            53094..53480
FT                   /pseudo
FT                   /locus_tag="JJD26997_0044"
FT                   /note="ATP/GTP-binding protein; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            53802..54632
FT                   /locus_tag="JJD26997_0046"
FT   CDS_pept        53802..54632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0046"
FT                   /product="GTP-binding protein LepA"
FT                   /note="identified by match to protein family HMM PF06421"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43501"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C4"
FT                   /protein_id="ABS43501.1"
FT                   /translation="MKENILNDIKGFANATLERLKSFDKDIVKDLTPDITSKELSSLFS
FT                   YEFKSDNGVSFNKRGSGVKRLFLLSFFLEDAERKHQSNMIYAIEEPETSQHPNYQRIII
FT                   ESLKKLAQNKGRQILLTTHTPEIARMVNKENIIFIQKDDKNKRIVYHGDEIDIEILVDA
FT                   LSIIVPNSKALSKGRELVKAMKEIVPRQLFEVAIQASIGNKIIARENVKSMGKNVTAKC
FT                   YGGDITRKRKLLEKQKEGKKRMKAIGKVHLPQEAFLSVLKIDMLKAKRNMPLKQ"
FT   gene            complement(54598..55965)
FT                   /locus_tag="JJD26997_0045"
FT   CDS_pept        complement(54598..55965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0045"
FT                   /product="CitT protein"
FT                   /note="identified by match to protein family HMM PF00939;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00785"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44398"
FT                   /db_xref="GOA:A7H1C5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C5"
FT                   /protein_id="ABS44398.1"
FT                   /translation="MSNSTKTFIIVADIILFIALLALLPFETKVNQGLAILAFIAVLWL
FT                   SEALHITITAILIPILAVIMGLMPTKSALHGFADPNIFLFFGGFALAAAMHFQELDKII
FT                   AQRILMLARGNFALAALYIFFTTAFLSMWMSNTATAAMMLPLAIGMLSQLDYEENKNTY
FT                   VFVLLGIAFSASIGGIGTLVGTPPNAIVATNLNITFAQWLQYGIPIVIIFMPLMILVLY
FT                   VTFKPNLKFQINTDLEQKIPMDTQKYITLIIFAIVAMCWIFSSYINPFVSNLLGFEKKI
FT                   ANFDSVIAILAAVLVCAFRVVSWKKVQENTDWGVLMLFGGGITLSLVLKDSGASKIMAD
FT                   GIISLIAGGHLFLIGLLVSLFIVFLTEFTSNTASAALLVPLFISIAESLGAPPLGLALI
FT                   IGIGASCAFMLPVATPPNAIVFGTGYIKQSQMVRVGIYLNVLCSIIIALMAYFFWL"
FT   gene            complement(56076..57065)
FT                   /gene="mraY"
FT                   /locus_tag="JJD26997_0047"
FT   CDS_pept        complement(56076..57065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="JJD26997_0047"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43745"
FT                   /db_xref="GOA:A7H1C6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C6"
FT                   /protein_id="ABS43745.1"
FT                   /translation="MNLHRLILSLFLMPKFINWAKKKNASQPIYEHAPQNHQIKSHTPT
FT                   MGGVIFVFCAIFASLLCIKFDNLFALMGLLCLISFCFIGVIDDLGKILKKNNHSGLSPK
FT                   AKMFGLIFASFLCLAPLYFSGILSADFYIPFYKYPLFNMYIFALFFWILVLISSSNAVN
FT                   LTDGLDGTVPSIFSLATLGVFLYLSGNLIYSEYLFLPKINGLGELVVICAALIGALMGF
FT                   LWFNCYPAQIFMGDSGSLALGGFIGFLAVVSKNEILLLLVGFVFVLETISVILQVGSFK
FT                   IWGKRVFKMAPIHHHFEKVGWVENKIIVRFWMIALLSNLLALASLKLR"
FT   gene            complement(57271..58032)
FT                   /locus_tag="JJD26997_0048"
FT   CDS_pept        complement(57271..58032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04402"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44125"
FT                   /db_xref="GOA:A7H1C7"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C7"
FT                   /protein_id="ABS44125.1"
FT                   /translation="MCLRIGCKYDIFSNQNKGEKMKTNNIFMALAIVLASLILAFGFNK
FT                   ALSDFKTLERSVSVKGLSQKEVEADTLILPIKFTRSNNNLANLYEELEQDKENIIKFLK
FT                   EQGVKEDEINYNSPNIIDRLSDPYGNDTQAAYRYIGTANLLIYTQNVKLGKSILEKISS
FT                   LAKFGIVTKIDDYDIEYLYTKLNEIKPQMIEEATLNARNAAIKFAQDSNSHLGKIKKAS
FT                   QGQFSISNRDKNTPYIKTIRVVSTIEYYLKD"
FT   gene            complement(58404..58688)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0049"
FT                   /note="drug resistance transporter, Bcr/CflA family; this
FT                   gene contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            58791..60140
FT                   /locus_tag="JJD26997_0050"
FT   CDS_pept        58791..60140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44400"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C8"
FT                   /protein_id="ABS44400.1"
FT                   /translation="MQNLNQNEQIKCPSCGSFIDISTALYAQILDKAKQEMLKQKKEFD
FT                   DEVNAKRAEYTKALNDLKTQKIEQEKLISEQVSQKLLLEKQKFEQELLTQKQNFQKEFS
FT                   EKFNKEHENEMKIMQEELEKKSKELSEFLSIKAENERLKREQKENEERLKFQAKEEAFK
FT                   EFKEQESKNLEFEREKMRLEFQKNTQEQDLKYKELETNFKSVAQKLEDAQRRIEQGSQQ
FT                   LQGEAAELLIEEYIQSEYLNDEVKEVPKGVNGADCLHIVKDNFGNICGSILYESKRTKE
FT                   FNKEWLDKLKLDSIAAKSDIAVLITKTMPKDKEKTHFKEGILICTFNEFKGVLAVLRES
FT                   IINAYKLKNALQNKDEKNHILYEYLNSKEFNTQITFILKTYQNMKEELEAEKRALQNIW
FT                   KKRERAIENLSFNSTAIVSSLNAIFSDLQGGNLIGEEGIKSLENLAKDED"
FT   gene            complement(60164..61207)
FT                   /locus_tag="JJD26997_0051"
FT   CDS_pept        complement(60164..61207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0051"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43214"
FT                   /db_xref="GOA:A7H1C9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1C9"
FT                   /protein_id="ABS43214.1"
FT                   /translation="MKKHILLLGLCLSLSLSAKSVSDYKAGEELSDKEGVEYFKELSKR
FT                   PVQEWPNKNLSINDVPKGKQGDLIRYGIELLSKTESTLGPYSKLKKTSNEVNCISCHMD
FT                   NDGNGLPGTKKYVIPFLNVLNNYPRLDIETMKIISVEDRIRGMGGTDSHRFPNDSKEMK
FT                   AILAYFKWLKEAYGIKDGVKLEGDFFAKMNFPNRPADPVRGKKLFEENCVACHGERGLG
FT                   VKNDNYEQGSGHLYPSLLIYPDGGHMAMIPFLARFLKSAMPFGASADNPILSDEDALDI
FT                   AAYVNTGFVRMPITTTENRAGLDTAYSKSPSLKPEYFASPQQNLDPKEYIKVKYGPWKN
FT                   PNHFPGE"
FT   gene            complement(61385..62032)
FT                   /locus_tag="JJD26997_0052"
FT   CDS_pept        complement(61385..62032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0052"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44598"
FT                   /db_xref="GOA:A7H1D0"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D0"
FT                   /protein_id="ABS44598.1"
FT                   /translation="MDLKSLENSRLYILKRLGILKFLSVIEALLVGFLVFVFIRDTLIA
FT                   VILAIFVGVFFFRFTAKKLKLAQKKLQIDALNLFLRRFGAKFKKQSLSQKDFLQLGFTK
FT                   DLKEFKSQNCFEFKDFKIYDIQFLDENKRFFCGILLEILSANQNPSFEDEEQIYIKLAD
FT                   KNFTLNHIFSKENHYLIATLSNPFFIDMKKDLKSNFKNLEENLNSIKNKLFK"
FT   gene            complement(62032..63840)
FT                   /gene="typA"
FT                   /locus_tag="JJD26997_0053"
FT   CDS_pept        complement(62032..63840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="JJD26997_0053"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43433"
FT                   /db_xref="GOA:A7H1D1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D1"
FT                   /protein_id="ABS43433.1"
FT                   /translation="MKNIKNIAVIAHVDHGKTTMVDELLKQSGTFSEREQISERVMDSN
FT                   DIEKERGITILSKNTAINYKGTKINIIDTPGHADFGGEVERVLKMIDGVLLLVDAQEGV
FT                   MPQTKFVVKKALSLGLKPIVVINKIDKPAADPERVINEIFDLFVALDANDEQLDFAIVY
FT                   AAAKNGYAKLDLNDESDNMEPLFKTILERVPAPSGTNDNPLQLQVFTLGYDNFVGKIGI
FT                   ARIFNGVVKKNQSVMLAKADGTKVNGRISKLIGFMGLEKMDIEEAGSGDIVAIAGFEAL
FT                   DVGDSIVDPNNPMPLDPLHIEEPTLSIVFSVNDGPLAGTEGKHVTSNKIAERLEAEMKT
FT                   NIAMKYESTGEGKFKVSGRGELQITILAENMRREGFEFCMGRPEVIVKIEDGIKTEPFE
FT                   HLVIDVPEEFSGAVIEKLGKRKAEMKTMTPTGDGQTRLEFEIPARGLIGFRSQFLTDTK
FT                   GEGVMNHSFLEFRPFSGAVEKRNNGALISMENGVALGYSLFNLQERGVLFIEPQTKVYT
FT                   GMIIGEHSRPNDLDVNPIKGKNLTNVRASGSDDAIKLVPPRKLSLERALEWIEEDELVE
FT                   VTPLNVRVRKRYLDPTQRKRMEKAKS"
FT   gene            63805..63990
FT                   /locus_tag="JJD26997_0054"
FT   CDS_pept        63805..63990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44084"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D2"
FT                   /protein_id="ABS44084.1"
FT                   /translation="MSYNCYIFNVFQIFFSKAKFLKAWIIQKFNLNYKVSKLGTLLALK
FT                   SYEIKILKRKLKCQNH"
FT   gene            63975..64274
FT                   /pseudo
FT                   /locus_tag="JJD26997_0055"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by glimmer; putative"
FT   gene            64317..66083
FT                   /locus_tag="JJD26997_0056"
FT   CDS_pept        64317..66083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43329"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D3"
FT                   /protein_id="ABS43329.1"
FT                   /translation="MSNLAPQNDVLNLTPSKTSTTSNSFSKTSKNKEYESSDSKNSTQD
FT                   DTESFLNSLLNSIDETNEFLPDHMKIGQKEVVNEVMNRLQKGAFDESDKISIFESASFM
FT                   QILSLLDKLKTDTADVKLANLSTQLSSLIKTEANFNALKGASNLSELLDIAKDLGLNVK
FT                   NIKVDRLLDLKATFPNLDKADFFKGAVNNVFKEIINSKISNVSKNLNHNLQNTTHTTST
FT                   HSTQKTNSKDSGSLLSQTLKNLDSILSSKESKHEKKDKVKSKIEEDAADAKNTLKNIKN
FT                   DEFAKNLTEELNIKDKKNQDNLNKENKDLNKDFNKELNKNQGDMQEQNKNLKNNNQNLI
FT                   FDKNSNKETVKDTPNLASNLTQKDFSLNKEVKNNNKENKDIKQNFFDQKLNFENLNKTQ
FT                   VVQNKENNANFNNNTNKETFTQEQTKTHSENVDKNSLDELNSLVKDLNKVTQNNARNIT
FT                   PKETLQHFSQDLKEAVDQYKAPITKLSITLNPNNLGEVEVTLIQRGNNLHINFNSNTNA
FT                   MNLFIQNQAEFKNSLVNMGFTGLEMNFSDQGKREQNQNQGKNRSGYGFKDALEGKNESE
FT                   KVNLELVLAKYF"
FT   gene            66142..67005
FT                   /gene="flgD"
FT                   /locus_tag="JJD26997_0057"
FT   CDS_pept        66142..67005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="JJD26997_0057"
FT                   /product="flagellar hook assembly protein"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44290"
FT                   /db_xref="GOA:A7H1D4"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D4"
FT                   /protein_id="ABS44290.1"
FT                   /translation="MATTNWNSNLNWTNTTNTNQTSDKATKADNSSSSSSSGVVSNPNA
FT                   TLDKDAFLKLLLVELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVETMQKL
FT                   SDSFSASMSTSALGAIGKMATVNENKVKLTGADEVIALKMYLPEDSDDKGITLEVYDKN
FT                   NKLIFSEKSNEGKEVSKGLFTLEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGT
FT                   YPIEGIKFVAGVAYAKMGGQYVSFDDIGEISDYKLGLSSTSVGDSSSGDSSNSGSTEDG
FT                   GKEEKA"
FT   gene            67009..68646
FT                   /gene="flgE-1"
FT                   /locus_tag="JJD26997_0058"
FT   CDS_pept        67009..68646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE-1"
FT                   /locus_tag="JJD26997_0058"
FT                   /product="flagellar hook protein"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43521"
FT                   /db_xref="GOA:A7H1D5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D5"
FT                   /protein_id="ABS43521.1"
FT                   /translation="MMNSFYNGISGVKSNSFGIDITANNIANVNTTGFKYSDAQFKDIF
FT                   YNTITTQSTNPAQGGYGSGAASSQVVFEQGSPIASDGEFDVALQGKGFFGVLEADGNAY
FT                   YTRNGSFKRDANGYLVDSYGNFVLGTMNPVFTGMNYSDRVAGLMGDYLNTGTPVNNGFT
FT                   VNSNNPFSIGTTVSQGAIKVPVNMYLPPQVTQNVKWSGSLNTNTITEVVKVDLDPSKFN
FT                   VTKTEDGKYVVSGSVGKEDVFSAKAGDRIILNFTDDNGVKTSFEATLDENLNFKSNELD
FT                   LKGLDENSIKLDTAQISTEQQKANKDILESPIYNADGSKSTLRVTLERVLPQESDNIQY
FT                   KAIAQIYDSNRNAVGNPTEGNMVFDKNGALLQNNITSIANPNGGTINIDLGSPYDANKP
FT                   GSGYSGIYIKEGVEKNVVTQQDGVAEGFFEQYNISDDGSIVAQFSNGKNAIVGKLALYN
FT                   FINEQGLAAMGDNIFAATANSGDASFIMKDGQVVNTAKFKGGFLEQSNVDLSTELSNLI
FT                   VTQKAFDASSKSITTSDQMIQKAINMKR"
FT   gene            complement(68650..70518)
FT                   /locus_tag="JJD26997_0059"
FT   CDS_pept        complement(68650..70518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0059"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43685"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D6"
FT                   /protein_id="ABS43685.1"
FT                   /translation="MNFQVKTLETFNPFESLNQEQANTEQILDFKIIDFKLLCSSVKPA
FT                   KTKTYERKDFDLFYADDFFVKNYNTIIQKFLIEIYPKTQSFPFTIKLRSNSNLTYLKAN
FT                   INLTENFKYYPNLKFDILQNIYKIMIKQKFLILRLDKNLFDKIDGFILSIQKNPSIKEL
FT                   ELEIAKGVDKIEHKSNEIIYHRDVNEGGSNENISYDEGGYCKPVEKNELLFEYIYRILG
FT                   KEGRNLRGEILHLNPIAFDNPFVIKDESIYTEELEDRIKYFSANYGFLNKDRSGYSVTN
FT                   NLKLSQVGLKTTGSIKTNIDENINLEITNFDISDDAIKSGIVNVQASNIKVNGSIGATK
FT                   LYGKNISIKGLTHAKSEIFAQDIFITTHKGTLQADTVYIKNLENGTIIAKNVFVENCVG
FT                   GKIEAENIYICNLLTDNTLYPRKNLIITNNIKFKNNILVSPLVSIENNSDTECENLKNL
FT                   SLKIKSKLDDTISQMQNYYDYLIKNQVKIIKLQKAEKLNTIGMKFSNLYHDIIKKYNHL
FT                   SILYKKLIKLKYQIDTKLNFLNKMVYNVKIYIKAENIGEDNFLKFYPKTNTDIELKHHI
FT                   NLKDYEKVLYLEKGQQANYIESSHNYSESDIEEIKIIFEKLEKDNS"
FT   gene            complement(70519..71241)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0060"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01814; match to
FT                   protein family HMM TIGR02481"
FT   gene            71768..72124
FT                   /pseudo
FT                   /locus_tag="JJD26997_0061"
FT                   /note="2-oxoglutarate/malate translocator; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(72256..73272)
FT                   /gene="trmU"
FT                   /locus_tag="JJD26997_0062"
FT   CDS_pept        complement(72256..73272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="JJD26997_0062"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM PF03054; match to protein
FT                   family HMM PF06508; match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44021"
FT                   /db_xref="GOA:A7H1D7"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1D7"
FT                   /protein_id="ABS44021.1"
FT                   /translation="MKILVAMSGGVDSTVTAYKLKNLGHEVIGCYMKLHGKPNYHEENI
FT                   KKVEKVANFLQIPYHILDLQEDFKNKVYMPFVDTYKEGKTPNPCALCNRFIKLGKLLEF
FT                   AKNLGCEKLATGHYARLENNLIKTAVDESKDQSYFLASADKEALKYLIFPLGEMKKEDV
FT                   KKFASTIEVLKSFATQKESSEICFVEDTYVQVLDQFMDTKIPGEVLDSSGKVVGKHEGY
FT                   MHYTIGKRRGFEVRGTHEPHFVLKINPKQNQIIVGTKEELKISEFNLKNINLFIDAKEL
FT                   DCEVKIRYRSKSTPCKVEIYEDKSAKITLKDPVYGLASGQMAVFYNHDKVIASGFIE"
FT   gene            complement(73269..73877)
FT                   /locus_tag="JJD26997_0063"
FT   CDS_pept        complement(73269..73877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0063"
FT                   /product="lysine decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF03641"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44176"
FT                   /db_xref="GOA:A7H1D8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D8"
FT                   /protein_id="ABS44176.1"
FT                   /translation="MNEKISQDLEKFANIPKLKNAVTFFGSARLKEDNFYFAQAKKLAN
FT                   LCVKNGFCVISGGGGGIMCAANAGAFECKNNANSIKSVGFNILLPHEQKLNDFVEYNIT
FT                   FESLAIRKMALIEKSLAFVIFPGGFGTLDELCEILTLKQLEFKKDVPIILFGSEFWRGF
FT                   DEFVRNSLLKLEVISKGDELKYKITDDLDFIINTLKEIK"
FT   gene            complement(73996..74733)
FT                   /locus_tag="JJD26997_0064"
FT   CDS_pept        complement(73996..74733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44685"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1D9"
FT                   /protein_id="ABS44685.1"
FT                   /translation="MISLNSHYPNINYPNNALSIKKDENNEYTYTKKDEPKSEEDAYWE
FT                   DFVQKYFGEMLSKEYANKYGYNGSPDVKEVENSLYKRYMEDKLSKDEIKILNEFGTDYL
FT                   VEGVDLTALIRRKVDLLKTLTSMNEFEKIWGAERAQREKQFFNELGKPLTQEDIDRFLA
FT                   NKNNQKEDKKTFKPIQAESKNKETYKDDSTRNELVKKLLEGKFSTSKELELLFGMNFSN
FT                   DDAGEFNKFLSQNTSAKIIDIKA"
FT   gene            complement(75063..75206)
FT                   /locus_tag="JJD26997_0065"
FT   CDS_pept        complement(75063..75206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44562"
FT                   /db_xref="GOA:A7H1E0"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E0"
FT                   /protein_id="ABS44562.1"
FT                   /translation="MLENLIAQIIEGIVGCKARKMGFFCIIAVMALAFVLWLVFSHLYG
FT                   YF"
FT   gene            complement(75558..75737)
FT                   /locus_tag="JJD26997_0066"
FT   CDS_pept        complement(75558..75737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43729"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E1"
FT                   /protein_id="ABS43729.1"
FT                   /translation="MKKIFALLALTSLLTSSAFAGDFLAKVSNGALSDNSQGVKALNLD
FT                   EMKEVRGGGYFSRW"
FT   gene            76032..76886
FT                   /locus_tag="JJD26997_0067"
FT   CDS_pept        76032..76886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0067"
FT                   /product="hmcD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43480"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E2"
FT                   /protein_id="ABS43480.1"
FT                   /translation="MKKIFLVFMVLVNCVFASDELNIDSLFKKQIGLRSITSVSLLSTG
FT                   NANSYSLYPNITIGGDPTIWNDTKQVFLTQTFIYTLTPKFDILISGGGSYARAEYTNFF
FT                   TNEYSSKNRIGFDNLWLGFIYTGDSIADLIPQITFQTAVVQREKAINQTKNFYLKSQSL
FT                   QASLRGYSDPVVYSIYTGFGYNQSRKFKTLKIEYGNSIYVGGDLSIILSPKITLDLGAE
FT                   QRFQMKQKINGYQNSEVRSIPTLSLGSTYSINSDTAVSVNASFGGSSASPDSIFGISLW
FT                   KKF"
FT   gene            76871..77470
FT                   /locus_tag="JJD26997_0068"
FT   CDS_pept        76871..77470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0068"
FT                   /product="peptidase family protein"
FT                   /note="identified by match to protein family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44260"
FT                   /db_xref="GOA:A7H1E3"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E3"
FT                   /protein_id="ABS44260.1"
FT                   /translation="MEKILKILLFLPILALSAKAEWVVKSYQEIKNERVIRQTYEQSCG
FT                   ASSLATLLNILDDQKKFDELELLKIMSGQELYTDMVSFADLNDAVKKLGYESNSYQINR
FT                   ENLDKLVNIPMLVKIEDDPRFPHFVIIINHKGNYLQVLDPSHGEYISSKSQFFSIWDRY
FT                   NKGGYALIIAPKKELKPFKLNTPKSLHFDFSPFSLF"
FT   gene            complement(77519..78340)
FT                   /gene="fliY"
FT                   /locus_tag="JJD26997_0069"
FT   CDS_pept        complement(77519..78340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="JJD26997_0069"
FT                   /product="flagellar motor switch protein"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44107"
FT                   /db_xref="GOA:A7H1E4"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E4"
FT                   /protein_id="ABS44107.1"
FT                   /translation="MFTNECINTIEGLTGKSAEFSEYKEFDVNASDTLKAPLVYAIFDI
FT                   ANGGKIGILAGTVLMSAIGEWMMGEEEITKNDKLGPDEMDAAKEAIQNIISAFSTTLGA
FT                   QKDIPKMDFSIESCEFVPESVDFKDFKKLFLYDVKIGDLEEQISLAMDQTLHNILSGKP
FT                   AETGNASADSNHNAEEKAIMLSEELKNINLIMDVRLPVRVRIGNKKMLLKDVLTMDIGS
FT                   VVELNQLANDPLEILIGDKRIAYGEVVIVDGNFGVQITEIGSKKERLEQLR"
FT   gene            complement(78358..79437)
FT                   /gene="fliM"
FT                   /locus_tag="JJD26997_0070"
FT   CDS_pept        complement(78358..79437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="JJD26997_0070"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM PF02154; match to protein
FT                   family HMM TIGR01397"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43387"
FT                   /db_xref="GOA:A7H1E5"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E5"
FT                   /protein_id="ABS43387.1"
FT                   /translation="MAEILSQEEIDALLEVVDDNTDTPIASNSKDEKDERNIVVYDFKR
FT                   PNRVSKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTS
FT                   FNVFSIKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYEASRELTDIELNLLDSILRIIM
FT                   QRLKESWATVTEIYPSIEAKESSPNVVQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVV
FT                   HLESILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQ
FT                   GDILRLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEKYEE
FT                   ERKAKASIYDESEEEDEEI"
FT   gene            complement(79437..80153)
FT                   /gene="fliA"
FT                   /locus_tag="JJD26997_0071"
FT   CDS_pept        complement(79437..80153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="JJD26997_0071"
FT                   /product="RNA polymerase sigma factor, sigma-F"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02479;
FT                   match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44756"
FT                   /db_xref="GOA:A7H1E6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E6"
FT                   /protein_id="ABS44756.1"
FT                   /translation="MNPKKDEEMLKEPPKAYAQMLKKEQDELVLSYMPALRAMAFRLKE
FT                   RLPSSIDVNDLISIGVEEMIKLSRRYDKEQNDNFWGFARKRVNGSMLDYLRSLDVMSRN
FT                   NRKIIKDIDAIMDEYFLEHECEPDDEYLAKKLDLDVEKIKEVRTAHAISYTLPIDEQIE
FT                   LYNEDNTLEKIEKEELLEKIHEVLYDLKERDQLIIQLYYYEELSLKEISEILQISESRI
FT                   SQIHKKLLKKLREKLV"
FT   gene            complement(80110..80466)
FT                   /locus_tag="JJD26997_0072"
FT   CDS_pept        complement(80110..80466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0072"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43131"
FT                   /db_xref="GOA:A7H1E7"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E7"
FT                   /protein_id="ABS43131.1"
FT                   /translation="MRPEIYVAFFTVCGFFIGLAFSIISIDEAFDILIFTCFITFMFYI
FT                   FVHIAIMNFIDVKKISGRIFNKHDYEKTSNNIINDLVIREKKMDIILEKLNEEREELKK
FT                   NEPKERRRNAKRAA"
FT   gene            complement(80485..81351)
FT                   /locus_tag="JJD26997_0073"
FT   CDS_pept        complement(80485..81351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0073"
FT                   /product="ATPase, ParA family"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43776"
FT                   /db_xref="GOA:A7H1E8"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E8"
FT                   /protein_id="ABS43776.1"
FT                   /translation="MNNQANKLRNLMSQNGTKKSQNTHFMAIISGKGGVGKSIISANLA
FT                   NVLANNGYKIGLFDADIGLANLDVILNVRIQKNLLHILRGECSLEDILIEVKPNLWLIP
FT                   GESGDEILKYNDKNIYERFLNQASILDKLDFLIIDTGAGIGGNILNFLEMADEVIVVTV
FT                   PDPAAITDAYATIKTTSKTKENLLMLFNIVKNENEALKIFENIKKIADANINNPLNLEF
FT                   LGHLSASKDVSSSIKKRTLFTDENTASSDELKALASKLLYRLERKVLDNVSNRSFSSFF
FT                   RKIIERF"
FT   gene            complement(81351..82796)
FT                   /gene="flhF"
FT                   /locus_tag="JJD26997_0074"
FT   CDS_pept        complement(81351..82796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="JJD26997_0074"
FT                   /product="flagellar biosynthetic protein FlhF"
FT                   /note="identified by match to protein family HMM PF00448"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44582"
FT                   /db_xref="GOA:A7H1E9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1E9"
FT                   /protein_id="ABS44582.1"
FT                   /translation="MGHLIHTFTVEDTEQIIPKVKEDYGDKALIITNKQIRPKTLNHSA
FT                   LYEVMVAIEESNYQEHLKKQEKSLPAKKSSPKSSSTSLAEEKIRSQIPQDEDVVLDFSN
FT                   TRLNTNLNTVKNDDITKRTYQDFPQNKINPHQNKTLGFDDFKEKLSEVSNEISKITNTP
FT                   LENYTPNPNYNKKIENFEKQFEKQINKLNDKIDLLADMMWDDKAEARKNLMIPPEFASI
FT                   YKQAKESGMLESHLEAIMKATIENIPAAMKTNKDAVQRYFHSFLRNILPCRVESDIKKQ
FT                   KIMMLVGPTGVGKTTTLAKLAFRYAYGDKRYKTGIITLDTYRIGAVEQLFQYAKMMKLP
FT                   IIDSIEPKDLDEAIKSLNNCEVILVDTIGNSQYDQSKLAKTKEFLIHSNAEIDVNLVVS
FT                   ANIKHEDLMENYKNFSFLNIDTLIITKFDETKVFGNIFSLIYETNIPLSFFSTGQEVPD
FT                   DLEVANSDFLVHCILEGFNKGKK"
FT   gene            complement(82807..83280)
FT                   /gene="folK"
FT                   /locus_tag="JJD26997_0075"
FT   CDS_pept        complement(82807..83280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="JJD26997_0075"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43988"
FT                   /db_xref="GOA:A7H1F0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F0"
FT                   /protein_id="ABS43988.1"
FT                   /translation="MLKIQGAKYFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRF
FT                   DMLFRAMMDDKRFKILSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYE
FT                   VKFKRKRTFKYAPRTLDLDLLYFSQKVKRDKWCEVPHKEAKERVSVILPLGMI"
FT   gene            complement(83283..83762)
FT                   /gene="aroQ"
FT                   /locus_tag="JJD26997_0076"
FT   CDS_pept        complement(83283..83762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="JJD26997_0076"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by match to protein family HMM PF01220;
FT                   match to protein family HMM TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44762"
FT                   /db_xref="GOA:A7H1F1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1F1"
FT                   /protein_id="ABS44762.1"
FT                   /translation="MKIMIIQGPNVNMLGVREVGIYGAMKMEEIHEQMKLAASQNNVEL
FT                   DFFQSNFEGEIVDKIQECLGTVDGIIINAAGYTHTSVAIRDAIAAVALPTIEVHISNVY
FT                   RREEFRQKNLIAPVCSGTIVGFGPFGYHLALMGIIQICEQIKNLRAMQQAQQTNK"
FT   gene            83855..85084
FT                   /locus_tag="JJD26997_0077"
FT   CDS_pept        83855..85084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0077"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44269"
FT                   /db_xref="GOA:A7H1F2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F2"
FT                   /protein_id="ABS44269.1"
FT                   /translation="MFIVAARYLFLCDEDFTILENQALVFEDEILELGKLDNLRKKYPK
FT                   AKIIKTPKNSVILPAFINPHTHLEFSANSTTLHFGEFLIWLKSVINSRSMLNAQAKEEL
FT                   ILQNINKMQKSGIGTIGEISSFGSDLDPCLKASQKGMRVVFFNEILGTNENQVEGKKQE
FT                   FLKRFENSLKFKNDFFIPAISIHSSYSTHPSLAHFALNLAKKQNLLVSTHFLESKVENI
FT                   WLRESKGGFKKWLENFTLHPKPLYTPKDFAKLFKGVRTLFTHCVYLKEYEWLDKNLHSI
FT                   THCAFSNRLLSQKSLDLKKALKSCLNIHLGTDGLSSNISLSLLDEMRANLLIHKNFDLL
FT                   ELASKLLQMATLYPARALNLNLGELKKGKIADFSVFELGECDKKQAPLQFILNAKEVDK
FT                   LFIKGKECKI"
FT   gene            85072..85968
FT                   /gene="sppA"
FT                   /locus_tag="JJD26997_0078"
FT   CDS_pept        85072..85968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="JJD26997_0078"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01343;
FT                   match to protein family HMM TIGR00706"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43516"
FT                   /db_xref="GOA:A7H1F3"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F3"
FT                   /protein_id="ABS43516.1"
FT                   /translation="MQNLKSFFKALGCGIKFINTYFKTFVLLLIVIWILVPSANSSSKL
FT                   ANLERIDLKGEIFDSSAVLEKIINAKNDSNIKGVLFVIDSPGGAFAPSMELALAIKDLK
FT                   IKKSVLVYASGTMASGSYLAGVGANKILANPASFIGSIGVIMQGADLSGLANKLGIKEQ
FT                   TIQAGEFKSAGTFARAWNENERNFLQGLIDQSYDLFTGFVAKERVLDLNKKDQWANARV
FT                   FLAAKAKELGLIDELSNYENAKKELEKLANVSNPIWKEEDKIDKFLNRLKGQASSLISK
FT                   SLIEIAYKTNSGFINAR"
FT   gene            86191..86800
FT                   /pseudo
FT                   /locus_tag="JJD26997_0079"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts"
FT   gene            complement(86846..87004)
FT                   /locus_tag="JJD26997_0081"
FT   CDS_pept        complement(86846..87004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43296"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F4"
FT                   /protein_id="ABS43296.1"
FT                   /translation="MDKFDYSYPILTKDTKCSFCENFFPIEYSSNLKTIEKECPFCNNK
FT                   MDIKLKD"
FT   gene            complement(87166..87595)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0083"
FT                   /note="non-heme iron protein, hemerythrin family,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            complement(87775..88431)
FT                   /locus_tag="JJD26997_0084"
FT   CDS_pept        complement(87775..88431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0084"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43245"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F5"
FT                   /protein_id="ABS43245.1"
FT                   /translation="MSKIDEISSKSKANILEHLKKAYKETTFTRIESIDPVEHIQTTQD
FT                   MLAEMKQKMSDNKYIVENATKDTLEEKINEIVLKYGFKSMIYGADLNLNLEQIKAENKI
FT                   CFDKEIENLRSEVFHSDFSIIHARAGVSSHGVALIPSSKTQPRMLSLAPKLCIVLLKKE
FT                   NVVKSLSEALNLVKKENEILPTNILFIAGPSRTADIELITVFGVHGPQIAHIIIY"
FT   gene            complement(88424..89863)
FT                   /locus_tag="JJD26997_0085"
FT   CDS_pept        complement(88424..89863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0085"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02589; match to protein
FT                   family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44179"
FT                   /db_xref="GOA:A7H1F6"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F6"
FT                   /protein_id="ABS44179.1"
FT                   /translation="MSQKIPHEQIVQTKLNDKQMQENLMTAMHTLQKNRLNVIDARFKD
FT                   WQGLRAKAKQAKNNALMSLEERLLEFEKNATKNGIKVHWASSDEDACEIVYEIMKEKNI
FT                   TKLLKGKSMASEEIGLNHYLEKKGLKAIETDLGELILQLNEEPPLHIVVPAIHRNRHEI
FT                   GQIFKEKLGANLENDEPESLNAVAREHLRKDFEGLKLGLSGVNFAMSREGAFWLIENEG
FT                   NGRMCTTAPDIHIALCGIEKVMESFEDAATMVSLLTPSATGQFIPTYNNIITGPRKNGD
FT                   LDGPKEVHVILFDHNRSKMLSHEDYYEALRCIRCGACMNFCPVYDQIGGHAYQTTYPGP
FT                   IGEVISPNIFGIDHTGDILNFCSLCGRCSEVCPVQIPLADLIRKLRCDKIGQGKNPPLG
FT                   ANNVHHNALEAFAFKQFKNIATNGDKWRFSLSKAHYFNWAVQNFASILPVIKKWHAFKE
FT                   LPQIKMDLYKEVQKLEGVSYE"
FT   gene            complement(89860..90597)
FT                   /locus_tag="JJD26997_0086"
FT   CDS_pept        complement(89860..90597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0086"
FT                   /product="cysteine-rich domain protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43862"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F7"
FT                   /protein_id="ABS43862.1"
FT                   /translation="MKKVYFYATCLGSAAMQQSVLNAIKLLRREGIEVIFKKNQTCCAQ
FT                   PSFNSGYFDESREIALYNVDLFDKDYPIVVPSGSCAGMMSHDYKELFKNRPESSKIKDF
FT                   SSRVIELSQYLDEVLKVDYEDKGAPIKVTWHSNCHALRVQKSIQASKNLIKKLQNVELV
FT                   ELQYEEECCGFGGTFSVKEPEISNAMVRSKIKDIQNSGAKYLISGDGGCLLNIDGTMKR
FT                   MGLDIKGMHLYDFLLKRLEGERL"
FT   gene            complement(90721..92403)
FT                   /gene="lctP"
FT                   /locus_tag="JJD26997_0087"
FT   CDS_pept        complement(90721..92403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="JJD26997_0087"
FT                   /product="L-lactate permease"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44849"
FT                   /db_xref="GOA:A7H1F8"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F8"
FT                   /protein_id="ABS44849.1"
FT                   /translation="MEQILTWQQIYDPFSNIWLSALVAFLPILCFLVCLVVLKLKGYQA
FT                   GFLTVVFATFIALSAYKMPWNLVGASFIQGFTNGMWPIAWIIIAAIFLYKLSIKSGSFE
FT                   IIKKSVMSITPDHRIQVILIGFCFGSFLEGAIGFGGPVAITAALLVGLGLRPLQAAGLC
FT                   LIANTAPVAFGAVGIPIIAMANLVGIEQHSVSAMVGRMLVPLSLTIPFFIVFLMDGFKG
FT                   VKETFPAILVAALSFTTTQFLSSNHLGAELPDIISAVVSLAVTTIFLKFWKPKNIFRFD
FT                   NESNFTQDNTLSFNQVLKAWSPFILLIVCIIIWTQPWFKGLFDKDGILSYTSITLQFSN
FT                   ITTGILSPSITSIGEAKPLSLTLGVDLINGKTVAQGGTAILLAAFLTIAILKIKAQDAA
FT                   ECFWATLKEMAIPCITIGLVVAFAFISKNSGMSTTLGLAFAHTGDAFSFFSPIIGWIGV
FT                   FLTGSDTSANLLFGTLQQVSAQKLGISEALFLAANSVGGVVGKMISPQSIAIACAAVGL
FT                   VGKESDLFKFTLKYSVAFIVLIGIWTCIIAFFLQGIIPEVIVK"
FT   gene            complement(92767..93009)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0088"
FT                   /note="cytolethal distending toxin subunit A; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            93169..93438
FT                   /locus_tag="JJD26997_0089"
FT   CDS_pept        93169..93438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43346"
FT                   /db_xref="GOA:A7H1F9"
FT                   /db_xref="InterPro:IPR027853"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1F9"
FT                   /protein_id="ABS43346.1"
FT                   /translation="MFYFVVFKGRIIMHLKHLYFSISQIFNFYKEGFKNLTLGKTLWKI
FT                   IFIKLFVMFVILKLFVFDVNFNSIFKSDKEKSTFVLKNLTLEGK"
FT   gene            93439..95001
FT                   /gene="cydA"
FT                   /locus_tag="JJD26997_0090"
FT   CDS_pept        93439..95001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="JJD26997_0090"
FT                   /product="cytochrome d ubiquinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43873"
FT                   /db_xref="GOA:A7H1G0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1G0"
FT                   /protein_id="ABS43873.1"
FT                   /translation="MNELSSVDWSRAQFALTALYHFLFVPLTLGLSFMIAIMETIYVKT
FT                   KNERWKKITKFWLSLFAINFAIGVATGIIMEFEFGTNWANYSWFVGDIFGAPLAVEGIM
FT                   AFFLEATFFAVMFFGWDKVSKSFHLLSTWCVAIGSNLSAFWILVANGWMQYPVGMSFNP
FT                   DTARNEMQSFFEVALSPMAISKFLHTIGSGYVISALFVMGISAWFMLKGRYIIEAKKSL
FT                   VVGASFGLVCSIFLFFSGDESAYRVTQTQPMKLAAMEGVYQGEHRAGLVPFGILNPKKT
FT                   IENNKSVFLFDITIPYALSILGNRDPNSFVPGIEDLIYGNESKGIEPMQNRIDRGKIAI
FT                   QALKDYKLAKESNDTVAMANHKSILETHFKDFGYGYLEKPSDTIPPVALTFYSFHIMVA
FT                   LGSFFFLLFIVTLYLAMANDIEKFRKVLWVCLLSIPLGYIAAEAGWIVAEVGRQPWAIQ
FT                   DLLPVHIAATQLGKVNVQISFWIFAVLFTALLIAEVKIILTQIKKGFDAHAGHTLLMGK
FT                   GEK"
FT   gene            95001..96125
FT                   /gene="cydB"
FT                   /locus_tag="JJD26997_0091"
FT   CDS_pept        95001..96125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="JJD26997_0091"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43159"
FT                   /db_xref="GOA:A7H1G1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1G1"
FT                   /protein_id="ABS43159.1"
FT                   /translation="MFFGLELEGLQIYWWLILSLLGGLLVFMFFVQGGQTLIDELSKDE
FT                   LEKTMLVNSLGRKWELGFTTLVLFGGAAFAAFPLFYSTSFGGAYWAWLCILFCFILQAV
FT                   AYEYRKKENNVYGSKTYEIFLKINGYLGVFLIGVAVSSFFSGSEFILNEHNFVSWQNPL
FT                   HGLELLLNPFNYLLGLALVFLARLLGAAYFMNNINDENIKIRAMKKLMVNSILFLPFFL
FT                   GFLVWIFLKDGFSVDANGVVSMSANLYLYNFLNQMIFAILLVVGVILVLLGMVQGAKGC
FT                   SKAIFTLGLGTVLTVFVLLSSIGLGQSVFYPSLSDLQSSLTLKNASSSYYTLSVMAYVS
FT                   LLVPFVLAYIIYVWNAMDKVKITREEIANDDHAY"
FT   gene            complement(96319..97014)
FT                   /locus_tag="JJD26997_0092"
FT   CDS_pept        complement(96319..97014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0092"
FT                   /product="putative aspartate racemase"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00035"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44085"
FT                   /db_xref="GOA:A7H1G2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1G2"
FT                   /protein_id="ABS44085.1"
FT                   /translation="MKTIGIIGGMSFESTITYYKTINQAINDKLKSLNSANILLYSVNF
FT                   EEIENLQSQDKWQEAAQILSQCAKKLELAGASFIIIATNTMHKVFDEIQQNINIPILHI
FT                   AKSSAKALKQENIQKIGLLGTKYTMAQDFYKKMLIEENISVIIPSDEDIQIVNDIIFNE
FT                   LCKGEIKQDSKEKYLNIIKKLQEKGAKGVLLACTEIGLLISKNDTNIKIFDTSLIHALD
FT                   AANEALKDL"
FT   gene            complement(97130..97825)
FT                   /gene="ung"
FT                   /locus_tag="JJD26997_0093"
FT   CDS_pept        complement(97130..97825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="JJD26997_0093"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00628"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43724"
FT                   /db_xref="GOA:A7H1G3"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1G3"
FT                   /protein_id="ABS43724.1"
FT                   /translation="MKEITINIDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNI
FT                   IIYPPANLIFNAFNLCPLKEIKIVILGQDPYHQENQAMGLSFSVPKNVKIPPSLNNIFK
FT                   ELQNDLNITPAKSGDLSFWAKQGVLLLNSILSVEANKAASHSSWGWQEFSDAVIHKLSN
FT                   EKSGLVFMLWGNYAKSKEILIDNTKHLILKAAHPSPLARTGFLGCKHFSKANEFLKKVG
FT                   KIPIDWKIV"
FT   gene            98099..99505
FT                   /gene="aspA"
FT                   /locus_tag="JJD26997_0094"
FT   CDS_pept        98099..99505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="JJD26997_0094"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44190"
FT                   /db_xref="GOA:A7H1G4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1G4"
FT                   /protein_id="ABS44190.1"
FT                   /translation="MGTRKEHDFIGELEISDEVYYGVQTFRAVENFDISHDRLKDFPRF
FT                   VRALARVKKAAAMANHELGLLDKNIQDAIIKACDKILEGGYYDQFVVDMIQGGAGTSTN
FT                   MNANEVIANIGLELMGHKKGEYQYLHPNDHVNLSQSTNDAYPTALHLALHDYLSDLAKA
FT                   MEHLKKAYERKAEEFKNVLKMGRTQLQDAVPMTLGREFKTFAVMIGEDIQRVLEARKLI
FT                   LEINLGGTAIGTGINSHPDYPKVVERKIREVTGFEYTVAEDLIEATQDTGAYVQISGVL
FT                   KRVATKLSKVCNDLRLLSSGPKCGLNEINLPKMQPGSSIMPGKVNPVIPEVVNQVCYFV
FT                   IGADVTVTFACEGGQLQLNVFEPVAAYSLFNSIVMLEKAMYTLADKCIDGITANEKICS
FT                   DFVYNSVGIVTALNPYIGYENSASIAKEAMNTGKRVADIALERGLLSKEQIDEILTPSN
FT                   MLNPHMKAKK"
FT   gene            99531..100859
FT                   /gene="dcuA"
FT                   /locus_tag="JJD26997_0095"
FT   CDS_pept        99531..100859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="JJD26997_0095"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter
FT                   DcuA"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF03605; match to protein
FT                   family HMM TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43893"
FT                   /db_xref="GOA:A7H1G5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1G5"
FT                   /protein_id="ABS43893.1"
FT                   /translation="MIILQVIVLLGAIFIGIRLGGIAIGYAGGLGVVVLGLVLGMKPGN
FT                   IPWDVILIIAAAIAAISAMQQAGGLDYMVRVTEKILRSSPKFINYLAPACGWLLTILAG
FT                   TGNAVFSLMPVVVDVAKSQNIKPSVPLSLMVVSSQIGITASPVSAAVVYMSGVLEPLGW
FT                   NYPTLIGIWIGTTFIACMLTAFIVSLITPMDLSKDNVYQKRLKAGLVKDAGAILHGEDK
FT                   PGAKLSVGIFLITVLAVVLYATAISSNIKWIDPVVVPRDAAIMSFLLTAATLITWLCKV
FT                   EPGKILDTSVFKSGMTACVCVFGVAWLGNTFVAGHEAAIKEVAGDWVKQTPAMLAVAFF
FT                   FASMLLYSQAATAKAIVPVIITALGISAANPHDSYMLVACFAAVSALFVLPTYPTLLGA
FT                   VQMDDTGTTRIGKFIFNHSFFIPGVLAIAIAVALGFVLAPMLI"
FT   gene            101520..104627
FT                   /locus_tag="JJD26997_0096"
FT   CDS_pept        101520..104627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0096"
FT                   /product="autotransporter beta-domain protein"
FT                   /note="identified by match to protein family HMM PF03797;
FT                   match to protein family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44705"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1G6"
FT                   /protein_id="ABS44705.1"
FT                   /translation="MTITKNGTLGNGSDNSITLKAQNGDTRTLVNLTNQGTIKGKIGIE
FT                   NNNGSFTGTITVRTFENKKTIDGDIYMGIWGGNGGTISIENFNNEGFISGKSRNEKGVH
FT                   FEGKNNAKVYINTFRNSGSIEGGENSSHERHGVYVQGNVDVTLFENTGFISGKNGQGVY
FT                   FQGNVTINTFENEGTITSEKGQGVRFEGNVHIKTFENKSGGTIEGKNGQKSIILVGTNG
FT                   STPTLENFNNEGFIKGEIGIGGTQGFRGTVTVKTFENKNGGTIDGGIYIPASTGTISIE
FT                   NFNNTGTIKGGNYQGVYFQGDKVHIKTFENKGFISGSAYDMIYKNFNVSGGVSMAGGTI
FT                   DTFINKGTIQSTGTNHNPAGVKLNYATVKTFENTGFISGTIGVLATQGTIETFKNSGTI
FT                   EATGKDGHEAAIQIRSAFKNSSSITHFTNEGIIKSKSHGVLIESGDKIETLTNKGTIET
FT                   ELNGIGFYNYTGSEETHLGKIILESDSSIKAGKNGIDIDNQTTARSIRVGGIEVQKGAS
FT                   VSGDEAGIYLGKDKEITAPITISGTVSGGNAGIVNEGRMARGITHNGEAELVISNQGLV
FT                   GKDDKGNTVTNNKGSVTIKDWVVTTNEEGKLDTVVVGGNKTDSVKVSNITVDQSGLELE
FT                   ELNEIKNLISGVSTNNIANVKTNGGGEISLSYDPISARLSTDVQLNASIAGANFRSSVA
FT                   TASKRATFIDNVMANAMQSFSLDSSGKSQKIALSEKGNLYADASDYIKNDYIKNDYIKS
FT                   DLTQANYGLNKEHALFILPYLSSQSVELSLNEESKGHTKGTIIGYSTLKDSGIYGVYAG
FT                   YEDTKMDSTYFDVNNISYYTGLKYFNTLFTTAKGQEVYIKAQAQAALIKNDFTKKIGKT
FT                   EAKAKAHSYTYGINTAWGMNFIADKNIFSPEAGFAYEGSYTEAFSMQDTRGQATVRGGE
FT                   RTYANHLNLFSTKTSFTWFRDWLPNLKTSVELGAKFNVNPKVKARARFGNMKVNDEFHL
FT                   PRVRKFASTSLIVPVNEAFYFSLNYNGMFDEKGNTHTGFAQFNYLW"
FT   gene            104880..105815
FT                   /locus_tag="JJD26997_0097"
FT   CDS_pept        104880..105815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0097"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43760"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1G7"
FT                   /protein_id="ABS43760.1"
FT                   /translation="MLLLEFINTNLSLKDERTTGDTYEEIIKQSINVNDSSTQEQTQNI
FT                   TNIIDKVNSKIKASASEGTGLTREDAINNAIIEAIGKMSGVNINSLKKSNTGVSTDSSG
FT                   SNIQDNYSEQISKATKGRADTYEINSVEQDANGRYVANVAIFKTTTTKKYQAPGLSADN
FT                   RRSITVFDSTPDPAKRGIGSALQQKIIYRISGDILNAIYPLKVASVENNEVVFSQSLNQ
FT                   GDVYECFALGKAIKDAYTKENTGRVESKTANIEITRTSPKLSYAKITEGSVKVGDIYRP
FT                   LSDTGSGNGYTIGCGANYQIQEGGGVNLGF"
FT   gene            105974..106282
FT                   /gene="rplU"
FT                   /locus_tag="JJD26997_0098"
FT   CDS_pept        105974..106282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="JJD26997_0098"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44558"
FT                   /db_xref="GOA:A7H1G8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1G8"
FT                   /protein_id="ABS44558.1"
FT                   /translation="MYAIIKHSGKQYKVSVGDDLKLDHFEAESKASIEVSEVLAINDKE
FT                   LKVGAPFVAGAKVVLEVINHGKDKKVVIYKKRRRKDSKLKRGFRRQFTRVVVKDIKA"
FT   gene            106293..106547
FT                   /gene="rpmA"
FT                   /locus_tag="JJD26997_0099"
FT   CDS_pept        106293..106547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="JJD26997_0099"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43750"
FT                   /db_xref="GOA:A7H1G9"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1G9"
FT                   /protein_id="ABS43750.1"
FT                   /translation="MAHKKGQGSTQNNRDSIGRRLGVKKFGGEFVRAGNIIIRQRGTAT
FT                   HAGNNVGMGKDHTIFALIDGFVKFERKDKDRKKVSVYPA"
FT   gene            106654..107691
FT                   /locus_tag="JJD26997_0100"
FT   CDS_pept        106654..107691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0100"
FT                   /product="GTP-binding protein, GTP1/Obg family"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM TIGR02729"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44735"
FT                   /db_xref="GOA:A7H1H0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1H0"
FT                   /protein_id="ABS44735.1"
FT                   /translation="MFIDSVKITLASGDGGKGAVSFRREKHVPLGGPDGGDGGNGGDII
FT                   FICDNNTHTLVNFKGKRELRAQNGAGGMGRNKNGKKGENLELVVPEGTQVIDAQTNEIL
FT                   LDLTKEGQRELFLKGGKGGLGNTHFKHATNQRPDYAQPGIKGESRLVRLELKLIADVGL
FT                   VGFPNVGKSTLISVVSNAKPEIANYEFTTLTPKLGLVDVDEYNSFVMTDIPGIIQGASG
FT                   GKGLGLAFLKHIERTSFLLFVLDPMREMLLKEQFIVLRKELEKFSDELFGRKFGIMISK
FT                   SDSVNLGEEFAEQIALNINELENYLKEINNPQSFLIKVSSLEKTGLKELKFMLLEEIKA
FT                   LRNNK"
FT   gene            107825..108530
FT                   /pseudo
FT                   /locus_tag="JJD26997_0102"
FT                   /note="glutamate 5-kinase, degenerate; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            complement(108516..108644)
FT                   /locus_tag="JJD26997_0103"
FT   CDS_pept        complement(108516..108644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43331"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1H1"
FT                   /protein_id="ABS43331.1"
FT                   /translation="MCEIKSFNYNLFDFKREFNKLYHSNKVPPIYLFLSKKVSTTC"
FT   gene            108654..109571
FT                   /gene="fmt"
FT                   /locus_tag="JJD26997_0105"
FT   CDS_pept        108654..109571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="JJD26997_0105"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43143"
FT                   /db_xref="GOA:A7H1H2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1H2"
FT                   /protein_id="ABS43143.1"
FT                   /translation="MKKIIFMGTPSYATCILKALVENENFKLVALFTQPDKAVGRKQIL
FT                   TPSDTKAFLSQNYPSIPIFTPSSLKDENIMRQIKDLNPDFIVVAAYGKILPKAILDLAP
FT                   CVNLHASLLPKYRGASPIQSAILNKDEKSGVCTMLMEEGLDTGAILESLECDIKDKNSS
FT                   EVFELLANLAAKLILSTLLNFDKITPKKQEESLATLCRKIKKEDGLINLQNARELYQKY
FT                   LAFTPWPGVFLENGLKFLELELVDELKQNAKMGEILELEKESFLLACKQGVLRIKKLQE
FT                   SGKKALDGRTYLNGKRLKSEDSLC"
FT   gene            109534..110187
FT                   /locus_tag="JJD26997_0106"
FT   CDS_pept        109534..110187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0106"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44123"
FT                   /db_xref="GOA:A7H1H3"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1H3"
FT                   /protein_id="ABS44123.1"
FT                   /translation="MEKGLKVKIVCVESIDSTHLFLCEQIRNGKIDGNFAIYALEQTNG
FT                   VGSRENSWQSSKGNLHLSFCIKEEDLPKDLPLASVSIYFAYLLKEVLQEKGSKIWLKWP
FT                   NDLYLDDKKAGGVISAKISNFIIGGMGLNLKFAPQNTAFCDIEISLKDLVSEFLQKVEK
FT                   KILWKNIFSKYMLEFEKSRKFSVHHEGKVFSLENSFLYEDGSILLGDKRVYSLR"
FT   gene            110184..110969
FT                   /locus_tag="JJD26997_0107"
FT   CDS_pept        110184..110969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0107"
FT                   /product="chromosome partitioning protein, ParA family"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44588"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1H4"
FT                   /protein_id="ABS44588.1"
FT                   /translation="MSEIITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANA
FT                   TTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELPQLHLAPSNIGLVGIEQELAKGENN
FT                   EKKMLLKNQIQEVIDEYDFIIIDSPPALGSITINAFAASDSVIIPIQCEFYALEGVAMV
FT                   LNTIKIIKKTINSKLRVRGFLPTMYSSQNNLSKDVVDDLKQNFKKQLFTINGNEDDFIV
FT                   IPRNVKLAESPSFGKPIILYDIKSPGSVAYQNLAYSILG"
FT   gene            110975..111811
FT                   /locus_tag="JJD26997_0108"
FT   CDS_pept        110975..111811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0108"
FT                   /product="chromosome partitioning protein, ParB family"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44316"
FT                   /db_xref="GOA:A7H1H5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1H5"
FT                   /protein_id="ABS44316.1"
FT                   /translation="MGLNKDRGLSSLISDMDTVYSKELGFDKNQSTMIEIDQISPNPFQ
FT                   PRKNFDQEALDELANSIKEFGLIQPIIVFKKNNKFILIAGERRLRAVKALGKKEILAFI
FT                   ADIDENKLRELALIENIQRENLNPIELANSYKDLMQVHKITQENLAELIHKSRTQITNT
FT                   LRLLNLDIRTQELIASGKISQGHAKVLVGLDQKDEKMLVDSIIGQKLNVRDTEKIVKKI
FT                   KNNESLPNQEFEDEIKKLKQILNRFGFDCKNRNNDFVIHLENIDKIKKLIKMLEKF"
FT   gene            111875..112300
FT                   /locus_tag="JJD26997_0109"
FT   CDS_pept        111875..112300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0109"
FT                   /product="ATP synthase F0, B' subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43742"
FT                   /db_xref="GOA:A7H1H6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1H6"
FT                   /protein_id="ABS43742.1"
FT                   /translation="MFEDMHPSIMLATMAIFLAMIVILNSMLYKPLLKFMDERNDSIKN
FT                   DENKVKENSQEVLGVNDELEAIHINTREEIQKIKQSAVAAAKEEAEQILRSKKEELERK
FT                   MASFYADLAVQKKELQEHLNIHLPELKQALQNNIKKI"
FT   gene            112311..112823
FT                   /locus_tag="JJD26997_0110"
FT   CDS_pept        112311..112823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0110"
FT                   /product="ATP synthase F0, B' subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44500"
FT                   /db_xref="GOA:A7H1H7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1H7"
FT                   /protein_id="ABS44500.1"
FT                   /translation="MSKLFFIIFLLPLYAFGASNGSGEYDIIPRTINFLIFVAILYYFV
FT                   ATPFKNFYKNRIVKISSKLDEIQKKLLESKAKKLDTMKKLEEAKANAAAALATAKKEAE
FT                   ILVQNIKKETQDELDLRQKHFEEQKDYEFRKMEKELVSNTLNEIFSDPNMTLKQSEIIE
FT                   LMMKKVS"
FT   gene            112826..113347
FT                   /gene="atpH"
FT                   /locus_tag="JJD26997_0111"
FT   CDS_pept        112826..113347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="JJD26997_0111"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43795"
FT                   /db_xref="GOA:A7H1H8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1H8"
FT                   /protein_id="ABS43795.1"
FT                   /translation="MENIIARRYAKAIASRADINDFYQNLCILNSAFVLPKFKNIIESN
FT                   EIKKERKMEFLDSFFHIKNSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGI
FT                   VHSKEKLSQENLKDLEVKLNKKFNANIKLNNKISQDDSVKIELEELGYELSFSMKALQN
FT                   KLNEYVLKII"
FT   gene            113361..114866
FT                   /gene="atpA"
FT                   /locus_tag="JJD26997_0112"
FT   CDS_pept        113361..114866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="JJD26997_0112"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44333"
FT                   /db_xref="GOA:A7H1H9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1H9"
FT                   /protein_id="ABS44333.1"
FT                   /translation="MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLK
FT                   NIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALI
FT                   GRVVNALGEPIDAKGVVNANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTI
FT                   VVNAGASDPAALQYLAPYAGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPP
FT                   GREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFA
FT                   SDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFED
FT                   GIYPFIEAKHPDIFEQIRSKKALDSDLEEKLAKAINEFKANHL"
FT   gene            114875..115759
FT                   /gene="atpG"
FT                   /locus_tag="JJD26997_0113"
FT   CDS_pept        114875..115759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="JJD26997_0113"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44383"
FT                   /db_xref="GOA:A7H1I0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1I0"
FT                   /protein_id="ABS44383.1"
FT                   /translation="MSNLKEIKRKIKSVHNTQKTTNAMKLVSTAKLKKTEEAAKRSKIY
FT                   AQKIDEILSEISFQINKIVHNEDDMRLSLFHKKEQIKTVDLIFITADKGLCGGFNIKTL
FT                   KTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHA
FT                   AVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGIELL
FT                   EDLMKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITT
FT                   ELIEIISGVESMK"
FT   gene            115784..117238
FT                   /gene="atpD"
FT                   /locus_tag="JJD26997_0114"
FT   CDS_pept        115784..117238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="JJD26997_0114"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43225"
FT                   /db_xref="GOA:A7H1I1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1I1"
FT                   /protein_id="ABS43225.1"
FT                   /translation="MQGFISQVLGPVVDVDFNDYLPQINEAIVVNFESEGKKHKLVLEV
FT                   AAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEI
FT                   PFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIM
FT                   ELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRI
FT                   ALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGK
FT                   FQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDP
FT                   LDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARK
FT                   IEKFLSQPFFVAEVFTGSPGKYINLEDTIAGFKGILEGKYDHLPENAFYMVGNIDEAIA
FT                   KAETLREISRGDTCLDNCKVEQKKAN"
FT   gene            117238..117627
FT                   /gene="atpC"
FT                   /locus_tag="JJD26997_0115"
FT   CDS_pept        117238..117627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="JJD26997_0115"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02823;
FT                   match to protein family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43595"
FT                   /db_xref="GOA:A7H1I2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1I2"
FT                   /protein_id="ABS43595.1"
FT                   /translation="MQDLISLEIVTPLGMIYQGEVKSVTLPGSEGEFGVLRGHASLVAS
FT                   LKSGVIDIEKADLNHELIAIDAGHAKVDEDKICVLAKGAVWVCGSDESEIEKNLAQAKD
FT                   LIKSMSSDNAALAVTFSKLDNARMH"
FT   gene            117627..118181
FT                   /locus_tag="JJD26997_0116"
FT   CDS_pept        117627..118181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0116"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44748"
FT                   /db_xref="GOA:A7H1I3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR017269"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1I3"
FT                   /protein_id="ABS44748.1"
FT                   /translation="MNFEAIFHFFNSSSIITYIVLLWLSLYFILAFSILFARLTYLATW
FT                   RNKEKESLETLLLGEKDLSRTDSILRKCNDTTSNHLEIYKNLASRRASAGLTWLSIIAS
FT                   TSPFIGLFGTVISILETFGGLGTQNSLSIIAPKISEALVATGCGILVAIPAYTFHLIIK
FT                   RKAFELLSIIDSEIKVISSSK"
FT   gene            118190..118579
FT                   /locus_tag="JJD26997_0117"
FT   CDS_pept        118190..118579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0117"
FT                   /product="putative TonB system transport protein ExbD"
FT                   /note="identified by match to protein family HMM PF02472;
FT                   match to protein family HMM TIGR02801"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43407"
FT                   /db_xref="GOA:A7H1I4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1I4"
FT                   /protein_id="ABS43407.1"
FT                   /translation="MPFDDEKPELNITPLVDIMLVLLAILMITAPSITYEEKINLPQGS
FT                   QKNTSAPTVKSLIISINAKKEIFLNQEKYDFISFADNLAQRKAQFNTEDPVFIRADKSL
FT                   KYDDVISVLRSVKNLGFNKVALQTE"
FT   gene            118582..119361
FT                   /locus_tag="JJD26997_0118"
FT   CDS_pept        118582..119361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0118"
FT                   /product="TonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44504"
FT                   /db_xref="GOA:A7H1I5"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1I5"
FT                   /protein_id="ABS44504.1"
FT                   /translation="MKNYGLSNLNSFLLALVIYISIVILVFFRLVSEVEPAIQYTDIKD
FT                   SFVDIELAEPSKQVITQSNTPKEIQKPTEQIDIERLFAQTTNKTVKTEDIDQKASNFND
FT                   LFGNIKEIQEEKTTKIQSSAKSGISSAPKPQASELVKQLNDSLLQGESSTQGESTKAQK
FT                   IGIYDEFLGKVARIITQRWTQYYPNSEKISVKVKIFIDENGKFGYTSVEKSGNPLYDTK
FT                   VAEFLESQKGKFITYPPQNKNISITMNLRDEAKVKND"
FT   gene            119371..120579
FT                   /locus_tag="JJD26997_0119"
FT   CDS_pept        119371..120579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0119"
FT                   /product="putative tolB protein"
FT                   /note="identified by match to protein family HMM PF04052;
FT                   match to protein family HMM PF07676; match to protein
FT                   family HMM TIGR02800"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43392"
FT                   /db_xref="GOA:A7H1I6"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1I6"
FT                   /protein_id="ABS43392.1"
FT                   /translation="MKKILAIFLVFLGSLWAEDPVIDVVNSGVVLPKIIVKDNSNLSDE
FT                   NLKKSFYNIIVNDLKVSSNFEVVANATETSNYTFEYALNKNGNTLSLNVKIKAGGSDKS
FT                   EQTYTLNGLEQYPFLAHKSVKASVNALGLAPVDWMDHKILIARNSSSKKSQIIMADYTL
FT                   TYQKVIVDGGLNLFPKWGNKEQTLFYYTAYDHDRPTLYRYDLNTNKASKILSSGGMVVA
FT                   SDVSVDGSKLLVTMAPKDQPDVYLYDLNTKNLTQLTNYSGIDVNGNFIGSDDSKVVFVS
FT                   DRLGYPNIFMQDLNSNSAEQVVFHGRNNSAVSTYKDFLVYSSREPNQAGVFNIYLMSIN
FT                   SDYIRQLTANGKNLFPRFSSDGGSIVFIKYLGAQSALGVIRVNANKTFYFPLRVGKIQS
FT                   IDW"
FT   gene            120656..121153
FT                   /locus_tag="JJD26997_0120"
FT   CDS_pept        120656..121153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0120"
FT                   /product="peptidoglycan-associated lipoprotein Omp18"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM TIGR02802"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44341"
FT                   /db_xref="GOA:A7H1I7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1I7"
FT                   /protein_id="ABS44341.1"
FT                   /translation="MKKILFTSIATLAVVISGCSTKSTSVSGDSSVDSNRGLGGSDGWD
FT                   IDSKISQLNDTLNKVYFDFDKFNIRPDMQNVVSTNANIFNTEVSGVSITVEGNCDEWGT
FT                   DEYNQALGLKRAKAVKEALIAKGVNADRIAVKSYGETNPVCTEKTKACDAQNRRAEFKL
FT                   SR"
FT   gene            121157..122104
FT                   /locus_tag="JJD26997_0121"
FT   CDS_pept        121157..122104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43169"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1I8"
FT                   /protein_id="ABS43169.1"
FT                   /translation="MKKIFTVALLGATLLYAESSAFGAGDITSNSSYGLTSNEKLFKEK
FT                   LDSLNNENIQTNARINEINERIEGLQSTLEGINSQYAKSNSRLSQVEENNQNIENNFTS
FT                   EIQKLKAYVEESRKIQEANNKQIKKVLAELSSLVDAINANYVSKNELNDANLSIKTITP
FT                   SVVVSTADSNSTIENNNTQNTQDDKAKQIDESWKKKKNNEILELAIKDVDKNAFEDSKA
FT                   KLNFLITKQYKPARANFWLGEIEYEQKNYNNAIVYYKKSSSLSTKGDYFPKLLYHTAIS
FT                   LDKTGDTKTANGFYKALKINYPNSPEAKASPNRK"
FT   gene            122119..122673
FT                   /gene="slyD"
FT                   /locus_tag="JJD26997_0122"
FT   CDS_pept        122119..122673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="JJD26997_0122"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   SlyD"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44103"
FT                   /db_xref="GOA:A7H1I9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1I9"
FT                   /protein_id="ABS44103.1"
FT                   /translation="MTIEKNSVVSMFYELKDANTNEVLESNLYSQPISFILGKGQILES
FT                   LEEEVMKLDCPSNADVVIKKEKGLGEYDENAVQTLPKEQFAGIDLKVGMELFGEGENGE
FT                   TVRVTVKEIGENDVTIDYNHPYAGRDLLFSLNIIDARAASEDEILTGIIAGSHSCGCGS
FT                   GHGHGGGGCCGGGGGGGCGCH"
FT   gene            122673..123593
FT                   /gene="fabD"
FT                   /locus_tag="JJD26997_0123"
FT   CDS_pept        122673..123593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="JJD26997_0123"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44551"
FT                   /db_xref="GOA:A7H1J0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J0"
FT                   /protein_id="ABS44551.1"
FT                   /translation="MNVTFIFPGQGSQSLGMGKDFYENSIKAKEFLQNASDFCKIDFKH
FT                   LLFEENEKLNQSEFTQPAIVLNSLMAYNVLLEKKPDLSSKFALGHSLGEFSALAVNGAF
FT                   DFLQALSLVNKRGLFMQEDCAKVEAAMMVVLGLDDEKVEELCQKAQKENKQIFAANYNC
FT                   NGQIVVAGLKPDLASYESVFKEAGAKRAMLLNMSVASHCPLLENASAKLCVELEKVLKP
FT                   NFKAVISNVNAKIYTSKEEALELLKAQLISPVLYKQSIKACENEVEYFIEFGASVLKGL
FT                   NKKITSKETYALTNMNDIDEFLKVI"
FT   gene            123593..124279
FT                   /gene="mtnA"
FT                   /locus_tag="JJD26997_0124"
FT   CDS_pept        123593..124279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="JJD26997_0124"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44532"
FT                   /db_xref="GOA:A7H1J1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J1"
FT                   /protein_id="ABS44532.1"
FT                   /translation="MKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFVKYKNHELVL
FT                   AYSKIGKVNSTLSASVMIEKFGAQALLFTGVAGAFNPEFEIGDLLYATKLAQYDLDITA
FT                   FGHPLGFVPGNEIFIKTDEKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIRE
FT                   IFNADACEMEGASVALVCDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFVL
FT                   KMCEKL"
FT   gene            124276..125037
FT                   /locus_tag="JJD26997_0125"
FT   CDS_pept        124276..125037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0125"
FT                   /product="PP-loop family protein"
FT                   /note="identified by match to protein family HMM PF01171"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43221"
FT                   /db_xref="GOA:A7H1J2"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J2"
FT                   /protein_id="ABS43221.1"
FT                   /translation="MINLSKKLIRQVAQANAKFGLIKDGDRVLLGLSGGKDSLALAHLL
FT                   NRMQAHVPFKFELEAVTLSYGMGEDYSGLHAHCEEHDIKHSVLDSNIYEMSGDTIRENS
FT                   SFCSYFSRMRRGTLYTYALEKGFNKLAIAHHLDDAAESFFMNFIHNGALRTLAPIYQSK
FT                   RGVTVIRPLIFVRERQLRNNATQNELSVIGNEFCPGMKLSEKNVKFPHAREEAKQLLAN
FT                   LEKDHPKLFTSLKTAFANLHTESFWLERTKV"
FT   gene            125034..125555
FT                   /locus_tag="JJD26997_0126"
FT   CDS_pept        125034..125555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0126"
FT                   /product="putative pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43784"
FT                   /db_xref="GOA:A7H1J3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J3"
FT                   /protein_id="ABS43784.1"
FT                   /translation="MKKAFVLVDYQNDFIDGSLGFDKALKIKENILKALNQIDFNNTHL
FT                   LLTYDTHDEHYLQSKEGLNLPVKHCIKESLGWQMPKEFEPFLQKAHKIFYKNTFGSLEL
FT                   ANFIQKSDYKELHFAGLVSHICVFCNIILAFGAKPNARIILHQNLSASFDKNLEKSAFD
FT                   LLRAYGIEIV"
FT   gene            125555..126169
FT                   /locus_tag="JJD26997_0127"
FT   CDS_pept        125555..126169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43431"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J4"
FT                   /protein_id="ABS43431.1"
FT                   /translation="MQGFILHTQKVKDEDLIVYILSPKMLIKVYRFYGLRHSSILSGYK
FT                   IDFALEENPSFLPRLKDVLHLGFLWIMQRDKMLIWQEFIRLLYRHLKDVEELDSFYFDL
FT                   LQECVKRFEKQNPKRVIVDAYLKILEFEGRLHKDFFCFACDEKIQNSITLLRAFLPSHS
FT                   QCALGFEFEEKKLKQFYSSKNCAIFDDEEIENLYHLIKEGL"
FT   gene            126166..126573
FT                   /locus_tag="JJD26997_0128"
FT   CDS_pept        126166..126573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0128"
FT                   /product="conserved hypothetical protein TIGR00043"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44422"
FT                   /db_xref="GOA:A7H1J5"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J5"
FT                   /protein_id="ABS44422.1"
FT                   /translation="MILSDEKCDFLESIASFLGPKDVELVFVDSKEMQEINLEQRKQDK
FT                   TTDVLSFPLENIDESLPLGSVVINVDLAKEKAKELGHSYEEEISLLFIHAMLHLLGFDH
FT                   ENDNGEMREKEKELIEHFNLPKSLIVRTLEG"
FT   gene            complement(126701..126814)
FT                   /locus_tag="JJD26997_0129"
FT   CDS_pept        complement(126701..126814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0129"
FT                   /product="peptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44050"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J6"
FT                   /protein_id="ABS44050.1"
FT                   /translation="MDRYNKGGYSLIKKELRPFKLNTPKSLHFDFSPFSLF"
FT   gene            127677..130250
FT                   /locus_tag="JJD26997_0130"
FT   CDS_pept        127677..130250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0130"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF03797;
FT                   match to protein family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43557"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J7"
FT                   /protein_id="ABS43557.1"
FT                   /translation="MGIWGGNGGTISIENFNNEGFISGKSRNEKGVHFEAQGNAKVYIN
FT                   TFRNSGSIEGGENSSHERHGVYVQGNVDVTLFENTGFISGKNGQGVYFQGNVDVTLFEN
FT                   TGFISGSGDSSLAGGLHTGGGVVMTGGTIETFKNSGTIQSTGTNHYPGGVKLNYATVKT
FT                   FENTGLISGISGGFITIKGTIENFINKGTIEATGQGGGEAAIRIHTAELNFSSITNFTN
FT                   TGTIKSSSNGVLIESGNKIGTIINKGTIETKLNGIDFIDDGGHSSPNNAELGKIILESG
FT                   SSIKAEKKGINIDNKSDKTIKVDGIEVKKGASVSGGEAGIVNEKIIGGDDKKGGIIISG
FT                   EVSGRIAGILNKGSITAPITISGTVSGGNAGIVNEGKMARGIVHNGEGELVISNQGLVG
FT                   EDDKGNTVTNNKGSVTIKDWVVTTNEEGKLDTVVVGGKKTDDVKVTNITVDQSGLELEE
FT                   LNEIKNIISGVSTNNIANVTTNGGGEISLSYDPISARLSTDVQLNASIAGANFRSSVAT
FT                   ASKRATFIDNVMANAMQSFSLDSSGKSQKIALSEKGNLYADASDYIKNDYIKNDYIKSD
FT                   LTQANYGLNKEHALFILPYLSSQSVELSLNEESKGHTKGTIIGYSTLKDSGIYGVYAGY
FT                   EDTKMDSTYFDVNNISYYTGLKYFNTLFTTAKGQEVYIKAQAQAALIKNDFTKKIGKNE
FT                   AKAKAHSYTYGIHTAWGMNFIADKNIFSPEAGFAYEGSYTEAFSMQDTRGQATVRGGER
FT                   TYANHLNLFSTKTSFTWFRDWLPNLKTSVELGAKFNVNPKVKARARFGDKKVSNEFHLP
FT                   RVRKFASTSLIVPVNEAFYFSLNYNGMFDEKGNTHTGFAQFNYLW"
FT   gene            complement(130436..130591)
FT                   /locus_tag="JJD26997_0131"
FT   CDS_pept        complement(130436..130591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0131"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44691"
FT                   /db_xref="GOA:A7H1J8"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J8"
FT                   /protein_id="ABS44691.1"
FT                   /translation="MLAQPFLKRHFWKKRLFDFKFTSTCKDFKRLISPLVSIHFSLSLL
FT                   LLIVLK"
FT   gene            complement(130619..131086)
FT                   /locus_tag="JJD26997_0132"
FT   CDS_pept        complement(130619..131086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0132"
FT                   /product="repeat motif-containing gene"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43317"
FT                   /db_xref="GOA:A7H1J9"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1J9"
FT                   /protein_id="ABS43317.1"
FT                   /translation="MQGNTVRNYYVSEGVKALFSIYFKDQTEENFIKALNEFNKENQIN
FT                   SQEIKDEALREIKEELSKLATTDLLNARIDTVDAKIDRTEASLNAKIDKVEASLNARID
FT                   KVEASLNARIDKVENKLDSFKTEVKTYVIILAVLMFILQPTIFDLIKSIFK"
FT   gene            complement(131136..131393)
FT                   /locus_tag="JJD26997_0133"
FT   CDS_pept        complement(131136..131393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43976"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K0"
FT                   /protein_id="ABS43976.1"
FT                   /translation="MALSYELCCKLFDKNFENLNYTKEELFFIRECYSECGKVMDMLGE
FT                   DTIEKLLKEKETIILPNVTKYAKDSINEYFENKKMKCLKN"
FT   gene            complement(131405..131584)
FT                   /locus_tag="JJD26997_0134"
FT   CDS_pept        complement(131405..131584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44646"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K1"
FT                   /protein_id="ABS44646.1"
FT                   /translation="MSNSTQYSGARFIPITHEYLIIWKKTAKSLFAVTWDIADGKDLND
FT                   LLLADKMNSIKLKA"
FT   gene            131628..131750
FT                   /pseudo
FT                   /locus_tag="JJD26997_0135"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(131775..132701)
FT                   /gene="dusB"
FT                   /locus_tag="JJD26997_0136"
FT   CDS_pept        complement(131775..132701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="JJD26997_0136"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44469"
FT                   /db_xref="GOA:A7H1K2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K2"
FT                   /protein_id="ABS44469.1"
FT                   /translation="MIDFSKKPLFLAPMAGFSDLPFRNVVKKFGADITISEMISSNALV
FT                   YESSKTLHMLERAELENPYIVQIAGGDKEVLKKAVQMLNKMDFVDGIDFNCGCPVNKVV
FT                   KQCAGSALLENLELFKNLVGVIKENNKKSLTSVKFRLGFNEKYPEKMAKICESLGVDFV
FT                   SVHGRTRKQLYSGKADYESIASAKASVKIPVIANGDINAQNAKEVYKITKCDGLMIGRA
FT                   SVGNPWIFYEIKSGKSVDEKLKKEIILTHFDEMIKHYKDQGVSIFRKHLHEYSKGHKDA
FT                   SAFRDGVNRIDNAEKMRKKIEEFFSLT"
FT   gene            complement(132698..133684)
FT                   /locus_tag="JJD26997_0137"
FT   CDS_pept        complement(132698..133684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43497"
FT                   /db_xref="GOA:A7H1K3"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K3"
FT                   /protein_id="ABS43497.1"
FT                   /translation="MKIKLFLLASFIYIALIFAFAWHLELGSYTLNISTYTFELPIMIW
FT                   LVIPLFIYMILAVLHIAFYGFLRYLKFKHFFKDAAKFETYTQDLLLEKDLKTTFQTKEF
FT                   RAVAQLFKTIKTHEKIPHSNKINEILDLIDGLNKNEFFNLSKFKLENNNALYLQNEKNH
FT                   LKNDANYAYSKLKNLNEIKDELEEIAFNTLIEKASYEQIKNVKIPKKPSQVLTLIKRFK
FT                   EGNLELSAAEYEVLLSHNILSEKDYLNAAKLSTKLLNPDAILGIFNKMKNEKSEALRAY
FT                   LYLLAEFGLLNELRGQIHNDDKKFNDFKAFLALREKNIKIDLNQLIQ"
FT   gene            complement(133674..134036)
FT                   /locus_tag="JJD26997_0138"
FT   CDS_pept        complement(133674..134036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0138"
FT                   /product="putative dnaK suppressor protein"
FT                   /note="identified by match to protein family HMM PF01258"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44232"
FT                   /db_xref="GOA:A7H1K4"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K4"
FT                   /protein_id="ABS44232.1"
FT                   /translation="MKKNEIQNFKNILEERKKAILENLQSNSNEIEALHNSVPSDSVDF
FT                   SVIETGSQIDFAISTNLKEELIEIEDSLDKIKNGTYGICESCDDEIDSQRLKVKPHARY
FT                   CITCRQIAEQGKKYEN"
FT   gene            complement(134048..134497)
FT                   /locus_tag="JJD26997_0139"
FT   CDS_pept        complement(134048..134497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44612"
FT                   /db_xref="GOA:A7H1K5"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1K5"
FT                   /protein_id="ABS44612.1"
FT                   /translation="MQVNIFYIQKSDEFKTWSEKYSKLISKYGTLKEINVFNKKIALAQ
FT                   NLNAIEAKKSYEEAFMPYKKGYCIALDERGKDLTSIEFAKLIQDKNELSFFIGGAYGLR
FT                   EEFNQSLDFRLSLSKLTLAHQFVKTLLLEQIYRAFCINNNHPYHK"
FT   gene            complement(134499..135341)
FT                   /gene="accD"
FT                   /locus_tag="JJD26997_0140"
FT   CDS_pept        complement(134499..135341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="JJD26997_0140"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43414"
FT                   /db_xref="GOA:A7H1K6"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K6"
FT                   /protein_id="ABS43414.1"
FT                   /translation="MNFADIFSKIRRQQPSVKETPNHWVKCQSCHTLMYYKEIESCFNV
FT                   CPKCNYHMRISADERIKLLSDESSFIEYDANLEAIDPLKFVDSKSYKKRLSEGESKTGR
FT                   KSSVISGECEINGLKTQLVVFDFSFMGGSLGSVEGEKIVRAIQRAITSKTPLVIVSASG
FT                   GARMQESTYSLMQMSKTSTALKLLSKEKLPYISILTDPTMGGVSASFAWLGDLIIAEPE
FT                   ALVGFAGARVIKQTIGADLPEGFQKAEFLLEHGLIDAIVERGEQKQYLSDVLKFFSGK"
FT   gene            complement(135350..136072)
FT                   /locus_tag="JJD26997_0141"
FT   CDS_pept        complement(135350..136072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0141"
FT                   /product="Inositol monophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44390"
FT                   /db_xref="GOA:A7H1K7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K7"
FT                   /protein_id="ABS44390.1"
FT                   /translation="MKEFLDACLNANLQIRKYLNNIPQNDLKLCSKLGYDKNQGYELDL
FT                   KCEQIFIKYLSCFGQIFSEESGLIGKANPKQMILDPLDGSSNFVSKIPFYGTSVALMEK
FT                   NLTKSAFVCNLVSQEIFAFNNNQAFKSNLSDPKYSPLTPNLFPKIGIVEKISLHPELLD
FT                   FLTKNQLKFRSLGATALSLAYASYFSFILILGKTRIFDTAAALTIHQNLYIEKNENFLL
FT                   LSQDKKIFDIILEFLKNN"
FT   gene            complement(136072..138291)
FT                   /locus_tag="JJD26997_0142"
FT   CDS_pept        complement(136072..138291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0142"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /note="identified by match to protein family HMM PF01103;
FT                   match to protein family HMM PF07244; match to protein
FT                   family HMM TIGR03303"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43189"
FT                   /db_xref="GOA:A7H1K8"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K8"
FT                   /protein_id="ABS43189.1"
FT                   /translation="MKKHLISICALVAMANAATIKDIKFIGLNHLSNTSAINITGLKIG
FT                   EEINPAKINTAILNLYKQNYFENIAVENNNGILEIIVTEKPTIAKVSITGIASNDRKQV
FT                   ESILGIKRGTLLDEGSIKEAIERIKAYYEAKSYFDTIVEYKKKTLENTDGLELEFTVNR
FT                   GENIIIDNVHLSGAKKFSYSDIEPAVVNKEKEFMGWIWGRNDGKLKVFELSNDSSRIAD
FT                   EYMKKGYLDVQVSSPYLKTYTDTYQANLTYFIKEGKPYKIKSISIENPLFDDKQNTQTI
FT                   KDLRSSADKTINIEDIRKDVKTIETQSADLGYAFVEVYPDIQKNDQTQEATVVFKVISH
FT                   DTVYIRNVIISGNSRTVDRVIRRELYTTEGNLYNRTDLSESKNALKRTSYFDDVNIKEE
FT                   KVDDTHIDLIVDVKEASTGAISGGIGYGSSDGILLNASLSDTNIFGSGIKSSVSVDKSD
FT                   DTLSGRISLINPRILDSQYSLGGTLYSNDYEWDNYSEKNYGFDITVGRQFARYYNASLT
FT                   YNLEQSDIYHLSPTLLRTGYELGKSIKSSITPAIIFNNTDDYYLPRSGIIASTSLEYAG
FT                   LGGDQEFISSSSKFNFYQGLQDYIGYDLIYRYKASFYKVWDEGYLPINQRIYLGGIRSI
FT                   RGFESRTVSPKNQWGDEVGGTIAFANSVELSFPLIDRIKLRGSVFFDYGMIGLKNLDEI
FT                   KRMSTGIGIEWITPIGPLQLVFAKPLNDKKGDNTNSFEFNLGTRF"
FT   gene            138367..139194
FT                   /gene="tyrA"
FT                   /locus_tag="JJD26997_0143"
FT   CDS_pept        138367..139194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="JJD26997_0143"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by match to protein family HMM PF02153"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43148"
FT                   /db_xref="GOA:A7H1K9"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1K9"
FT                   /protein_id="ABS43148.1"
FT                   /translation="MKIAIIGLGLMGGSLGFCLKENKLISCVYGMDLSKENEKDALQLG
FT                   LIHELIEFKDLALCDMIFVATPVNAIIEILQKLVDLPSNITIIEFGSTKRKIIESLPKN
FT                   LIKQTLFAHPMTGTENSGPKAAFKELYKDAVCVLCDSEIADDLHQKRAVEIFSHLGMKI
FT                   VFMDSKAHDHHAAIISHLPHVISFSLANFVMKEEDKRNIVHLAGGSFKGMSRIAKSSPQ
FT                   MWESIFLQNKDNLLSSIDFFQQELERCKQMIQLDKNDELREWMKQANTLREIL"
FT   gene            139275..140648
FT                   /locus_tag="JJD26997_0144"
FT   CDS_pept        139275..140648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0144"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43424"
FT                   /db_xref="GOA:A7H1L0"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1L0"
FT                   /protein_id="ABS43424.1"
FT                   /translation="MAKRKGKTYLSVLILVLIAISIFFISRLSIFEKNPPQILMPDVVY
FT                   TDLKKPILVHVKDDKSSIKNVQIILYKDDNTSAMVIADEKISNLKDITLQVALPKFGYK
FT                   ENVKSFVLEVIAKDSSFWNFFSGNEARKQIAVLVDNTAPKINIISNSYQIEQGGAGAVV
FT                   FKADDVNLDKVYIETNKGKIFKATPYVKEGYYAALIAWDARDEEFRAFVIATDKAGNIS
FT                   KERIRYYFVNRKYLVSNINLTDKFLDGKIENLANQYAPKDNSLNRYEKFKFINETLRNS
FT                   NEELIHEITSKVPEEKIDNFDLNLFLPLKNGMKVADFADHRYYSYNGQFVSDSYHMGID
FT                   LASVAQAPIISNNAGKVVFAAENGIYGLNLIVYHGFGVYSLYGHCSSKNVDLDEMINKQ
FT                   SIIGKTGTSGLALGDHLHFGVLVQGVETRPEQWQDKKWIENNIYNVLNDGKKIILGKN"
FT   gene            140648..141532
FT                   /gene="lpxC"
FT                   /locus_tag="JJD26997_0145"
FT   CDS_pept        140648..141532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="JJD26997_0145"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF03331;
FT                   match to protein family HMM TIGR00325"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43647"
FT                   /db_xref="GOA:A7H1L1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1L1"
FT                   /protein_id="ABS43647.1"
FT                   /translation="MKQLTLVKTVKGVGIGLHKGEPIEITLEPLEANSGIVFFRSDLNA
FT                   SYKASPENVINTQMATVLGDDRGFISTIEHLMSAINAYGIDNVRIVLNANEAPVMDGSS
FT                   ISFCMMLDEAGVKELDAPKKIMVIKKPIEVRDGNKFVRLTPTKEPRINYTIKFDNAVIG
FT                   EQSYNFEFSKKNYIENIARARTFGFLKDVQALRSMNLALGGSLENTIVVDENRILNPEG
FT                   LRFKDEFVRHKILDAIGDLTLLGYRVFGDYTSYAGSHHLNHLLTKEVLKDKDAYEIVSL
FT                   EKTTQKAYEKVFA"
FT   gene            141571..141972
FT                   /locus_tag="JJD26997_0146"
FT   CDS_pept        141571..141972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44787"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1L2"
FT                   /protein_id="ABS44787.1"
FT                   /translation="MIGIYQDDKLIKTYKSEEKASEFLPKILDELLKEYDFTSLIYANG
FT                   PGSYMGIKISYVSLSTLSIVKNIPLFAVSAFELNGYKPISANKNFCFVYKEGEICLEQN
FT                   IPAEFFLPKNLQELKLNNDNLPFYFLDAI"
FT   gene            141981..142859
FT                   /gene="thrB"
FT                   /locus_tag="JJD26997_0147"
FT   CDS_pept        141981..142859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="JJD26997_0147"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00191"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43663"
FT                   /db_xref="GOA:A7H1L3"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1L3"
FT                   /protein_id="ABS43663.1"
FT                   /translation="MKILVPATSANLGPGFDCLGLSLKLFNETQIQKSGVFSISIGGEG
FT                   SDNIFLKKNNIFVNIFYEIYEKLSGKKDNFRFIFQNNIPLSRGLGSSSAVIVGAIASAY
FT                   YMSGFKVEKKRILDEALIYENHPDNIAPATLGGFVCSLVEKNKVYSIKKEIDKDLAAVV
FT                   VIPNLAMSTEQSRQALAKNLSFNDAVFNLSHASFLTACFLEKKYEFLKFASQDKLHEIN
FT                   RMKNLPELFEVQKFALENKALMSTLSGSGSSFFSLAFKDDALALAKKMQTKFKDFSVQY
FT                   LEFDDNGFEIC"
FT   gene            142884..143141
FT                   /locus_tag="JJD26997_0148"
FT   CDS_pept        142884..143141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44210"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1L4"
FT                   /protein_id="ABS44210.1"
FT                   /translation="MKKHIPIRMCIVCKNRFDQNVLFRFKIVLGDIMPKEEHGRSGYLC
FT                   QNCIEKEDKILQKAFFKICKNLNTKITQQGLKEIFLNGKD"
FT   gene            143128..145692
FT                   /gene="infB"
FT                   /locus_tag="JJD26997_0149"
FT   CDS_pept        143128..145692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="JJD26997_0149"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43395"
FT                   /db_xref="GOA:A7H1L5"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1L5"
FT                   /protein_id="ABS43395.1"
FT                   /translation="MAKIRIHEIAKELGYDSKEIIEKANELGLGIKTASNAVEPDIAVA
FT                   IYEYIQTREIPEAFKKNIKTPTAKKPKKENAKDQEKLNESEKKEPKKEESKEQEKQEII
FT                   DTHKPQSLASATLAKRRGLVIVKKKKDEEEIQVKKEEIKNSNDISINNEERLSLKTMFS
FT                   NADESLKKKKKEKKSFVASKKESTEKMNFLDEHDFGDISLDDEDEVVLPDFSVKEQEKP
FT                   QNINKKQPNFIRQAVGNSAGFGLEGGIQRRSRKKPPKKIEKKEVEEVSSVSISKEIRVY
FT                   EFADKIGKSTSEVISKLFMLGMMTTKNDFLDEDAIEILAAEFGIEINIINEADEFDYVK
FT                   DYEEETDEKDLVTRAPVITIMGHVDHGKTSLLDYIRKSRVASGEAGGITQHVGAYMVEK
FT                   NGRKITFIDTPGHEAFTAMRARGASITDIVIIVVAADDGVKPQTKEAINHAKAAGVPII
FT                   IAINKMDKEAANPDMVKTQLAEMEIMPVEWGGSYEFVGVSAKTGMGIEDLLEIVLLQAD
FT                   ILELKANPKSFAKASIIESSVQKGRGAVATIIVQNGTLAVGSTVVAGEAYGKVRAMSDD
FT                   QGKALKEIKPGECGVIVGLSEVADAGEILIAVKTDKEAREYANKRHEYNRQKELSKSTK
FT                   VSIDELGAKIKEGNLKALPVILKADVQGSLEALKASLEKLRNDEIKVNIIYSGVGGITQ
FT                   SDIELASASENSIVLGFNIRPTGEVKERAKDKGVEIKTYNVIYNLLDDVKALLGGMMSP
FT                   IISEEQLGQAEIRQVINVPKIGQIAGCMVTEGVINRGAKIRLIRDGVVVYEGNVSSLKR
FT                   FKDDAKEVAKGYECGVGIEGCDDMRVGDYIESYKEVEEQASL"
FT   gene            145689..146051
FT                   /gene="rbfA"
FT                   /locus_tag="JJD26997_0150"
FT   CDS_pept        145689..146051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="JJD26997_0150"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43719"
FT                   /db_xref="GOA:A7H1L6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1L6"
FT                   /protein_id="ABS43719.1"
FT                   /translation="MNPSEIKKLRTESILKELIPEALANLDDENLKNLCVVDVECKKGR
FT                   YDAFVYLDKMFFNIHEQEKILSSLKKASRALQNYCMSEQGWYRCPNFHFKFDDRLEYQN
FT                   HMDALFEKIKKDKNES"
FT   gene            146041..146463
FT                   /locus_tag="JJD26997_0151"
FT   CDS_pept        146041..146463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0151"
FT                   /product="protein Tmden_0678"
FT                   /note="identified by match to protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44495"
FT                   /db_xref="GOA:A7H1L7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1L7"
FT                   /protein_id="ABS44495.1"
FT                   /translation="MNLEALCKEAELSFYDDELVSENGKKIYRIYVQKEGGVNLDDCAR
FT                   LSEILSPIFDVEPPVNGEYFLEVSSPGLERKLSKIEHFAKSIGELVKITTNEKEKIEAK
FT                   IIAVDDENITLENLENKEKTTINFNDIKKARTFMEW"
FT   gene            146467..148263
FT                   /locus_tag="JJD26997_0152"
FT   CDS_pept        146467..148263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0152"
FT                   /product="putative McrBC restriction endonuclease system,
FT                   McrB subunit"
FT                   /note="identified by match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43959"
FT                   /db_xref="GOA:A7H1L8"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1L8"
FT                   /protein_id="ABS43959.1"
FT                   /translation="MEIIFKQDEKDNFISAINFLIHEVETCIQRNVLTQHGKVSVKGTS
FT                   QKDINIKLDFLKKYNYSYKIGLGNAGGFLNEDSWIIFVRNDLLASNLINGEKLTATKGI
FT                   YIFIAFSGYFSDDKHIQLRFGFPQGDMNLSRCNAVDQMDRSGKLRYFDFKYKDFEKETN
FT                   QIVKDFQDMINYFNIFDKNDFKLRAEFSTFIPLNQILYGPPGTGKTYHTIDKALEIISK
FT                   EEKIQIPSEDDRINRKKLFDEYVKNGQIVFTTFHQSYGYEEFVEGIKPDINSKEVKYKI
FT                   ENGVFKEFCEKALDNYENSILNADELNKKIELKEKFENFLNWLLETNEPIGKTKGGNFF
FT                   VVDINDKTVMIYSEGVERFDGNFNLSISIFMELLKCKDEFNNAAEMFKKVFNRDYADRT
FT                   HTYYFNLVKKFKAYEKQSVAKIENNKNNDNSLKPYVIIIDEINRGNVSKIFGELITLIE
FT                   PSKRIGVEEELKVTLPYSKKEFGVPKNVYIIGTMNTADRSITSLDTALRRRFEFIEMMP
FT                   DVSKLSMDCEGINLQELLKAINTRIEYLLDREKTIGHAFFISVENKDYLKNMTEFIESD
FT                   KIVYKFSDSNNWSKDTFIKIYE"
FT   gene            148263..149600
FT                   /locus_tag="JJD26997_0154"
FT   CDS_pept        148263..149600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44068"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1L9"
FT                   /protein_id="ABS44068.1"
FT                   /translation="MKTSNTFSIIEYQAFSKEDLKEIFKEKAEGFYKELEDFAKNNENL
FT                   LGFKNKNSLKAKNYVGIIQTKSGVLEILPKCTNLDSYKKEDSSSNHDKEKLRRCYELDN
FT                   ISKNNDFYEKDFKFNPKNLLINMLKTLKNSPFKKSQISSLQSSKIPLFEVFITMFLDEF
FT                   DSVYKKGLMRSYLSCEENRAFLKGKLLFNEHIKQNLIHKERFFTSNDEFVLDIAPNRLI
FT                   KSTLNFLKSKTSLNKFRLIKAMQMLDEVEFSKNYEKDFSYKISRHFDCYENLLLWCKIF
FT                   LKNESFMPYHGKNEAFALLFPMEKIFEDYVAYMLKKVNPAQDIKVQNNGKYLISKNDEN
FT                   CFMLKPDLYIENKMILDTKWKIPNDSKDEKKQGIAQSDLYQMFAYACKFKIYDIKIVYP
FT                   LCEKTQDLQRKIAEKFFVFKASEHLYFKEQGQKDIKVQVCFAPLPF"
FT   gene            complement(149589..150392)
FT                   /locus_tag="JJD26997_0153"
FT   CDS_pept        complement(149589..150392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0153"
FT                   /product="cation ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00950;
FT                   match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44727"
FT                   /db_xref="GOA:A7H1M0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M0"
FT                   /protein_id="ABS44727.1"
FT                   /translation="MLEILNFTFFQNALLGAILVSIACGIIGTLVMINRLFSMAGGITH
FT                   GAFGGIGIAFYFSLPILLSTGIFTLFLAFLVAFLAKRYEHRSDSIIAVIWAFGMAVGII
FT                   LIDLSPSYNTDLMAYLFGSILAVGTQDLWLMTLVDGMVVLLIFLFYRQFEALSFDAEFA
FT                   KVRGINTSFFHYLLIALMAFCIVISIRLVGLILVMALLSIPSFIAENFTKKLGFIMILA
FT                   SFLSMIFCILGLILSYYLNLSSGACIIAVACFGFLMHLIGKFLKR"
FT   gene            complement(150385..151239)
FT                   /locus_tag="JJD26997_0155"
FT   CDS_pept        complement(150385..151239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0155"
FT                   /product="cation ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43545"
FT                   /db_xref="GOA:A7H1M1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M1"
FT                   /protein_id="ABS43545.1"
FT                   /translation="MLFFEISNLNYAYDNETILKNINLSYDNKDFLSIIGPNGAGKSTL
FT                   VKLILGLLKSQNEIHFKALQRKEIGYVPQHTLANPNFCPRVLEIVLMGLVSKKIFGFYG
FT                   KKDKEKAMQALKSVGMEKFWNKTIDSLSGGQRQRVFIARALASECKMLILDEPTANVDN
FT                   KSAIQIFELLSSLHQKGMGILLICHDINLVLAYSDKIAHLNKELFLHTNTKEKEKSSFL
FT                   KHLYENHSHFCDVEMSLNTCFCDEENCDSKKLCEQEFTRRNLKKTEFKKENFCLKFSKE
FT                   NNA"
FT   gene            complement(151252..152127)
FT                   /locus_tag="JJD26997_0156"
FT   CDS_pept        complement(151252..152127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0156"
FT                   /product="cation ABC transporter, periplasmic
FT                   cation-binding protein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44070"
FT                   /db_xref="GOA:A7H1M2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M2"
FT                   /protein_id="ABS44070.1"
FT                   /translation="MKKIIFFILSLAISHTFIQAKNLEQDQNTSGNIISVSIAPQAFFV
FT                   KKIAVDTLDVNIILPPNSNEHNFEFKPNTMKKLEKSDIYFTIGLEFEKVFTDKFKQNFP
FT                   KLQVVNMQKNIALIQTHDTHEHSHEHEHFDPHTWLDPILVQTMALNIYDVLIQKYPQNK
FT                   NLYKQNLDKFLAELDSLNLQIASKLEKLKNREFVVYHPSWTYFAKRYNLIQIPVEILGK
FT                   EPKSKDLQKLITLMKNKNLKVIFVQNGFPENAAKTLAKECDAKIYKIDHLSYDWENELL
FT                   KTADAFSHNL"
FT   gene            152329..152610
FT                   /pseudo
FT                   /locus_tag="JJD26997_0157"
FT                   /note="methyl-accepting chemotaxis protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            152794..152964
FT                   /pseudo
FT                   /locus_tag="JJD26997_0158"
FT                   /note="methyl-accepting chemotaxis protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            153203..154300
FT                   /pseudo
FT                   /locus_tag="JJD26997_0159"
FT                   /note="methyl-accepting chemotaxis protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00015"
FT   gene            154434..156215
FT                   /locus_tag="JJD26997_0160"
FT   CDS_pept        154434..156215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05787;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44541"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M3"
FT                   /protein_id="ABS44541.1"
FT                   /translation="MERRLFLKGSALGSMVAFFASSNLSAAMLKDKDLLGFKAVSASTQ
FT                   DKVIVPQGYEAKVLISWGDPLFSKAKPYDENKIIDMNAVKNAHLVFGDNDDGMSFFPLS
FT                   KNRGILAVNNEYINPEIMFNHHGKNLSKEDVLYEQASVGVSILEIEKKGDDWTVVLDSK
FT                   YNRRIDTNTKMQVSGAAKKEVLKNEKFVHGTFANCANGQTPWGTYITCEENFDDFFGSS
FT                   GENLEFNDSLKRYGFNKTSLYGWEKFDERFDLAKNIDEANRFGWIVEINPFDAKSTPVK
FT                   RTSLGRFKHENAEIIVEKDGSVIVYMGDDEMNEFIYKFVSKHKYKKGTDTSKILDEGTL
FT                   YVGQFNGKVGDFKGQGKWIALEYGKNGLDEKNGFKSQAQILINTRLAASIVGATPMDRC
FT                   EWIESHKQSGSKEVFATLTNNKNRQKPNAANPRTKNVYGQILKWMPKNSHKDDDFTWEI
FT                   FALAGNPDNQQGLYKGSNNITSENKFNSPDGLKFDRDGRLWIQTDGSYSNKDEYEGMGN
FT                   NCMLAANPKTGEIRRFLTGPIACELTGIAFSEDYTTMFVGIQHPGEGLKGSTFPYGKTP
FT                   RSSVMMIRKLDGGVIGS"
FT   gene            complement(156253..157191)
FT                   /gene="trxB"
FT                   /locus_tag="JJD26997_0161"
FT   CDS_pept        complement(156253..157191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="JJD26997_0161"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43966"
FT                   /db_xref="GOA:A7H1M4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M4"
FT                   /protein_id="ABS43966.1"
FT                   /translation="MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSE
FT                   IENYPGVAQVMDGISFMAPWNEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELA
FT                   KAVIVCTGSAPKRAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYL
FT                   ANICSKVYLIHRRDEFRAAPFTVEKVKKNKKIELITSASVDEVYGDKMGVTGVKVKLKD
FT                   GSIRDLNVPGIFTFVGLNVRNEILKQDDGKFLCNMEEGGQVSVDLKMQTNVAGLFAAGD
FT                   LRKDAPKQVICAAGDGAVAALSAMAYIESLH"
FT   gene            complement(157325..157639)
FT                   /gene="trx"
FT                   /locus_tag="JJD26997_0162"
FT   CDS_pept        complement(157325..157639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="JJD26997_0162"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43239"
FT                   /db_xref="GOA:A7H1M5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M5"
FT                   /protein_id="ABS43239.1"
FT                   /translation="MGKYIELTSDNFDQAKEGIALVDFWAPWCGPCRMLAPVIDELAND
FT                   FDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKNGEVVDQLVGAQSKQAISDKLNSLL
FT                   "
FT   gene            complement(157696..158034)
FT                   /locus_tag="JJD26997_0163"
FT   CDS_pept        complement(157696..158034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02021"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43989"
FT                   /db_xref="GOA:A7H1M6"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1M6"
FT                   /protein_id="ABS43989.1"
FT                   /translation="MGVKAYLDGILGEDKACKFLKKQGFEILKRNFHSKFGEIDIIAKK
FT                   DEILHFIEIKFTQNNYEVSERLDRKKLEKILKTIEFYHLKNGISSDFQIDLICIKNDVI
FT                   QFCENISF"
FT   gene            complement(158034..159281)
FT                   /gene="hom"
FT                   /locus_tag="JJD26997_0164"
FT   CDS_pept        complement(158034..159281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom"
FT                   /locus_tag="JJD26997_0164"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00742;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44091"
FT                   /db_xref="GOA:A7H1M7"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M7"
FT                   /protein_id="ABS44091.1"
FT                   /translation="MKVAILGYGTVGSAVVKFLLENDKLIRARCGKSITPVIALTRSPK
FT                   KNALIPITHSIEEILNADVDVFVELMGGVDEAFKIVSEILKKKKAVVTANKAMLAYHRY
FT                   ELENLAKNLAFGYEASVAGGIPIIKVLKEGLSANNILAIKGILNGTSNYILSFMSQKNM
FT                   SFEQALQIAQNLGYAEADPTFDIEGQDAAHKLLVLSSIAYNLKAKPEDILIEGISEIAP
FT                   EDMYFANEFEFTIKLLGIAKVCENKVELRVHPTMIDKEKMLAKVDGVMNAISINGDLLG
FT                   ESLYYGAGAGGEATASAVISDLMDIARDQVKAPMLGFVNTLEYELLSKDEIYTKYYLRV
FT                   KVEDKIGVLSKITQLMSENNISIDSFLQKPKKNDENYSTLFFTTHLTYEKSIQNLLEIL
FT                   HKQDFIKTKPFMMRIE"
FT   gene            complement(159285..160487)
FT                   /locus_tag="JJD26997_0165"
FT   CDS_pept        complement(159285..160487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0165"
FT                   /product="aminotransferase, classes I and II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44648"
FT                   /db_xref="GOA:A7H1M8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M8"
FT                   /protein_id="ABS44648.1"
FT                   /translation="MFDAIRFNTIERLPDYVFAEVNAIKMAARRAGEDIIDFSMGNPDG
FT                   KTPQHIIDKLCESANKDKTSGYSTSMGIYKLRLAICNWYKRKYNVNLDPENEVVATMGS
FT                   KEGFVNLARAIINPGDVAIVPTPAYPIHTQAFIIAGGNVAKMPLVYNEKFELDENQFFE
FT                   NLHKTLNESIPRPKYVVVNFPHNPTTVTCEKSFYERLIATAKKERFYIISDIAYADLTY
FT                   DDYKTPSILEIEGAKDVAVETYTLSKSYNMAGWRVGFVVGNKRLVSALKKIKSWFDYGM
FT                   YTPIQVAATIALDGDQTCVDEIRATYDKRMHILLEAFENAGWKLQKPRASMFVWAKLPE
FT                   GKRHLKSLEFSKQLLQRASVAVSPGVGFGEAGDEYVRIALIENENRIRQAARNIKKYLK
FT                   E"
FT   gene            complement(160497..161303)
FT                   /locus_tag="JJD26997_0166"
FT   CDS_pept        complement(160497..161303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43427"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1M9"
FT                   /protein_id="ABS43427.1"
FT                   /translation="MVKKIIILILWVNISFAISSLELAKNLVNNPSKNSQLELLFSNNS
FT                   YIDNNGNCDIAKISQILKTNSLIALTLSNPQSLRLNFKAKADEVMFFKILSDVLTDAGY
FT                   IYFIPTDLILREGNIDYTIQVESQYVLDPGTLYNLLKENSVYIDNIKRIGAYDYEYDLN
FT                   FSNAVLKTNTNVNLNTAKSLEKPLKDYVLDLKNATNLIIDANDLDNWFPKIFFLDKNLN
FT                   LIKAVKSENKNNHFSELIPNGAIYAIVSDMYSLDNIRRGLKITLKK"
FT   gene            complement(161297..162235)
FT                   /locus_tag="JJD26997_0167"
FT   CDS_pept        complement(161297..162235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43725"
FT                   /db_xref="GOA:A7H1N0"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N0"
FT                   /protein_id="ABS43725.1"
FT                   /translation="MFNWKKIQELNLKEVAAKTQIELDFLEALVEKNFAVLSRFNVKGF
FT                   IKILSREYELDFSDFNEEYEAYLNENNPTPQTKSKMITSKLDAYSQKSSNAWPFLIVLI
FT                   VLVAIGSGIYYFDRLKTFFKDEQNNTSATVIDIIGQAQENLKSLGGNNVVVIDNNKAQE
FT                   TNQTESVLPSQNISLQENDKNISIENNISENNTTLLDEEKNTQIQEDTNTLKTDSLKEA
FT                   HFKTSTKIWIGLIDLKSLKKTSFVKEKDFNISLDKDQLILTGAAALTMFDQENKEQKFP
FT                   AGISKRFLIKDGKITSISAAEFVKLNKGKEW"
FT   gene            complement(162228..162911)
FT                   /locus_tag="JJD26997_0168"
FT   CDS_pept        complement(162228..162911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0168"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /EC_number="2.1.-.-"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43208"
FT                   /db_xref="GOA:A7H1N1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N1"
FT                   /protein_id="ABS43208.1"
FT                   /translation="MIVYGKQIFFYILEYHKDCINELYLAKECDKATFSKIAKSGFKIK
FT                   KLDFKTAQAYAKGGNHQGFLLDIKESSFANLNEIKKNDFIVMLYGISDVGNIGAITRTA
FT                   YALGVGALIFIGEKLAMEGVIRASSGAALDLPIVISNDALSVINELKQVGFYFYASDGS
FT                   GKEIHSVKINNGKKVLVLGSEGFGLSSKIVKKCDECVGIAMKNNFDSLNVSAAFAILCD
FT                   RMLNV"
FT   gene            complement(162925..163749)
FT                   /locus_tag="JJD26997_0169"
FT   CDS_pept        complement(162925..163749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0169"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44429"
FT                   /db_xref="GOA:A7H1N2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N2"
FT                   /protein_id="ABS44429.1"
FT                   /translation="MLYFIPTPIGNLSDISFRALELLKTCEFVFCEDTRVSKSLISLLN
FT                   TKFHTDIHISKFIALHSHNEKEVLASIDLKIFEKNVAYLSDAGMPGISDPGRALVEFAQ
FT                   ENNIAYEILPGANAALVALVSSAFCQKEFIFIGFLANKGKERQKDIEKILNLPYPSIIY
FT                   ESPKRILSLVEQIMILDSQREIFLIKEISKKFENKFKGNAKELFEILKKSNLNGEWVVV
FT                   LQSKEQNFLQNTLCEKDIMDLELPLKAKAKLLSKFNGKNAKEIYQKLLLSQD"
FT   gene            complement(163755..163952)
FT                   /gene="rpmE"
FT                   /locus_tag="JJD26997_0170"
FT   CDS_pept        complement(163755..163952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="JJD26997_0170"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44112"
FT                   /db_xref="GOA:A7H1N3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1N3"
FT                   /protein_id="ABS44112.1"
FT                   /translation="MKKEIHPEYVECKVSCACGNTFATKSNKAELRVDICSNCHPFFTG
FT                   SEKIVDAAGRVEKFKKKYAM"
FT   gene            complement(164031..164687)
FT                   /locus_tag="JJD26997_0171"
FT   CDS_pept        complement(164031..164687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0171"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43231"
FT                   /db_xref="GOA:A7H1N4"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N4"
FT                   /protein_id="ABS43231.1"
FT                   /translation="MQFLYNKQAGEEFIQLQGENFNHLKARRVRENSELNLRNLQDNFL
FT                   YSYTITDLTRNSCTLKFLNKKLQNIEQSKLNLALAIIDIKILEKTLPFLNELGVKKLHL
FT                   VFTNFSQRNFKIDLERFEKIIISSCEQCGRNTKMDLIIHQSTQEFVQKFPDAIMVDFQG
FT                   EQQSHFDEKELYFIGPEGGFNNDEKLLFNRKISLKNSNILKSQTAIIAIASKILL"
FT   gene            complement(164689..165096)
FT                   /locus_tag="JJD26997_0172"
FT   CDS_pept        complement(164689..165096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0172"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44786"
FT                   /db_xref="GOA:A7H1N5"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N5"
FT                   /protein_id="ABS44786.1"
FT                   /translation="MDQSYEFFLALHLYSLYASGFLMLFYLILTQGNFKTEFIFIRRIR
FT                   LFLPIYYLFLALIIFTGCLLSAMKQFQMNFDIWIMIFSWILIFALAIFHFICFKKARRF
FT                   RKYATFRWISCLILPFEIFLLFLPFLIERYL"
FT   gene            complement(165096..165521)
FT                   /locus_tag="JJD26997_0173"
FT   CDS_pept        complement(165096..165521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0173"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43877"
FT                   /db_xref="GOA:A7H1N6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N6"
FT                   /protein_id="ABS43877.1"
FT                   /translation="MQKAKNLITLSFFLLVLSACSNDEKNISKTQNIDQEVVQIEQNDE
FT                   KTELSDSNLPLPVDDEAQSSDDEHEANPSIISSLYKQKCATCHGEKGELKPKNSTAIKT
FT                   LGNKIFIQKIKTIKDKNHSFLSDEQIQNLADFINKGK"
FT   gene            complement(165521..166102)
FT                   /locus_tag="JJD26997_0174"
FT   CDS_pept        complement(165521..166102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0174"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase-like
FT                   protein"
FT                   /note="identified by match to protein family HMM TIGR03367"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44276"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N7"
FT                   /protein_id="ABS44276.1"
FT                   /translation="MIIRKLFEFENAHIVRFCSSKRCKSSIHGHSYKVEVLLESKYLDN
FT                   AGMVYDFGLLKTYIRQIIDSFDHAITLFKYDDAKYLEEMKKYSSRWICLPVNVSAENFC
FT                   RVFFILIDALLKQTKMVNGEQGVILQSIIVHETRTGYAQGFREDAYSELMPKISLQDIE
FT                   FSNGIKAEWNDIDFYNKLKNEEIFINPKEI"
FT   gene            complement(166099..166842)
FT                   /locus_tag="JJD26997_0175"
FT   CDS_pept        complement(166099..166842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0175"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43477"
FT                   /db_xref="GOA:A7H1N8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1N8"
FT                   /protein_id="ABS43477.1"
FT                   /translation="MQLVESFLSIQGEGKYNGKLAIFMRFAGCNFNCLGFNVKISKNDK
FT                   TLIGCDTIRAVFTKDFKESYETLSTNELLKRVIKLKQGFNPIVVITGGEPLIHYENPEF
FT                   IEFIQMLLKNKFEIHFESNGSIEIDFDRYPFYKECIFALSVKLQNSGIKKDKRLNFKAL
FT                   KAFKNYAKDSFYKFVLDANTLDNSFLEINEILKEAPNQIFCMPMGENEQNLKKNAQKIA
FT                   EFCIKNGYNYSDRIHIRLWNDKESV"
FT   gene            complement(166845..167807)
FT                   /locus_tag="JJD26997_0176"
FT   CDS_pept        complement(166845..167807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0176"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06463; match to protein
FT                   family HMM TIGR02666"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44219"
FT                   /db_xref="GOA:A7H1N9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1N9"
FT                   /protein_id="ABS44219.1"
FT                   /translation="MLIDQFDRKINYLRISVTQRCNFRCLYCMPKIPFDYQPKENLLSF
FT                   EELFLFVKATIDEGIEKIRITGGEPLLRKDLSIFIKMISDYKSDIDLAITTNGFLLKDF
FT                   AKDLKNAGLKRLNISLDTLDHKKAKTLAQKDVLDSVLSGIDEALNLDLKVKLNTVALKN
FT                   LNDDELISLLEFAKSKKAQIRFIEFMENTHAYGKLQGLKRDEIIQILSQKYQIQLIKKD
FT                   EKAPVSIYKADDYEFGIIDPHSHEFCDSCNRIRLSAEGLLIPCLYFDEASSIKEAVRKG
FT                   DIKAAVEILQEVLRNKPEKNKWSVVDNETSSRAFYQTGG"
FT   gene            complement(167820..168335)
FT                   /locus_tag="JJD26997_0177"
FT   CDS_pept        complement(167820..168335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43446"
FT                   /db_xref="GOA:A7H1P0"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P0"
FT                   /protein_id="ABS43446.1"
FT                   /translation="MSDDVLYLVFIIVLLIAMLTYMNIKERENNAKIAKLQNVIEDITK
FT                   ELHYFRKELGTKDDNEEDEDYKTSLLKEEIMIELDKQISSKITPVLSTLKTMEHIIEDF
FT                   QNEQQNRLLNLEQKAQSMAKLTPNYDTEEQKIENLFKEGKSIEQIAKDLHIGTGNVELV
FT                   LKFKKLIK"
FT   gene            complement(168332..168532)
FT                   /locus_tag="JJD26997_0178"
FT   CDS_pept        complement(168332..168532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44009"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P1"
FT                   /protein_id="ABS44009.1"
FT                   /translation="MDTILEEDKEYYLRFDLNNQKIAIFIKAQSQTLAKIIKIKPEDKM
FT                   AFDAFVVEIQRNMIRNKKGQE"
FT   gene            complement(168820..169704)
FT                   /locus_tag="JJD26997_0179"
FT   CDS_pept        complement(168820..169704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0179"
FT                   /product="putative 4-hydroxybenzoate octaprenyltransferase"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01475"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43294"
FT                   /db_xref="GOA:A7H1P2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P2"
FT                   /protein_id="ABS43294.1"
FT                   /translation="MNAFWIKFKDILELVVFKHSIFALPFLFSSMIVASKLANDTAWFG
FT                   FKALILGIICAVSARNFAMATNRLMDEDIDKNNPRCANRPNVSGKIDRKSVWIFIIINA
FT                   LIFISCSYFINTLAFYLSFPVLFVLAIYSAFKRFSSLAHLVLGFCLGLAPIAGSVIIMG
FT                   EIHIYSVILCLGVTFWTAGFDLLYSLQDMEYDKKVGLHSIPAKFGSKATLFISAFCHIL
FT                   AVLFWLLFVWEVWGVALGKIALIGVIISGIILALEHKIVYKNFAHIDRVFFTLNGYLSI
FT                   IFFIFIWIDLLWN"
FT   gene            169775..170644
FT                   /gene="miaA"
FT                   /locus_tag="JJD26997_0181"
FT   CDS_pept        169775..170644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="JJD26997_0181"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43960"
FT                   /db_xref="GOA:A7H1P3"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1P3"
FT                   /protein_id="ABS43960.1"
FT                   /translation="MFFEIALIGTTASGKTYIADTLAREFDAVVLSLDSLCVYKEINIA
FT                   SAKPSQDDLASIKYFGVNLLSVNEHFNVELFIREYQKAKEFALARNLPLIIVGGTGFYL
FT                   KTMIDGLSEKTLESKSSLNNDEIYTLLLNIDPNYKIEKNDTYRLKKWLGIYEQTREIPS
FT                   EFLKRTQKTGVLKDIEIYELAWDKEILKKRIQTRTKEMLDNGLLDEAKILFYKFDHKLK
FT                   ALNSIGLKECKEYLDGEISFKDLENLITIHTTQLAKRQRTFNKKFQSKALEFDKALATL
FT                   RMKFSIEK"
FT   gene            complement(170630..171193)
FT                   /locus_tag="JJD26997_0180"
FT   CDS_pept        complement(170630..171193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0180"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02659"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44749"
FT                   /db_xref="GOA:A7H1P4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1P4"
FT                   /protein_id="ABS44749.1"
FT                   /translation="MDFYSLIFLSCALGMDAFAVSLCKSFSVKKLHLKHYLIVGIYFGG
FT                   FQALMPTIGYFIGITFASFIASIDHWIAFILLSLIGLKMIKESLENENCNSNAKQFGFK
FT                   TMLALAIATSIDALAVGVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNK
FT                   AELLGGLVLIILGVKILIEHLFFD"
FT   gene            171341..171415
FT                   /locus_tag="JJD26997_0182"
FT   tRNA            171341..171415
FT                   /locus_tag="JJD26997_0182"
FT                   /product="tRNA-Glu"
FT   gene            complement(171551..171679)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0183"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            171988..172650
FT                   /gene="sodB"
FT                   /locus_tag="JJD26997_0184"
FT   CDS_pept        171988..172650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="JJD26997_0184"
FT                   /product="superoxide dismutase, Fe"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF00081;
FT                   match to protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43585"
FT                   /db_xref="GOA:A7H1P5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P5"
FT                   /protein_id="ABS43585.1"
FT                   /translation="MFELRKLPYDTDAFGDFLSAETFSYHHGKHHNTYVANLNNLIKDT
FT                   EFSGKDLVSIIKTSNGGVFNNAAQVYNHDFYFDCIKPSTGCGCGGSCQSMDANLQAALE
FT                   KEFGSLENFKAQFIKGAIGVFGSGWFWLVYNTKNQKLEFVGTSNAATPITEDKVPLLVV
FT                   DVWEHAYYVDHRNARPVYLEKFYAHINWEFVAKAYEWALKEGMGSVSFYADELHPVK"
FT   gene            172719..173411
FT                   /locus_tag="JJD26997_0185"
FT   CDS_pept        172719..173411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44688"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P6"
FT                   /protein_id="ABS44688.1"
FT                   /translation="MDNSLSAYTQKYDKEGYGLQYPDGHVIRFYERILKYKLSKTSGKL
FT                   LDFGCGNGVHSKYFKNITGGGGIEPYGIDIVPSLKKVWEKDPCLDSKNFHIISPNSSFK
FT                   KLFNTKMDFIFANQSLYYLTKQAFKEAMQEFYELCNEGAIIFATMMSDKGYSMYERGEL
FT                   MDNGLREVKGCPSGRLSGSSYIRFTKDIEELKEDFKPFKPLFWGDYELINLYNFEGSVE
FT                   HFIYIGQK"
FT   gene            complement(173425..174630)
FT                   /locus_tag="JJD26997_0186"
FT   CDS_pept        complement(173425..174630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0186"
FT                   /product="saccharopine dehydrogenase"
FT                   /EC_number="1.5.1.7"
FT                   /note="identified by match to protein family HMM PF03435"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43655"
FT                   /db_xref="GOA:A7H1P7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P7"
FT                   /protein_id="ABS43655.1"
FT                   /translation="MKNLLIIGAGGVSRVATVKCAMNSDTFSKITLASRTKSKCDEIAA
FT                   FIKERLGVQIETAQIDAGDSNAVVELIKKTGAQILLNVALPYQDLSLMDACIKAGIDYV
FT                   DTANYEHPDLAKFEYKEQWARNDEFKQAGILGLLGSGFDPGATNVFCAYAQQNLFDEIS
FT                   YIDILDCNAGDHGYTFATNFNPEINLREVSAKGRYWENGKWIETGPMEIKMEWDYPEVG
FT                   VKDSYLLYHEELESLVKNIKGLKRIRFFMTFGQSYLTHMKCLENVGMLGIKPVMHQGKE
FT                   IIPIEFLKTLLPDPASLGPRTKGYTNIGCVIRGKKDGKDKQVYIYNVCNHEKCYKETGA
FT                   QAVSYTTGVPAMIGTKLIAKGIWQGKGVFNMEEFDAKPFMEELNSQGLPWKIIEMTPNL
FT                   GE"
FT   gene            complement(174666..175574)
FT                   /locus_tag="JJD26997_0187"
FT   CDS_pept        complement(174666..175574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0187"
FT                   /product="iron ABC transporter, ATP binding subunit"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44194"
FT                   /db_xref="GOA:A7H1P8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P8"
FT                   /protein_id="ABS44194.1"
FT                   /translation="MMLEIKNLSKNFGKIQALENINLHVKEGEFLSILGGSGSGKSTLL
FT                   RIIAKLEQASSYDLFSCKGEVALMFQNYALFPHLNVEKNILFALYDKKDKNQILNHLLK
FT                   TFEIEDLRYKKIDEISGGQAQRVAFARAIARGCKLLLLDEPFSNLDQNLKQDLRRELKK
FT                   MIENQGITAIMVTHDIEDAYCMSNQIAFLEKGKILAHANPKELYFKPDFKSAQILPDLN
FT                   IIEEKLDLEDEFFAWIASKNYIFGYAELKIGNRFEAKILQKEFLGAFYRLKLRYKNIEF
FT                   FMLLSSNYNLEEKINFDIINF"
FT   gene            complement(175558..177174)
FT                   /locus_tag="JJD26997_0188"
FT   CDS_pept        complement(175558..177174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0188"
FT                   /product="iron ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43138"
FT                   /db_xref="GOA:A7H1P9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1P9"
FT                   /protein_id="ABS43138.1"
FT                   /translation="MYKTLKYYKLGAILLALFLALPIFSIFAELFYILFQNFNTSNLTQ
FT                   FSSIKENLSHFFDYLFLKFIKDTFIISVGVLCLSLILGVSSAYLIANYDFYFCKILEKL
FT                   LILPLAIPAYILAFVYVGIMDFQGFFHENFGFRIDFFNHYGVIFVLAISLYPYIYLFAK
FT                   TAFKSEAKEAYEVAKIMKYSEFRIFTRVALLSARPAIFSGALLVLMETLSDYGASAYLG
FT                   VDTFSAGIFKLWYDLNDSYSSSVLSGILMLFVFLIMYVDYYYKNKHHYSFNQNLTLFIK
FT                   KRKLNPIKQILSCIYCFMIAFIGFILPFIWLVYWGLKDHKLFESQFYIISFQTIILALI
FT                   TALITTFLAYFLMFSSRIVKNHFFNLFILKISSLGYSIPAAALGISIIVLFVFLDKIFH
FT                   MSLLGNSLLVLVFAYIIRFLASAIYSLEGGYNKIHLNIDEASLNLRASYFILFFKIHTP
FT                   LMKHFLFLAFIIVFIDTIKELPLSRILAPFGFETLSVKAFWFASDERIYDAALPSLFIV
FT                   FLSLMVVVWMDKITRKDDVRN"
FT   gene            complement(177174..178178)
FT                   /locus_tag="JJD26997_0189"
FT   CDS_pept        complement(177174..178178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0189"
FT                   /product="iron ABC transporter, periplasmic iron-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44392"
FT                   /db_xref="GOA:A7H1Q0"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q0"
FT                   /protein_id="ABS44392.1"
FT                   /translation="MKKIFFMFLTAFSFLGASELNIYSARHYDADFEIMKKFEEKTGIK
FT                   VNHTQAKASELIKRLSLEGSNSPADIFMTGDISNLTEVKNLGLLSPVSSKYLEEFIPAH
FT                   LKDKDKEWFAFAKRARIIAYNKNANIDISKMKNYEDLAKPEFKGEIAMRSATAPYSKTL
FT                   LASIIANDGNKNAKTWAKGVLDNLATNPKGGDRDQARLVFAGEAKFAIMNTYYIGLLKN
FT                   SKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDVAKKFMEFMLSPEIQKI
FT                   LTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKEAVKIYDEVGFR"
FT   gene            178496..179695
FT                   /locus_tag="JJD26997_0190"
FT   CDS_pept        178496..179695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0190"
FT                   /product="putative antibiotic transport protein"
FT                   /note="identified by match to protein family HMM PF05992;
FT                   match to protein family HMM PF06472"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43450"
FT                   /db_xref="GOA:A7H1Q1"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q1"
FT                   /protein_id="ABS43450.1"
FT                   /translation="MFSSFFASKKWALWAYLGLFLLLFFLYIQTSLNVAINSWYSDFYN
FT                   VLQKPKIELLDSNSTQKIEENLENNATLIQEANQRAEQNFQKANFINKGALYYYQNLLE
FT                   YFFNSRAMIEKPNYSANDFYALILVFLAIAIPYVLIATINIYFASVYAFKWREAMTFSY
FT                   LKFWKNKDDNIEGSSQRIQEDTYNFSKIVESLGLSFIKALMTLVAFIPILWSLSDVVSK
FT                   ALFANLSENSSFYFLKNIDGLLVYIALLISLGGLVVSWFVGIKLPGLEYNNQKAEAAFR
FT                   KELVYAEDNRKEYAKNETMIELFTGLKFNYKRLFLHYGYFNIWLILFEQMIVIVPFLIM
FT                   APGLFAGAIGLGIVMQINNAFDQVRSSFSVFITNWTTITQLRSIYKRLKEFEKNISYKS
FT                   "
FT   gene            179866..181152
FT                   /locus_tag="JJD26997_0191"
FT   CDS_pept        179866..181152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0191"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43691"
FT                   /db_xref="GOA:A7H1Q2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q2"
FT                   /protein_id="ABS43691.1"
FT                   /translation="MVVVALALVFLNSFFVLSEFSIVKVRRSKLEEMVKEKKASAKKAL
FT                   EVTSRLDTYLSACQLGITLSSLALGWIGEPAIAKMLEIPLINLGFSTVIIHTIAFIIAF
FT                   SIITLLHVVLGELVPKSIAIAVADKAVLFIARPLHWFWILFLPCIKIFDFLAGISLKLF
FT                   GIKPAKESELTHSEEEIKIIASESQKGGVLDEFETEIIRNAVDFSDTVAKEIMTPRKDM
FT                   ICLNKQKNYEENMQIICEHKHTRFPYIDGSKDTILGMIHIRDIIQNELSHKSQNLDTFV
FT                   KPLILVPENISISKVLVMMNKERSHTALVVDEYGGTAGILTMEDIMEEIIGEIKSEHEE
FT                   DSYKKLAENIYEFQGRCDIETVEEMLVINYDEDLEQVTIGGYVFNLLGRLPMVGDRIED
FT                   ELCYYEVKKMDGNSIERVKVVKKTNKDEE"
FT   gene            complement(181165..182342)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0193"
FT                   /note="Ser/Thr protein phosphatase family protein,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            complement(182352..182561)
FT                   /locus_tag="JJD26997_0195"
FT   CDS_pept        complement(182352..182561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0195"
FT                   /product="PhnA domain protein"
FT                   /note="identified by match to protein family HMM PF03831"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43229"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q3"
FT                   /protein_id="ABS43229.1"
FT                   /translation="MAKDANGTELNAGDSVSVIKDLKVKGASTTLKRGTTIKNIKLTFK
FT                   EGEIEARVDKFGVIVLKTEFLKKI"
FT   gene            complement(182545..183273)
FT                   /locus_tag="JJD26997_0196"
FT   CDS_pept        complement(182545..183273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0196"
FT                   /product="integral membrane protein, TerC family"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44192"
FT                   /db_xref="GOA:A7H1Q4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q4"
FT                   /protein_id="ABS44192.1"
FT                   /translation="MFEWIFSIDAWITLATLSALEIVLGIDNIIFLAILVSKLPPEYRD
FT                   KGRILGLAFAMITRILLLLSLFWVMKLATPLFSILGNEISGRDLVLLLGGLFLIVKSIK
FT                   EIKEQISHQEESQSHFKASNKFWIVVAEIAVIDIVFSLDSVITAVGIAQDVTIMIIAVI
FT                   IAVAVMLFASKPIADFVEKYPSIKILALAFLVLIGVVLIAESFDIHIDKAYIYTAMAFA
FT                   LVVQILNILDQRKEKNGQRR"
FT   gene            complement(183345..183911)
FT                   /gene="purN"
FT                   /locus_tag="JJD26997_0197"
FT   CDS_pept        complement(183345..183911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="JJD26997_0197"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43145"
FT                   /db_xref="GOA:A7H1Q5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q5"
FT                   /protein_id="ABS43145.1"
FT                   /translation="MLVKLAVLFSGNGSNLENILEKLHKQTIGKNTYEIVLCLCNKKDA
FT                   FGIQRAKKFGLDTVIVDHKAYSTREEFDTILVQKIKESGANLTVLAGFMRILSPVFTKN
FT                   IKAINLHPSLLPLFKGAHAIKESYESNMKVAGVSVHWVNEELDGGMIIAQKAFEKRNLS
FT                   FEEFEEKIHSLEHEILPLSVIEIFS"
FT   gene            complement(183902..185272)
FT                   /locus_tag="JJD26997_0198"
FT   CDS_pept        complement(183902..185272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03853; match to protein
FT                   family HMM TIGR00196; match to protein family HMM
FT                   TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44157"
FT                   /db_xref="GOA:A7H1Q6"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q6"
FT                   /protein_id="ABS44157.1"
FT                   /translation="MKAIIDNIKILEQNAINKGLDELILMENAGLNLAKLIKKEAKKIR
FT                   IQRKIKKVKILFLLGGGNNASDGLVALRNLKHAKAYKVGFKENTLFKKQEQILQNYAFK
FT                   FCQKEPDFKKFHIIIDCILGTGSNRCLDEKTSLMIQKANQSKALKIACDIPTNLGFYPC
FT                   FKADITLCMGALKEILLEDFAKEFVGRIKTANLGISSKKFYPNSQAFLLEKKDLKTIDR
FT                   KINANKGNFGHIYIVANASAGTLAGLGALNFGAGLVSLVAQKSFSPLLMLKEKIENNAS
FT                   AIALGMGLENLDFLKDEILQNTPLILDANCFLSETLLWYLNRKDVVITPHPKEFIRLYK
FT                   MCFDEDLDIETLQKNRFFYARKFSQNYDCVLVLKGANPIIIQKEKLFVVNLGNQALAKG
FT                   GSGDVLSGMIATHLGFGFSALEAAKNATLAHGFVAKKYKFNKNSFDALKLIEGLKCL"
FT   gene            complement(185256..185954)
FT                   /locus_tag="JJD26997_0199"
FT   CDS_pept        complement(185256..185954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43807"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q7"
FT                   /protein_id="ABS43807.1"
FT                   /translation="MKNKSIAIFIDAENIPAKYAKSIFDIASDYGEVIIKRIYGDWTQK
FT                   NIQGWREQIAEYSLIAMQQFNFAANKNSSDMYLITEIMSIFYEKNIDIFVIVSSDSDYT
FT                   SLIQKLRENKKQVIGMGLEKSIKSYVNAFSEFFYLDQDESKKEDILSKDYLRALINITE
FT                   QLIDEKGRAEYAQIRTNMNRKYSDFHPQNYGFKNFRALIQKFLPKMKKFEEEREKNIYF
FT                   LVKKDYESYY"
FT   gene            complement(185956..187461)
FT                   /locus_tag="JJD26997_0200"
FT   CDS_pept        complement(185956..187461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0200"
FT                   /product="Mg chelatase-related protein"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07728; match to protein
FT                   family HMM TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44840"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q8"
FT                   /protein_id="ABS44840.1"
FT                   /translation="MKKLKCISFHEGLDIIDVESTFTRGLPNLSIVGLASVAIKESVER
FT                   IKATLLSCNFVFPAKKITINLSPSGIPKKGSHFDLAIALLILLQNEELDDFFVVGELGL
FT                   DGSIKSTNELFSLLLFLSAKIEKAKIVVPKSIAQKASMIPNLEIYGLENLNGAIEFFKE
FT                   KNYENFRFSHNHPLFANPLQIENEIFLQNMDFKLDFKDIKGQEKAKRACMIAALGMHNI
FT                   LFEGSPGSGKSMCAKRLVYIMPPQSLSEILMQNAYMSLDSKDCEFTKIRAFRHPHHTST
FT                   RASIFGGGTKNARIGEVALANGGVLFFDEFPHFNKQIIESLREPLEDHKIHISRVNSKI
FT                   TYETKFSFIAAQNPCPCGNLFSKNLSCVCSENEIKKYKNHISAPIMDRIDLYVAMDEIS
FT                   KDDKASISSKEMSEKILQAFIFGKKRGQKEFNGKLKDEDLSRFCVLEKDAKDTLDLAIS
FT                   RYNLSLRSLNKILKVSRSIADLEQSLNINKTHILEALSFRARN"
FT   gene            complement(187458..187985)
FT                   /gene="def"
FT                   /locus_tag="JJD26997_0201"
FT   CDS_pept        complement(187458..187985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="JJD26997_0201"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43607"
FT                   /db_xref="GOA:A7H1Q9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Q9"
FT                   /protein_id="ABS43607.1"
FT                   /translation="MVRKIITYPNPRLFLNSEIVNKFDTELHTLLDDMYETMIASNGVG
FT                   LAAIQVDIPLRVLLVNIFDENDEQKKEDLLEIINPEIIPLDEEMITCTEGCLSVPDFFE
FT                   EVKRYNHILLKYQDRFGEFKELEAKGFLAVAIQHENDHLNGHLFIEKISFAKRQKFDKE
FT                   FKKKKKNHKKEK"
FT   gene            complement(188021..188605)
FT                   /gene="clpP"
FT                   /locus_tag="JJD26997_0202"
FT   CDS_pept        complement(188021..188605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="JJD26997_0202"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574;
FT                   match to protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43470"
FT                   /db_xref="GOA:A7H1R0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1R0"
FT                   /protein_id="ABS43470.1"
FT                   /translation="MFIPYVIEKSSRGERSYDIYSRLLKDRIIMLSGEIHDELAASIVA
FT                   QLLFLEAEDPTKDIYLYINSPGGVITSGFSIYDTMNYIKPDVCTICIGQAASMGAFLLS
FT                   CGAEGKRFALPNSRIMIHQPLGGARGQATDIEIQAKEILRLKTILNDILAKNTKQKVAK
FT                   IAKDTERDFFMSAQEAKEYGLIDKVLEKSFK"
FT   gene            complement(188605..189939)
FT                   /pseudo
FT                   /gene="tig"
FT                   /locus_tag="JJD26997_0203"
FT                   /note="trigger factor; this gene contains a frame shift
FT                   which may be the result of sequencing error; identified by
FT                   match to protein family HMM PF00254; match to protein
FT                   family HMM PF05697; match to protein family HMM PF05698;
FT                   match to protein family HMM TIGR00115"
FT   gene            190082..190654
FT                   /gene="folE"
FT                   /locus_tag="JJD26997_0204"
FT   CDS_pept        190082..190654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="JJD26997_0204"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43323"
FT                   /db_xref="GOA:A7H1R1"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1R1"
FT                   /protein_id="ABS43323.1"
FT                   /translation="MQKKFEDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQ
FT                   NVKEILNDALFESSNNEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPR
FT                   LVEVFARRLQIQEQLTEQIAQALMENADAKGVGVIIEARHMCVEMRGVQKANSTTTTSA
FT                   LRGIFLKNEKIREEFFSLINSAKQVRF"
FT   gene            190654..192039
FT                   /gene="fliI"
FT                   /locus_tag="JJD26997_0205"
FT   CDS_pept        190654..192039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="JJD26997_0205"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01026; match to protein
FT                   family HMM TIGR02545"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43820"
FT                   /db_xref="GOA:A7H1R2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1R2"
FT                   /protein_id="ABS43820.1"
FT                   /translation="MNLEKLRSKLGKENLSAIFGEITKISATSIEIRGLKTGIGDIVKL
FT                   VSNENENLNTLAMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVV
FT                   DPFMRPKDGKGAIEVTKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGI
FT                   FAGSGVGKSTLMGMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSD
FT                   DSALMRKYGAFCAMSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPP
FT                   SVLSLLPQLMERTGKEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTD
FT                   FGIYPPINIQNSASRVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKEL
FT                   DEAISKKEFMQKFLGQNPEESFEFNQTLELLSQIDTPNISLPPTQNINIGSASATLPNP
FT                   NLK"
FT   gene            complement(192042..193379)
FT                   /gene="purF"
FT                   /locus_tag="JJD26997_0206"
FT   CDS_pept        complement(192042..193379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="JJD26997_0206"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44168"
FT                   /db_xref="GOA:A7H1R3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1R3"
FT                   /protein_id="ABS44168.1"
FT                   /translation="MCAVVGVINSKNTSTYAYYALFAMQHRGQEASGISVSNGKNIKTI
FT                   KAKGEVSQIFNPDNLKTLEGEIAIGHNRYSTAGNSSLNDAQPIAATSVLGDIALAHNGN
FT                   LVNKEEVRSRLIQDGAIFQTNMDTENLVHLIARSKQESLKDRFIESLKECIGAYCFVLA
FT                   SKDKLYVVRDPHGVRPLSLGRLKDGGYIVASETCAFDLIEAEFIRDVKPGEMLIFTQGN
FT                   DKFESIELFSQTPRICAFEYIYFARPDSIVEGKSVYEVRKKMGEALAKKFAYKADFVVP
FT                   VPDSGVSAAIGFAQYLQIPLEMAIVRNHYVGRTFIEPTQELRNLKVKLKLNPMRKVLEG
FT                   KEIVVIDDSLVRGTTSKKIISLLRAAGASKIHLAIACPEIKFPDTYGIDTPTFEELISA
FT                   NKNAEEVREYVEADTLSFLSIEELTQSIGDERKYSLISFDGDYFIK"
FT   gene            complement(193364..194110)
FT                   /gene="dapB"
FT                   /locus_tag="JJD26997_0207"
FT   CDS_pept        complement(193364..194110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="JJD26997_0207"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113;
FT                   match to protein family HMM PF05173; match to protein
FT                   family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44158"
FT                   /db_xref="GOA:A7H1R4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1R4"
FT                   /protein_id="ABS44158.1"
FT                   /translation="MIKIGIYGAKGRMGKQIEECLKSETQAEISILYNKGGNLEELFEK
FT                   SDVIIDFSSPSGTHELLNYARTMPKPLTIGTTGLDEKILHLMQSASKVMPIFYATNMSL
FT                   GVAVLNYLASKASQMLRNFDIEILEMHHRHKKDAPSGTAMTLAQSVAKARNLELEKVRV
FT                   SGRDGIIGERSKDEIAVMSLRGGDIVGRHTVGFYEDGEFLELNHTATSRATFAKGAIKI
FT                   AIWLSKQEAKMYSINDFFRNLKCVQL"
FT   gene            complement(194173..195354)
FT                   /locus_tag="JJD26997_0208"
FT   CDS_pept        complement(194173..195354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0208"
FT                   /product="ATPase, AAA family protein"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43206"
FT                   /db_xref="GOA:A7H1R5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1R5"
FT                   /protein_id="ABS43206.1"
FT                   /translation="MSLALTFRPENFDDILGQYELIEIFKKFTALQKLPHSIFFGTAGS
FT                   GKTTFARVVAKEFGLDFYEFDGGNFKLEELRKILDNYKNSLYKPLIFIDEIHRLSKTQQ
FT                   EMLLIPMENYRLILIGASTENPYFVLSSGIRSRSMLFEFKSLGAKELETLLLRVQEKMK
FT                   FSIDKEAKDFLLKSADVRAMLNLLEFVLVLDEKHISLENLKKLRNTINSEGVSSKDTHY
FT                   ILASAMIKSLRGSDVDAAIYYLARLIDAGESADFIARRLVIFSSEDVGNADPNALNLAV
FT                   STLEAVKNIGYPEARIILAQCVVYLASTIKSNASYKAINEALNYVKNNEALEIPNYLNN
FT                   NHQEKQNYLYPHDFGGWVEQKYLSKNLKFYHSKGLGKEAKLLDNLYKLKNHKA"
FT   gene            complement(195354..196475)
FT                   /locus_tag="JJD26997_0209"
FT   CDS_pept        complement(195354..196475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0209"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44257"
FT                   /db_xref="GOA:A7H1R6"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1R6"
FT                   /protein_id="ABS44257.1"
FT                   /translation="MKKWIFIVFCFILGFIIHIFYIGYTNELLFNKFIKNSNPDYTITD
FT                   IYFKKGFLTSKGSFTLNHSHTQLSTKIDLKFNNYFLLNKIIKGNFTNPFDFLDEVLKNN
FT                   KLGTFTLKLHDNNSKIFLNIKDINLSNEGGDTIINGGYIEVLMNKNLEIKNMKIHFDMI
FT                   DFSQFYTKFVLQNLNYEQFFNNPVQFYELNLFSDSQQEINFDYLVLDNNKINSFYSKNQ
FT                   VNFNEENSAVNLNIQGKSNEIDLKSLLGQNLNFDKTKFNITINKFFNSNFNISHFIQKN
FT                   LDLKIQNLILEKNKQNISLQGNLNINNSYQAKLQVISSDEPDEIFPWTKDYGGLNQYFL
FT                   KGNNNFFLNLSYDSLANPQLKINGSEFSNMDLN"
FT   gene            complement(196610..196957)
FT                   /locus_tag="JJD26997_0210"
FT   CDS_pept        complement(196610..196957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44564"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1R7"
FT                   /protein_id="ABS44564.1"
FT                   /translation="MKKSILFASALLTGSMLFADSLKLEGTIAQIYDNNKTLLIDSIYG
FT                   GQMAIKVLPNTEIEMDDCGIFGTDKDGTFKDLQVGNFLESKISYGAPATPNTQAIPVAR
FT                   KIEIQCYKKAY"
FT   gene            197314..197557
FT                   /pseudo
FT                   /locus_tag="JJD26997_0211"
FT                   /note="putative transmembrane transport protein,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            197571..197939
FT                   /pseudo
FT                   /locus_tag="JJD26997_0213"
FT                   /note="putative transmembrane transport protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            198126..200120
FT                   /locus_tag="JJD26997_0214"
FT   CDS_pept        198126..200120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0214"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="identified by match to protein family HMM PF03169;
FT                   match to protein family HMM TIGR00728; match to protein
FT                   family HMM TIGR00733"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43216"
FT                   /db_xref="GOA:A7H1R8"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1R8"
FT                   /protein_id="ABS43216.1"
FT                   /translation="MYKKQNLPELTLRGLILGSILTIIFTASNVYLGLKVGLTFSSSIP
FT                   AVIISMAVLSLFKTSNILENNMVQTQASAAGTLSSVIFVIPGLFMCGYWSEFPLWQTFM
FT                   ICLCGGGLGVLFTIPLRRAMVVESKLAYPEGRAAAEILKVANKDQSNKKGKQGIKEIAL
FT                   GSFIAAIFSLLSNGFKLAASESNFAFIWNKMAFGFSMGYSLALLGAGYLVGLAGAIALF
FT                   VGMFLAWGIFTPYLSNFEFDSTKNAVDLASSVWSSKVRLIGTGAIAIAALWTLIELLKP
FT                   VIEGIKEIVKNVKITNQEKNERTNIDLSLKSIFILFVLMVVGLFITFYSFVEDANLSIY
FT                   YQMLFSFVGTLVSVLIGFFVAAACGYMAGLVGSSSSPISGIGLIGVIISSIVFLVLGVE
FT                   LFQDPMLSKFAVALAIFTTGVILATAAISNDNLQDLKTGHLVGATPWKQQVVLLVGCVF
FT                   GALAIVPVLNLLYQAYGFVGAMPREGMDASSALAAPQANLMSTIAQGIFHHNIEWGYMA
FT                   FGVFVGILMIIIDKILRRTQKMSLPPLAVGIGIYLPPAVNIPLVIGGILKYIVMQYLTK
FT                   KYAKNSHKEEKLASCEQRGTLFASGLIVGESIFGVIIAGITVFSVSMGGSENPLALNLT
FT                   NFHDSELFALIFFVGVVLYFIKRIVKKDA"
FT   gene            200194..200997
FT                   /locus_tag="JJD26997_0215"
FT   CDS_pept        200194..200997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0215"
FT                   /product="putative undecaprenol kinase"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44805"
FT                   /db_xref="GOA:A7H1R9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1R9"
FT                   /protein_id="ABS44805.1"
FT                   /translation="MGNLYALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSF
FT                   LIIIQLGSILAVIFVFWRKLFQGLDIWLKLSVGFFPTGVIGFFVAKYLNALFNGWVVVG
FT                   MLIFGGVMFILIEFAHKNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGG
FT                   LLLGFNRKVAAEFSFLLAIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVL
FT                   VIKFFLKFISKFDFIPFGIYRIILGFVFFYLYYSGILNAGSEFKL"
FT   gene            201128..202936
FT                   /gene="thrS"
FT                   /locus_tag="JJD26997_0216"
FT   CDS_pept        201128..202936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="JJD26997_0216"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43184"
FT                   /db_xref="GOA:A7H1S0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1S0"
FT                   /protein_id="ABS43184.1"
FT                   /translation="MEKEVIAYLDNETIIDSQSVKNTNLKEIYFDNSKESLEVIRHSCA
FT                   HLMAQAIKSLYPEAKFFVGPVIEDGFYYDFCVESKIGEEDLVKIEKKMKELAEAKIEIS
FT                   KYKITKNEALAKFQNDDLKQEVLLRIPDGAVSIYKQGEFEDLCRGPHVPNTKFLRFFKL
FT                   TRVAGAYLGGDEKREMLTRIYGTAFADKESLKEYLAIIEEAKKRDHRKLGIELKLFTFN
FT                   DEIGGGLPIWLGNGARLRSKLEHMLYKIHRLRGYEPVRGPELLKADAWKISGHYANYKE
FT                   NMYFTQIDEQEYGIKPMNCVGHIKVYQSDVRSYRDLPLKFFEYGVVHRHEKSGVLHGLF
FT                   RVREFTQDDAHIFCMPSQIKEQVLEILAFVDNLMKLFDFSYEMEISTKPEKAIGDDEIW
FT                   EVATKALKEALDEQGLKYGIDEGGGAFYGPKIDIKITDALKRKWQCGTIQVDFNLPSRF
FT                   KLEYTDSDNEKKQPVMLHRAILGSFERFIGILTEHCAGEFPFFIAPTAVGIVPIGEAHI
FT                   AYAKEIQKELLELNIDSEVYEKNESLSKKIRIAEKQKLPMILVLGDDEVAKRSVALRDR
FT                   RAKEQKNLSLDEFIKLVKEKMSEVYF"
FT   gene            202933..203451
FT                   /gene="infC"
FT                   /locus_tag="JJD26997_0217"
FT   CDS_pept        202933..203451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="JJD26997_0217"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43673"
FT                   /db_xref="GOA:A7H1S1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1S1"
FT                   /protein_id="ABS43673.1"
FT                   /translation="MSKEKEVLLNEEIRADEIRCVGDDGKVYGIISSDEALEIANRLGL
FT                   DLVMIAADAKPPVCKIMDYGKFRYQQEKKQKEAKKKQKVIDIKEIKLSVKIAQNDINYK
FT                   VKHALEFLEQGKHVRFRVFLKGREMATPEAGVVLLEKIWTMIENEANRDKEPNFEGRYV
FT                   NMLVTPKKA"
FT   gene            203490..204581
FT                   /locus_tag="JJD26997_0218"
FT   CDS_pept        203490..204581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0218"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="identified by match to protein family HMM PF02086"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44629"
FT                   /db_xref="GOA:A7H1S2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1S2"
FT                   /protein_id="ABS44629.1"
FT                   /translation="MKENPSFLKEQIITYLGNKRALLSFLNKGFKVAKKELGKDKFSFC
FT                   DIFSGSGVVSRFAKAHSNYILANDLEDYSKLINECYLANKDKDLLQNIKKYYKNLIQNL
FT                   DFEKGFISELYAPKDDDDIKKNERVFYTFKNALYLDTIRQKIENEIPKELRHFFIAPLI
FT                   YEASVHSNTSGVFKGFYKGKDGIGKFGGEGQNALKRIKGEIELKMPIFSNFSCEFEVMQ
FT                   KDASVLAKELDFFDVVYLDPPYNQHPYSSNYFMLNLIANYKKPEEISKISGIPKDWNRS
FT                   TFNKPKFAQEALFELINDLKARVILLSYNCEGFVKKEIFLKRLSTLGKCRILEQKYNTF
FT                   RASRNLKNRNIHLQEQLYILVKN"
FT   gene            204621..204878
FT                   /pseudo
FT                   /locus_tag="JJD26997_0219"
FT                   /note="immunoglobulin A1 protease; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            205117..207684
FT                   /pseudo
FT                   /locus_tag="JJD26997_0220"
FT                   /note="putative serine protease pic; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF02395"
FT   gene            207808..208176
FT                   /pseudo
FT                   /locus_tag="JJD26997_0221"
FT                   /note="hemoglobin-binding protease hbp; this gene contains
FT                   a frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM TIGR03304"
FT   gene            208258..209286
FT                   /gene="argC"
FT                   /locus_tag="JJD26997_0222"
FT   CDS_pept        208258..209286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="JJD26997_0222"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01850"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44104"
FT                   /db_xref="GOA:A7H1S3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1S3"
FT                   /protein_id="ABS44104.1"
FT                   /translation="MKIKVGILGASGYAGNELVRILLNHPKVEISYLGSSSSVGQNYQD
FT                   LYPDTPLNLCFENKNLDELELDLLFLATPHEFSAKLLNENLLKKMKIIDLSADFRLKNP
FT                   KDYELWYKFTHPNQELLQNAIYGLCELYKEEIKKASLVANPGCYTTCSILSLYPLFKEK
FT                   IIDFNSVIIDAKSGVSGAGRSAKVENLFCEVNENIKAYGLASHRHTPEIEEHLSYVAKE
FT                   KITLQFTPHLVPMQRGILISAYANLKENLQEQDIRDIYTKYYQNNKFIRLLPPQSLPQT
FT                   RWVKSSNFADINFSIDQRTKRVIVLGAIDNLIKGAAGQAVQNMNLMFDFDEDEGLKFFA
FT                   NL"
FT   gene            209296..209742
FT                   /locus_tag="JJD26997_0223"
FT   CDS_pept        209296..209742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0223"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43828"
FT                   /db_xref="GOA:A7H1S4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1S4"
FT                   /protein_id="ABS43828.1"
FT                   /translation="MLIRAMQKSDYEAVYKLWCEIKGFGIRSIDDSKENIENFLDRNPD
FT                   LSVVAVLDEEIVGSILCGHDGRTGGFYHVCVHKDHRKKGIAHEMTKFCLEALKAQKINK
FT                   IALIAFKNNDLGNEFWKHYGFTLREDANYYDLSLNEYNQTSFNA"
FT   gene            209752..210591
FT                   /gene="argB"
FT                   /locus_tag="JJD26997_0224"
FT   CDS_pept        209752..210591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="JJD26997_0224"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44799"
FT                   /db_xref="GOA:A7H1S5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1S5"
FT                   /protein_id="ABS44799.1"
FT                   /translation="MQKYLEKANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHCVM
FT                   QDIALLKLVGLKPIIVHGGGKDISAMCEKLGVKSEFKNGLRVSDKATTEVASMVLNHIN
FT                   KNLVHSLQNLGVKAIGLCGKDGALLECVKKDENLAFVGTIQKVNSKILEELLEKDFLPI
FT                   IAPIGMDEDFNTYNINADDAACAIAKALRAEKLAFLTDTAGLYEDFNDKNSLISKISLE
FT                   QAKILAPKIEGGMHVKLKSCIDACENGVKKVHILDGRVKHSLLLEFFTDEGIGTLVG"
FT   gene            210601..211782
FT                   /gene="argD"
FT                   /locus_tag="JJD26997_0225"
FT   CDS_pept        210601..211782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="JJD26997_0225"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00707"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44205"
FT                   /db_xref="GOA:A7H1S6"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1S6"
FT                   /protein_id="ABS44205.1"
FT                   /translation="MDYKEQSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGV
FT                   CALGYNHAKFNAKIKAQVDKLLHTSNLYYNENIATAAKNLAKASALERVFFTNSGTESI
FT                   EGAMKTARKYAFNKGIKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFKPLISGVKFAK
FT                   YNDISSVEKRVNEKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCG
FT                   MGRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSLEAGDHGSTYGGNP
FT                   LVCAGVNAVFEIFKEEKILENVNKLMPYLEQSLDELIKEFDFCKKRKGLGFMQGLSLDK
FT                   SVKVAKVIQKCQENALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF"
FT   gene            complement(211801..212430)
FT                   /gene="pcm"
FT                   /locus_tag="JJD26997_0226"
FT   CDS_pept        complement(211801..212430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="JJD26997_0226"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="identified by match to protein family HMM PF01135;
FT                   match to protein family HMM TIGR00080"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43202"
FT                   /db_xref="GOA:A7H1S7"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1S7"
FT                   /protein_id="ABS43202.1"
FT                   /translation="MNAFEQKRCQNMAEEIAQKVFINEELFNAFCQIPREIFSPLKAHA
FT                   YRLDALPLANSQWISSPLTVAKMTMALNFKNADSILEIGCGSGYQAAILSKVIRRVFTI
FT                   ERIENLAKKATQTFRELELFNINVKFDDGQNGWKNYAPYDRILFSAYATQIPEILLDQL
FT                   SDGGILVAPILHNGKQFITRLRKNGTNLQKETLEECLFVPIVDGKE"
FT   gene            212519..213067
FT                   /locus_tag="JJD26997_0228"
FT   CDS_pept        212519..213067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0228"
FT                   /product="transferase, hexapeptide repeat family"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44141"
FT                   /db_xref="GOA:A7H1S8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1S8"
FT                   /protein_id="ABS44141.1"
FT                   /translation="MLIKFKNHSPKLGQNIFVAEGAKIIGEIEIGDESSIWFNCVLRAD
FT                   VNFIKIGKRTNIQDLSTVHVWHREFDEKGKLKDAGFPTIIGDDVTIGHNCVIHACVIKN
FT                   RVLIGMNAVIMDNALIEEDSIVGAGSVVTKGKKFPPRSLILGNPAKFVRKLNDEEVRFL
FT                   KQSALNYVDFKNEFLKDLQ"
FT   gene            complement(213036..214406)
FT                   /locus_tag="JJD26997_0227"
FT   CDS_pept        complement(213036..214406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0227"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44819"
FT                   /db_xref="GOA:A7H1S9"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1S9"
FT                   /protein_id="ABS44819.1"
FT                   /translation="MTSKTSLALLCDFYEFTMSQGYFKNNKKDQICYFDIFFRKIPDSG
FT                   SFAIFAGLEDILDFVENLSFDAEDIEFLRKQGIFDTEFLDFLTSFKFKGEIYAMREGEV
FT                   IFPNEPLLCVKATTIEAQLLETFLLLSLNHQSLIATKTNRIVRAAKDSKILEFGSRRAQ
FT                   GSEAALKGARAAFIGGCIGSACTLAGKIYNIPINGTMAHSWVQMFENELEAFKAYVKIY
FT                   PKNPVFLIDTYDCLNSGLKNAIKVFKEFGIQEGGVRIDSGNLLELSLKIRQKLNQAGLQ
FT                   KCKIIVSNALDERSIKKLKEQNAPIDIFGVGERLITASSDPIFSCVYKLAALEDQGIKP
FT                   KIKISENNEKSTLPHFKKLFRVYDKNTKKILFDELYVFDENPNQDENLERKELLELVYK
FT                   EKRLLKKPSLNTIQDYTKEQISKLDESFLDLDRFVKFEVKLSPKLQNITEDLLKTRF"
FT   gene            complement(214396..215418)
FT                   /gene="nrdB"
FT                   /locus_tag="JJD26997_0229"
FT   CDS_pept        complement(214396..215418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="JJD26997_0229"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44625"
FT                   /db_xref="GOA:A7H1T0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T0"
FT                   /protein_id="ABS44625.1"
FT                   /translation="MQRKKIYNPSSNETLGDRKVFDGNPHGILNFTKAKYTWALKLWDL
FT                   MEANTWFPKEVDTTKDALDYRCNLTAGEKRMYDLVWSQLISMDSFQTNNLADNINPYIT
FT                   APEINAVLARQAYEEANHSKSYAVMVEAICDNTDLIYEMEKHDETLREKNDFISSIYEE
FT                   LAGDVDDNKLLLAMVANQILEGVYFYSGFTAIYALARAGKMLGSAQMIRFIQRDEITHL
FT                   LLFQNMINSVHKERPDLFHDENINKIYDMFKKAGDLEIKWGKYITQNQIMGFTDDIIEE
FT                   YIHYLVDQRLSAINLDKLYNAKHPIKWVDDFSKFNDQKSNFFESKVTNYSKGSISFDDF
FT                   "
FT   gene            complement(215432..215842)
FT                   /locus_tag="JJD26997_0230"
FT   CDS_pept        complement(215432..215842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43637"
FT                   /db_xref="GOA:A7H1T1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T1"
FT                   /protein_id="ABS43637.1"
FT                   /translation="MKTKAKISSRWLRFRALLIDIFLIYVPILYLFYFLLGSKEAFLNN
FT                   HFITTLCTFLFGLIQAIFLTKKAQSPGLKAYNLYLIDIKTGKKLSFLRILLRYVIFIIS
FT                   FGLLFGLFVSFVRKDRLNLHDILTQSCIATKA"
FT   gene            complement(215843..216451)
FT                   /gene="pyrE"
FT                   /locus_tag="JJD26997_0231"
FT   CDS_pept        complement(215843..216451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="JJD26997_0231"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01367"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43371"
FT                   /db_xref="GOA:A7H1T2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1T2"
FT                   /protein_id="ABS43371.1"
FT                   /translation="MNLEQIYKDRGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKL
FT                   CDELAKIIASYKIEFDSICSPALGGILAGYELARACNKRFIFTERVNKEMTLRRGFEVK
FT                   KGKKFIICEDIITTGGSALESAKTIESLGGIVVGFAALANRGFCGVENLKSPRKDNAKL
FT                   PENLPLFTLGNFEFEIYDETNCPLCKKGSKAIKPGSRGN"
FT   gene            complement(216454..217011)
FT                   /gene="frr"
FT                   /locus_tag="JJD26997_0232"
FT   CDS_pept        complement(216454..217011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="JJD26997_0232"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44563"
FT                   /db_xref="GOA:A7H1T3"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1T3"
FT                   /protein_id="ABS44563.1"
FT                   /translation="MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKINTHILDHITVDYY
FT                   GNQTPLNQVATVLASDASTISITPWEKPLLKTIESAIAAANIGVNPNNDGESVKLFFPP
FT                   MTREQREENVKQAKAMGEKAKVSIRNIRKDANDAVKKLEKDKAISEDEAKKAYDEVQKL
FT                   TDVYTTKIDESVKSKESELLKV"
FT   gene            complement(217027..217395)
FT                   /gene="secG"
FT                   /locus_tag="JJD26997_0233"
FT   CDS_pept        complement(217027..217395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="JJD26997_0233"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="identified by match to protein family HMM PF03840;
FT                   match to protein family HMM TIGR00810"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43241"
FT                   /db_xref="GOA:A7H1T4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T4"
FT                   /protein_id="ABS43241.1"
FT                   /translation="MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKG
FT                   PAGFLAKFTFVMGILLIANTIGLSYLYNKASKDSLAEKIKVENNTTIPSAPIIPTTPNT
FT                   NSVAPSAPQLPSDINSSK"
FT   gene            complement(217499..218194)
FT                   /locus_tag="JJD26997_0234"
FT   CDS_pept        complement(217499..218194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0234"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01027"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44358"
FT                   /db_xref="GOA:A7H1T5"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T5"
FT                   /protein_id="ABS44358.1"
FT                   /translation="MSLYDRDYSRSKEFENTRSSELSIFIKQTYQLFAASLLAATVGAY
FT                   VGIFALASFFIQSQVTFWVLFAVEIGLLFALQWKKKEAPLNLVLLFSFTFCSGLTLTPL
FT                   LISVLALPAGGIIIAQAFALTTVAFAGLSVFAMNTKKDFTVMGKALFIVLIVIVAASLL
FT                   NLFFQSSIVNLAISAVAAILFSFYILYDTQNIIRGNYETPIEGAVALYLDFVNLFVSLL
FT                   NILRSFNSR"
FT   gene            218354..218989
FT                   /gene="cynT"
FT                   /locus_tag="JJD26997_0235"
FT   CDS_pept        218354..218989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="JJD26997_0235"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44438"
FT                   /db_xref="GOA:A7H1T6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T6"
FT                   /protein_id="ABS44438.1"
FT                   /translation="MENLISGAIKFMQEDFKEHEELFESLKNKQNPHTLFIGCSDSRVI
FT                   PNLITNTGPGELFVIRNIANIVPPYRVGEDYLATTSAIEYALNSLHIKNIVVCGHSNCG
FT                   GCNALYYSDEELNKIPNVKKWLTMLDPIKKDVMIFARDDLAMRSWLTEKLNLVNSLQNI
FT                   LTYPGVQEALDEGKIEVHAWYYIIETGEIYEYDFKAKIFTLIQDRKVQ"
FT   gene            218986..220869
FT                   /locus_tag="JJD26997_0236"
FT   CDS_pept        218986..220869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0236"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43876"
FT                   /db_xref="GOA:A7H1T7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T7"
FT                   /protein_id="ABS43876.1"
FT                   /translation="MKKIIFSLCFFILYLGAQEFKFIDANISKEDEGIYALVEKYVDLN
FT                   NQIKEFKKNNDENSSTFNGILSEFEKDKKTILAKIPDMIVGQKINEEAVARFLKAKEKL
FT                   LDVQKKNINKPYIYTDATLNLVYFNIVESFYSSLFEVEKLFKNTASSEDLIATVDKAME
FT                   NLQNSSNVNLDSFKSKITNPEELEKITLKERYISNAVDSYSEILKYLRSNADLLESNYI
FT                   FSLLELQVWIDRINEAIGVGFINIGKIVISALVLVFFISLRCFFANIVYFFLVQLFYRD
FT                   KNDVDDIKVIVIENIKKPVGFFLIVYAISICLTIATYPAPLSINLSNFFHIVYAVLIAW
FT                   LILKMLDGYGMVLVSKLAQKSGKKEVVNLIIKILYFVIIIIALLYILAQLGFNISAIIA
FT                   SLGIGGLAVALAAKDIIANFFASILLLFDNSFNQGDWVEVSGIEGTVVEIGLRKTTIRT
FT                   FDNCLVFLPNSTIMGANIKNWSKRRMGRHVRMYLGVGYDATPEKLEQCVKDLREFLHTS
FT                   DLVAHDEDSALKYGDHTTKYRQNLVSINDLEGYKNACYVALSEFADSSINIELYFYTKE
FT                   IGGKDFREARQSLMLEFMRIIEKNGLTFAFPSRSIYIENLPPLDLQAKAIK"
FT   gene            complement(220893..221864)
FT                   /locus_tag="JJD26997_0237"
FT   CDS_pept        complement(220893..221864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0237"
FT                   /product="NifU family protein"
FT                   /note="identified by match to protein family HMM PF01106;
FT                   match to protein family HMM PF01592; match to protein
FT                   family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43859"
FT                   /db_xref="GOA:A7H1T8"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T8"
FT                   /protein_id="ABS43859.1"
FT                   /translation="MGKNSLIGGSIWDEYSQKVQDRMNNPQHMGEFSEEDAKVRNAKLI
FT                   VADFGAESCGDAVRLFWLVDEKTDKIIDAKFKSFGCGTAIASSDTMVDLCIGKTVDEAV
FT                   KITNLDVEFAMRDNPETPAVPPQKMHCSVMAYDVIKQAAAHYKGISPEDFEDQIIVCEC
FT                   ARVSLGTIKEVIKLNDLHSVEEITQYTKAGAFCKSCIKPGGHEKRDYYLVDILAETRAE
FT                   IDREKLKNTMKSDVAFDEMTVVGQLKAVESVLDAEIRPMLHNDGGDLEVIDIQKAEGAA
FT                   IDVYIRYLGACSGCSSGSGATLYAIETILQEELSPNIRVMPV"
FT   gene            complement(221874..223055)
FT                   /locus_tag="JJD26997_0238"
FT   CDS_pept        complement(221874..223055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0238"
FT                   /product="putative cysteine desulfurase"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR03403"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44683"
FT                   /db_xref="GOA:A7H1T9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017773"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1T9"
FT                   /protein_id="ABS44683.1"
FT                   /translation="MKVYLDNNATTMLDPNTYELMLPFLKDMYGNPNSLHQYGSTTHPA
FT                   LREALDKLYAGLGANDLDDIVVTSCATESINWVLKGVYFDHILDKERNEVIISSVEHPA
FT                   VTAAAYFLKSLGVKVIELPVNEEGVSTVEDLRKVISDKTALVSVMWANNETGMIFDIKA
FT                   MAELAHEFGALFHTDATQAVGKIKVNLTQAGVDFASFSAHKFHGPKGVGGLFIKKGLKL
FT                   TPLLHGGEHMGGRRSGTLNVSYIVAMGEALRIANTMLDFEDSHIRRLRDKLEDQILALP
FT                   DTTVVGKREHRVPNTILASIKGVEGEAMLWDLNKNGIAASTGSACASEALESNPIMEAI
FT                   GADHDLAHTALRLSLSRFNTEEEIDYAAKQIKNATQRLRAISCTYAYNPNNYK"
FT   gene            complement(223240..223635)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0239"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01814; match to
FT                   protein family HMM TIGR02481"
FT   gene            complement(223767..224933)
FT                   /locus_tag="JJD26997_0240"
FT   CDS_pept        complement(223767..224933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43150"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1U0"
FT                   /protein_id="ABS43150.1"
FT                   /translation="MTINSANPYQNLTLSNPLQNSSALNLIKDSKALDQEGNENSLEQL
FT                   SYIFNNTTYASEFGFRINEEGFFDKDLNKIANIPESYDINIKSVRSIAKELAKQDENLN
FT                   YNKIDLPYLLNSYHSSLKSINSEFLQDDNAYLNRDLISKLSSGFSTDNGEFLGQISRIY
FT                   NNQEEIDLALSNITNLNTLMLDNKITNFHFDKAIENTSSNEILKPYLTKNAEVSKSGLL
FT                   MNFIYHDIKTQNEKEFNFFMKPATLELSSHQNLQKILKGETDIEDYIKKENEKKMSFDL
FT                   YLYVNGVDKKTSTQDKLSVFFQQYINYQKDMDLREFANSSSIFQIYIDQNRNDFDALKK
FT                   QYQNQSQDTQRLEEANQLHSSSLKNFLDRRQKQANINKILNSYMSVMV"
FT   gene            225095..225286
FT                   /gene="rpmI"
FT                   /locus_tag="JJD26997_0241"
FT   CDS_pept        225095..225286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="JJD26997_0241"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43126"
FT                   /db_xref="GOA:A7H1U1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1U1"
FT                   /protein_id="ABS43126.1"
FT                   /translation="MPKMKSVKSAVKRFKVGKNKIKRGSAFRSHILTKKPAKRMRNLRT
FT                   AKYVHSTNVKAVEKMLGI"
FT   gene            225380..225733
FT                   /gene="rplT"
FT                   /locus_tag="JJD26997_0242"
FT   CDS_pept        225380..225733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="JJD26997_0242"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44359"
FT                   /db_xref="GOA:A7H1U2"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1U2"
FT                   /protein_id="ABS44359.1"
FT                   /translation="MARVKTGVVRRRKHKKVLKLARGFYSGRRKHFRKAKEQLERSLVY
FT                   AYRDRRRKKTDFRRLWIVRINAACRLNDLSYSRFINGLKKAGIELDRKILADLAMNDVA
FT                   AFAKIAEAAKKAL"
FT   gene            complement(225785..225964)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0243"
FT                   /note="putative MCP-domain signal transduction protein;
FT                   this gene contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(226040..226450)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0244"
FT                   /note="putative MCP-domain signal transduction protein;
FT                   this gene contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00015"
FT   gene            complement(226468..226910)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0246"
FT                   /note="putative MCP-domain signal transduction protein,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            227230..228087
FT                   /locus_tag="JJD26997_0247"
FT   CDS_pept        227230..228087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08668"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43733"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1U3"
FT                   /protein_id="ABS43733.1"
FT                   /translation="MIGDMNELLLKSVEVLPPLPDTVSKLRKYVSEANSNIETMKVAEI
FT                   ISSDPLMTAKLLQLANSPYYGFTREITTINQVITLLGVGNIINIVTADSIRDNFKIDVS
FT                   PYGLNTQNFLKTCNEEATFITNWLNDEDKKLSHLLVPCAMLLRLGIVIFSNFLIQNHKD
FT                   KDFLAFLNKNENLALAENEFLGVDHISFLGFLLHRWNFDDVLIESICFVRTPHAAREEV
FT                   KKSAYALAITDHLFAPHDGSSPFNAKAAVALLEEAKTQGINFDLDNLLSKLPSKAKENL
FT                   DKED"
FT   gene            228117..228593
FT                   /locus_tag="JJD26997_0249"
FT   CDS_pept        228117..228593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0249"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43474"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1U4"
FT                   /protein_id="ABS43474.1"
FT                   /translation="MKSLILPPNEFLDHYILNAEFHRFAGISKNAYKFWKNVEIGRYQG
FT                   TRIIFLHRNCILEKHQQALRQCSGLNGFVLASAFCSFTGLAPSHLVEKNNSSIYKLLDL
FT                   KEICGIKFVNLKKFYDFLELNYHQHIYIEKCHFFSPAPFEKRIKITESMCVGYY"
FT   gene            complement(228562..229872)
FT                   /locus_tag="JJD26997_0248"
FT   CDS_pept        complement(228562..229872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0248"
FT                   /product="major facilitator superfamily protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44470"
FT                   /db_xref="GOA:A7H1U5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1U5"
FT                   /protein_id="ABS44470.1"
FT                   /translation="MNKTLNQKDIKVLGLSSLGGTLEFYDFIIFVFFANYISTNFFPKD
FT                   LSSFWQMFNTYGIFAAGYLARPLGGVILAHFGDKFGRKRMFMISILLMVIPTFTLAFIP
FT                   NYESIGFLCIVLLVFIRICQGIAIGGELPGAWVFVYEHAPQGQKRTYLGILTASVVGGI
FT                   LLGSLVFLIMNKIYTQEELHEWAWRIPFFLGGIFGIISAYLRKFLRETPVFEQMKKDKA
FT                   LEKFPLKEVFKKAKMGIVLSMMITWVLTGCIVVMILLMPSYMAKILQINTSIQTYLQIG
FT                   GILLICLGCIISGILADKIGIIKSCIFFSVFFGIASLLYFNTLYKQNADFNLTVCLYLF
FT                   VCFFGGVMNFCPLIMSEVFDAKIKFSGLSFSYNIAYAIAGGLTPQLAFFLHSFALDNLS
FT                   NFWRFSLGVYVFFLAIIALLCAFIFSYLNNTQRTYSQ"
FT   gene            complement(229856..230032)
FT                   /locus_tag="JJD26997_0250"
FT   CDS_pept        complement(229856..230032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0250"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44640"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1U6"
FT                   /protein_id="ABS44640.1"
FT                   /translation="MAYEDEEDLNYDDYENEDEEYPQNHHKNYNYDDDDYEYDDDSNDD
FT                   DFYEMEIKNEQNP"
FT   gene            230125..230598
FT                   /gene="moaC"
FT                   /locus_tag="JJD26997_0251"
FT   CDS_pept        230125..230598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="JJD26997_0251"
FT                   /product="molybdenum cofactor biosynthesis protein MoaC"
FT                   /note="identified by match to protein family HMM PF01967;
FT                   match to protein family HMM TIGR00581"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43664"
FT                   /db_xref="GOA:A7H1U7"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1U7"
FT                   /protein_id="ABS43664.1"
FT                   /translation="MKLSHLDEKNHPKMVDVSDKNITSRMATASGVIYMSQEAFDVIKN
FT                   NTAKKGPVLQTAIVAAIMGAKKTSEIIPMCHPLMLSKIETDIVEFVKECAFKLIVTVKC
FT                   EGKTGVEMEALSGVSIGLLTIYDMIKAIDKSMRITDIVLESKEGGKSGKFVRY"
FT   gene            230576..230839
FT                   /locus_tag="JJD26997_0252"
FT   CDS_pept        230576..230839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44811"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1U8"
FT                   /protein_id="ABS44811.1"
FT                   /translation="MVNLCDIKKEPQINYPTFWDYKVIFEVHVKASEIFQEILGQREYK
FT                   FEHSNSSTSGKYQSYLLNVYVDNKKDRLDIFDKLKAKAKFIL"
FT   gene            230853..231989
FT                   /locus_tag="JJD26997_0253"
FT   CDS_pept        230853..231989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43814"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1U9"
FT                   /protein_id="ABS43814.1"
FT                   /translation="MKNTLIIFENSLSNLGKDKASDLLEDLSFNLSYKQISHNPHEAKK
FT                   VLNSLLVEFLTILKKLDFCDDENVAKVIKALVKASVVDAQNSLYEYISEAELLNKRIEN
FT                   QKNLIKNQISDNFFEFENILQEYSFCDEFSGGLNDAILFDIEMLGILKETAESAFLTTL
FT                   EKAEDIELTSSEIAKNLVYNAICEAHFEKERILKISSIILNTAFEIANESMAYAKDLCL
FT                   GVIKGTRDGIVLAMEKFKASLTYANFEEDLSLKSKELIGIEDDFIALLKKEIQLQNDPC
FT                   KSIVENLLEHELDNLFAKFRRLAGESREQLILVLNDIKKNPKINDFNKLTQRKLNRFKQ
FT                   EIFELEKIASEKYKDLNSKKAKKLGVRLWEKAKKFVKK"
FT   gene            complement(232010..232789)
FT                   /gene="xth"
FT                   /locus_tag="JJD26997_0254"
FT   CDS_pept        complement(232010..232789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="JJD26997_0254"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00195; match to protein
FT                   family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43262"
FT                   /db_xref="GOA:A7H1V0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V0"
FT                   /protein_id="ABS43262.1"
FT                   /translation="MKILRKIMKLLSWNVNGLRSICDKNALDWIKKEKIDFIGFQEIKA
FT                   HEDKFPKKIYEYPFKHMYFNSAKRAGYSGVMSLCNFDSEVKKCEFFDDEEGRVLEHRFK
FT                   NIALFNIYFPNGQKDEERLNFKMKFYTDFLVYLNKLLKDGFEIIICGDVNTAHKEIDLT
FT                   HPKANANTSGFLPIERAWIDDLLKLGFVDTFREINGEIKEKYSWWSYRMKARERNVGWR
FT                   IDYFFISKGLKDKLKNAFIRDDIFGSDHAPVGIEIDI"
FT   gene            complement(232943..233254)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0255"
FT                   /note="transposase; this gene contains a frame shift which
FT                   may be the result of sequencing error; identified by match
FT                   to protein family HMM PF01797"
FT   gene            233470..234711
FT                   /locus_tag="JJD26997_0256"
FT   CDS_pept        233470..234711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0256"
FT                   /product="ISHa1675 transposase B"
FT                   /note="identified by match to protein family HMM PF01385;
FT                   match to protein family HMM PF07282; match to protein
FT                   family HMM TIGR01766"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43400"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V1"
FT                   /protein_id="ABS43400.1"
FT                   /translation="MLSAVKYRIYPTKAQKELIHKHFGCARVVYNHFLDYRQKQFAKGI
FT                   KETYFTMQKELTLLKKQDEYKYLNECASQSLQMALRQLVTALDNFFAKRAKYPNFKSKK
FT                   NARQSYAIPQNIKLDNKKVYASKFTEGIKTKIHRKLDKDCIIKQAFISKIADEYYIAIS
FT                   YENNKSLPKPKVIENAVGLDMGLENLIIRSDCVIYKNHKFLQDKENKLIKLQKQLSKKQ
FT                   KGSNNYAKTKLKVAKAHQKITRARDDYLHKISDEITNLYDFIAVENLNIKGLIKNKHLS
FT                   KSIANASWGKFINLLTYKAENKGKTLMQIDKFFPSSQICSNCGSNTGKKPLHIRSFTCP
FT                   NCNTKHHRDLNASINIRNYALGIIDDRYKIKLDKSRVGITQSYACKDSSSGVSKYGYIL
FT                   DTSYLSLKQEAHLL"
FT   gene            complement(234857..236299)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0257"
FT                   /note="MmgE/PrpD family protein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF03972"
FT   gene            complement(236613..236879)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0258"
FT                   /note="adenylosuccinate lyase; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            complement(237090..238253)
FT                   /gene="metC"
FT                   /locus_tag="JJD26997_0259"
FT   CDS_pept        complement(237090..238253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="JJD26997_0259"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="identified by match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44535"
FT                   /db_xref="GOA:A7H1V2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V2"
FT                   /protein_id="ABS44535.1"
FT                   /translation="MNSKTKLIHCGRGDQGAEVRSVNPTLMRASTILFKDHATWQKYRK
FT                   LRKTDRVLSYGARGTTTNFELEKLICTLEGGYRAQLFPTGLAALAMVLLNYASKDVHFL
FT                   ITDAIYGPVRTICELFLDKMGVEIDFLKADASDVEEKIKPNTKLILCESPGSILYEIID
FT                   LPKLCKIAHAHNIPVAIDNTYSSGYFLNPLELGVDISVIAATKYLSGHSDVTMGIVVIN
FT                   EKEWKNFDKLPEALGFTTSPDDAYLVLRGMRTLDVRMKAHEKSADEIVEFLQSRKEIKT
FT                   IFYPKLKSHPNHEIFMRDHKGVNGMITIEFAEGYNKDDAIKFVDKLEYFSIGASWGGYE
FT                   SLATVTTPPRTATDLSARGPFVRFHIGLEDTKDLIADLTQAFDGIKK"
FT   gene            complement(238333..239705)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0261"
FT                   /note="cryptic C4-dicarboxylate transporter DcuD; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(239709..240071)
FT                   /locus_tag="JJD26997_0262"
FT   CDS_pept        complement(239709..240071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0262"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43192"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V3"
FT                   /protein_id="ABS43192.1"
FT                   /translation="MSNYPKAIGPYSAYREANGLLFISGQLPINPASGEIESSDIKEQT
FT                   KQSLKNIGAILEENGISYDKVIKTTCFLADINDFVTFNEIYAEFFKAPYPARSAFAVKD
FT                   LPKKAKVEIEIIAQKG"
FT   gene            240239..240895
FT                   /locus_tag="JJD26997_0263"
FT   CDS_pept        240239..240895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08348"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44170"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V4"
FT                   /protein_id="ABS44170.1"
FT                   /translation="MDEVQKQQFIKLTYFLREVLGEKYEIVFHVITEDGAYIAAIANNH
FT                   ISGRSLDSPLTAFASELIQNKKYLEKDFLCDYKALAGKSKLIRGSTFFIKNHDKLVGIL
FT                   CINHDTSIMRDLICKMIDLEKIGDMGEILGNISFSQNDSSIETLSHSIEDILVQSVDSS
FT                   YLNSDYQLSINQKEEIAEKLYEKGIFNIKGAVPIVAKFLKISEPSVYRYLKKFKK"
FT   gene            complement(240896..241366)
FT                   /locus_tag="JJD26997_0264"
FT   CDS_pept        complement(240896..241366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0264"
FT                   /product="ankyrin repeat protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43399"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V5"
FT                   /protein_id="ABS43399.1"
FT                   /translation="MTTLSLEEEKRFEELCKMAFNFARNNECENLKIMIEAGLNVNLKT
FT                   HKGDSLLMLAAYNNSYESAKMLLEKGAKVDEKNDRGQTPLAGVCFKGYLPMCELLVKYG
FT                   ANIDENNSLGMTPYTFAIMFGRKDVAEFLLKKSKNNFLKKMSLKILKFIKKF"
FT   gene            complement(241423..242847)
FT                   /gene="katA"
FT                   /locus_tag="JJD26997_0265"
FT   CDS_pept        complement(241423..242847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="JJD26997_0265"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by match to protein family HMM PF00199"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44256"
FT                   /db_xref="GOA:A7H1V6"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V6"
FT                   /protein_id="ABS44256.1"
FT                   /translation="MKKLTNDFGNIIADNQNSLSAGAKGPLLMQDYLLLEKLAHQNRER
FT                   IPERTVHAKGSGAYGEIEITADLSAYTKAKIFQKGEITPLFLRFSTVAGEAGAADAERD
FT                   VRGFAIKFYTKEGNWDLVGNNTPTFFIRDAYKFPDFIHTQKRDPRTHLRSNNAAWDFWS
FT                   LCPESLHQVTILMSDRGIPASYRHMHGFGSHTYSFINDKNERFWVKFHFKTQQGIKNLT
FT                   NQEAAELIAKDRESHQRDLYNAIENKDFPKWKVQVQILAEKDIEKLGFNPFDLTKIWPH
FT                   SLVPLMDIGEMILNKNPQNYFNEVEQAAFSPSNIVPGIGFSPDKMLQARIFSYPDAQRY
FT                   RIGTNYHLLPVNRAKSEVNTYNVAGAMNFDSYKNDAAYYEPNSYDNSPKENKSYLEPDL
FT                   VLEGVAQRYAPLDNDFYTQPRALFNLMNDDQKTQLFHNIAASMEGVDEKIITRTLEHFE
FT                   KISPDYAKGIKKALEK"
FT   gene            243018..243332
FT                   /locus_tag="JJD26997_0266"
FT   CDS_pept        243018..243332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43320"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V7"
FT                   /protein_id="ABS43320.1"
FT                   /translation="MSVLVIGADEITPIRAVLHDLGAKKIEHWDARNENRVNRKPIPCD
FT                   TECIVMLTSFLNHNTMKKIKNEAKKRKIPLVCAKRSVSCVYCEYCKIFNLNKEFSCYKG
FT                   "
FT   gene            243335..244030
FT                   /locus_tag="JJD26997_0267"
FT   CDS_pept        243335..244030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44036"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V8"
FT                   /protein_id="ABS44036.1"
FT                   /translation="MLFGFDDKQEFIPQIYRYLNKQELMLTFLTQYNASVDSALKIPVS
FT                   YAKNTKSLKMIFGNFLHDIMHVSFSKIQNINIKLNAYAFYFQKRKSLIFNTKISKNVDL
FT                   LKLLRIYLYGICFDAQILFSSYVYDKVSFQNNGKNIDQDGDLIIIDKKFAILPLCKEIN
FT                   THNLKIENEIHGLLNLIKENNFEKIYIVCPRNKNFTHFIEIKHFLCDLNKTMLKLVPYK
FT                   ISNQIIRRK"
FT   gene            244030..244521
FT                   /gene="fldA"
FT                   /locus_tag="JJD26997_0268"
FT   CDS_pept        244030..244521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="JJD26997_0268"
FT                   /product="flavodoxin"
FT                   /note="identified by match to protein family HMM PF00258;
FT                   match to protein family HMM TIGR01752"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43864"
FT                   /db_xref="GOA:A7H1V9"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1V9"
FT                   /protein_id="ABS43864.1"
FT                   /translation="MSVAVIYGSAMGNTEGAANTIASKLGISDVFNISDIDAAKINSYD
FT                   KLICGTSTWGSGDLQDDWDGFDFSGLSLGGKTIAVFGMGDSESYSDTFCGGMGKLAQNL
FT                   KDAGANLVGEVSTDGYTFETSDAVVDGKFVGLALDNDNQEDQTESRIDAWVEQIKPYFA
FT                   "
FT   gene            complement(244566..245046)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0270"
FT                   /note="putative lipoprotein; this region contains one or
FT                   more premature stops and/or frameshifts"
FT   gene            complement(245097..245807)
FT                   /locus_tag="JJD26997_0271"
FT   CDS_pept        complement(245097..245807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44053"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W0"
FT                   /protein_id="ABS44053.1"
FT                   /translation="MKKLSLILACSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQ
FT                   KVGNTGFESVIVSVELNGQKQENILFTKDSLITPDLINLKTGISYAQEYEMKKFQEARE
FT                   NFTKNAKAVAQKETMVIALGDKNKPAIYVFSDPECPYCREHLAQIDDELKNYQVNYILT
FT                   PVHGKSAFEKSALIYKKAKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEK
FT                   YRSLGLSATPTIIK"
FT   gene            complement(245856..247661)
FT                   /gene="selB"
FT                   /locus_tag="JJD26997_0272"
FT   CDS_pept        complement(245856..247661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="JJD26997_0272"
FT                   /product="selenocysteine-specific elongation factor"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00475"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43571"
FT                   /db_xref="GOA:A7H1W1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W1"
FT                   /protein_id="ABS43571.1"
FT                   /translation="MKSVIIGTAGHIDHGKTSLIKALNGFEGDSLKEEQERRITINLSF
FT                   SNLKLKDKNISFIDVPGHKDLVKTMVSGAFGFSVCLFVVDINEGLKEQSLEHLEILKIL
FT                   DIKNIILVLSKCDLCENIEQKSAKILKELKNLDYPILKVFHTSIKNNQGIEELKNYLYT
FT                   IENKENDGELIFHYYIDRVFSLKGIGTVVTGSLNEGSITLNEKIICLDTQKELIVKNIQ
FT                   NHDTNLEQIKACNRVALSLNCDYKELKKGYLLSKKGYFKAFKECDALVRAKNLQNSKMI
FT                   FCVGSRQIECKINILKNLENDEFFVHFSFDKNVFLSFDETFILLQNNRVIGGGKVLNPL
FT                   SEPLKKEQKNKFLMFLKNKDFKAAFSFLKYTHKYGFGLLSSYQRFKLSHQKALELAKEL
FT                   NQVFVDEKNLNVYHLQSLEEIKNFIKFILEKNPYAMLSAHSLALRITWASKNFCELGLK
FT                   EMSNLLDFQNGIYFKKGIDFEKLQEKNNNQLYEILKKQGIKPEAPYNLYDFLELDRKSG
FT                   DNILKKLTQKGLVVRLSHNLFIEKQALEKLMQECLNLLKNQSLDVQSMKGYFNLSRKYA
FT                   ITYLEYLDKFPQVSKEAEKRFLINI"
FT   gene            complement(247658..248980)
FT                   /gene="selA"
FT                   /locus_tag="JJD26997_0273"
FT   CDS_pept        complement(247658..248980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="JJD26997_0273"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="identified by match to protein family HMM PF03841;
FT                   match to protein family HMM TIGR00474"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44336"
FT                   /db_xref="GOA:A7H1W2"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1W2"
FT                   /protein_id="ABS44336.1"
FT                   /translation="MNKFRTFPQINTLIQDESLKSYPFYIKAFFCKKVVAKLKENFSRD
FT                   EISKDKLLLEIKKEIKTFYRKDLQSVINASGVVIHTNLGRSVIHEELYEACKDIICNYS
FT                   NVEFDLENGKRGSRYALVLEKLKMLFECEDALVVNNNAAAVFLVLNSLCYDKEVISSRG
FT                   ELVEIGGSFRVPEVIKAAGVKLCEVGTSNKTHLKDYEQAINENTALILKTHKSNFALMG
FT                   FHSEVNIKDLHELVKEKGLLSYYDLGSGWCENLNEKLIKNEPKIKKLVQECDILSFSGD
FT                   KLFGSVQAGIILGKKELIGKLKQNQLLRMLRVDKLTLSFLNESLKAYLQKDYEKIITLK
FT                   LLNDDLSFIEEKALRVQKELKFQTQLKKSKSLVGGGSMPDKSLDTYILTFQGDALKLQT
FT                   RFRKENIIGRIENDEFVLDFRTIRENELQKLILKINQMENL"
FT   gene            249058..250731
FT                   /locus_tag="JJD26997_0275"
FT   CDS_pept        249058..250731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0275"
FT                   /product="iron-sulfur cluster-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44577"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W3"
FT                   /protein_id="ABS44577.1"
FT                   /translation="MQDFIYIKNDVLIPLPDAIEILDQANDKEALICNDKNQKAQIYAP
FT                   EINFYLKNSQDEILEQSKNVLTLYEARASVYDLGLDLEQSKEVQNRLILVDSDTQTVEF
FT                   LKEHGFKVIALSSAEILAVFGSVGELCAVVKNQGEEVEIDFDFLLFKAEDLSVVRKDFT
FT                   RQSGCYNLLNFENLEALLEFLQSKSPKYPYKTYISYNASVCQYHERRSEHCAKCAEICP
FT                   TVAILKDDENKHLEFSQVDCLGCGGCISVCPSGSLDYAPMPRESFFTLCEFYKDKKILI
FT                   IPKKMSLENLNLALPKDVLPFMIEGEKWLSSMHFLTLLQNSGANLVFYTDFVSRGSNEA
FT                   IVLLNTFFERKFQKKAIFVAKDEKELQNVLKEQEFIQDLKYDFHNNILTTRENFAKRMQ
FT                   EMIKNEDFGSIESGEWLRYGKVEINPNTCTLCLSCVGACNVGALIADTKENALKFNASL
FT                   CTTCGYCELSCAEKDTLKLFRSGMEFRASYFEYQTMAKDELFACIECGKEFATKKAVEK
FT                   IANLMKPKFGNDENKIKTLYCCADCKAKVMIKAMGFAGQN"
FT   gene            complement(250728..252029)
FT                   /locus_tag="JJD26997_0274"
FT   CDS_pept        complement(250728..252029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0274"
FT                   /product="putative multidrug resistance efflux transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44653"
FT                   /db_xref="GOA:A7H1W4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W4"
FT                   /protein_id="ABS44653.1"
FT                   /translation="MLNNVLPLSFIVGTRFFGLFIVLPVLSLYALKLEGVNEFLVGLLV
FT                   GVYALTQMILQMPFGILSDKIGRKKTMLIGLIIFIIGSLICSFAENIYTMLLGRMLQGA
FT                   GAIGAVATAMISDFITEENRGKAMAVMGSFIGLSFAASMVISPLMSAKWGLSSLFDLSA
FT                   ALSLLCIILLYTVVPKENKITHENEKTPFFHFIKQKNLALMNLTNFMQKMLMSIAFLSI
FT                   PIILVKHLGFAFDKLWIVYSASMVAGFIAMGFAGSLGEKRGLAKQILLLGIVFFILAYL
FT                   FFAFSNSIDFFIIAVVIFFIGFNLHEPIMQSCASKFCKVHEKGAALGLFNAFGYGGSFI
FT                   GGIIGGMFLHLNALNLLAIILVVLALIWLVALFFLKNPADFKNLYLPLETPLNFSTFSE
FT                   NLGVVDIYKNSKNLVVKFDSKLTNKEELEGKIKI"
FT   gene            252195..252797
FT                   /locus_tag="JJD26997_0276"
FT   CDS_pept        252195..252797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0276"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43590"
FT                   /db_xref="GOA:A7H1W5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1W5"
FT                   /protein_id="ABS43590.1"
FT                   /translation="MKIILATSNKHKVLELKEILKDFEIYAFDEVLTPFEIEENGKTFK
FT                   ENALIKARAVFNALDEKQKKDFIALSDDSGICVDVLEGNPGIYSARFSGKGDDKSNRDK
FT                   LVNEMIKKGFNQSRAHYVAAIAMVGLMGEFSTHGTMYGKVIDTEKGENGFGYDSLFIPK
FT                   GFDKTLAQLSVDEKNNISHRFKALELAKIILKILTKG"
FT   gene            complement(252829..255300)
FT                   /locus_tag="JJD26997_0277"
FT   CDS_pept        complement(252829..255300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0277"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44703"
FT                   /db_xref="GOA:A7H1W6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W6"
FT                   /protein_id="ABS44703.1"
FT                   /translation="MFAKLLKFFISHPKSTFFGTLFICLFLSFFAFKLSVDASAESLLL
FT                   EDDADLKTFREISKHYKSDNFLLLAFKPYDEKPFSNENLAKLKKLHEELEKSPLVERVF
FT                   SIINAPLLQSSQNTDLKELLKNIPNIESQDINRTKAQNEILNSPFYKNNIISKDGKVTG
FT                   LIIYLKPDTVYNNLVEKRDLATDEKEKDQIRLAIKKHQDKQKVITKQSLDTIKNIVRNY
FT                   EKNKDTLYLGGVSMIADDMIAYIKSDLVLYGVSLVFLLGLALYYFFRSWRFVFLPLFIC
FT                   FISLSAASGVFALLNFQITVISSNYVALVLIITLSVVVHLITHFIESTQNHPKAKIERI
FT                   VLQTLLAKANPSLYAIVTTMIGFFSLIFSNIEPIIKLGIMMSIGIGLALIFSYLFLASI
FT                   LVLLKPKNYHKKEFKFNLLAFCAKTALDPKKRRMIYGISVLAIILALIGISKLRVENSF
FT                   VNYFKDGSEIKKGLLVIDKNLGGTLPLEVIIRFPNNKNDQNTSDTLDSFESEFENLATQ
FT                   ETYWFDSKKTRIAKKVHEFLENKEFVGSVLSLNSLLTLGKNINDGKELDDFALAFLNEN
FT                   LPAKFKQDLLSPFVSIENNELRFSMRIVDSDPNLRRNKFLIDLKKQLNELVKNDGVEVQ
FT                   ITGIMVLYNNMLQSLFSSQFDTLIFVILAIFILFIIVFRDLKFSVVAILVNVIPLSVVF
FT                   ALMGLLGIPLDMMSITIAAIAIGIGVDDAIHYIYRFREEIKNKSLEEAIMISHLSIGSA
FT                   LYYTTISIVLGFSVMMSSNFIPTIYFGILTVFVMILLLNGSLFLLPSFLITIYSKKAKF
FT                   PNQHKEHILKQ"
FT   gene            complement(255300..255869)
FT                   /locus_tag="JJD26997_0278"
FT   CDS_pept        complement(255300..255869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0278"
FT                   /product="putative toluene tolerance protein"
FT                   /note="identified by match to protein family HMM PF05494"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43979"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W7"
FT                   /protein_id="ABS43979.1"
FT                   /translation="MKKIFLILALFFNAFALQLDEISSTMQKNIDASLKLLQDSKEDKK
FT                   QAADGIFKLFDSIIDYKLMAKLSLSKNYSKLNSKEQEKFTTAFEASLKKSFTDKLSLYK
FT                   YQVLKVKNGELKNEKRYFLTTSMVVDGEEKNIIFKFYNNNNNWLIYDVDVLGVSIVQTY
FT                   RSQFGDILANQGFDALLQKLESIVIE"
FT   gene            complement(255869..256579)
FT                   /locus_tag="JJD26997_0279"
FT   CDS_pept        complement(255869..256579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0279"
FT                   /product="lipoprotein, VacJ family"
FT                   /note="identified by match to protein family HMM PF04333"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44654"
FT                   /db_xref="GOA:A7H1W8"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W8"
FT                   /protein_id="ABS44654.1"
FT                   /translation="MRIKFISFILIFFTIFAFAKEQNLDDFEQEYQNYQVNDPLSGYNK
FT                   VMTSFNVTLYDYGLRPMLKGYNAITPEFIRLGVRNLFDNLLAPLRFVGNVLQFKFEEAG
FT                   EEFKRFTANTIMGFSGLMDVASKMGLKKHPADLGTVLAYWGVGSGFHIVLPILGPSNLR
FT                   DTLALPATWYASFTAYIDPTWASIAISAYGFGNELSFRLDEIDEIYHNTPNLYPFLRDA
FT                   YEQRRNELSANKGK"
FT   gene            complement(256624..257064)
FT                   /locus_tag="JJD26997_0280"
FT   CDS_pept        complement(256624..257064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0280"
FT                   /product="putative nucleotide phosphoribosyltransferase"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43350"
FT                   /db_xref="GOA:A7H1W9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1W9"
FT                   /protein_id="ABS43350.1"
FT                   /translation="MIFYSYEEFKEDVKILAKEIKKDFNPDALLAIARGGMSLGHSLAV
FT                   ALKTRQLFALNSIHYDTKKLDTIEIFNIPDLSKHKKILLIDDIVDSGESLAEIKKVVLE
FT                   KFPHIELKIATIFYKKTALLEPDFKVKEATEWVDFYWDINLD"
FT   gene            complement(257078..258397)
FT                   /locus_tag="JJD26997_0281"
FT   CDS_pept        complement(257078..258397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0281"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44580"
FT                   /db_xref="GOA:A7H1X0"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X0"
FT                   /protein_id="ABS44580.1"
FT                   /translation="MDFFKLKENNTSFKTEVIAGLTTFLAMVYIIPVNSSIVGNTGMPI
FT                   EALITATALITIVASAFNAFFANTPVAMSVGMGLNAYFTFAVCLGQNIAWQSALGAVFI
FT                   SSIIFLILSFTHFRLWVIRNIPKDLRLAICAGIGCFIAFLGLSQMGVIMHNKDTLVSIG
FT                   NFKSPHVLFGIFTLALIIFFWAIKLRGAFILGVLASSIIAWIFHLDNASFPVQIFSLPN
FT                   FSMENGLGAIFLQLDIKSALNITMIPIILTFFITQLFDSIGTITGVGERGKIFDDPKNG
FT                   EKKLSKTLMADATGSALGAITGTSTVTAFVESTTGVESGGRTGLTALVVAICFAFTLFL
FT                   LPLFKAIPANAIYPVLVMVGILMFMEVKNIDFKDSAIAVASFFTIIMMPFTYSITTGFA
FT                   FGFLSYLLVRIFKREWDKINLGIIVLSLLSLGNFLLMALQ"
FT   gene            complement(258406..259470)
FT                   /locus_tag="JJD26997_0282"
FT   CDS_pept        complement(258406..259470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00423"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44280"
FT                   /db_xref="GOA:A7H1X1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X1"
FT                   /protein_id="ABS44280.1"
FT                   /translation="MKNLITKLENEERLNQEEANALWDLDLFTLGKYAHKKRTKLHGKK
FT                   VYFNINRHINPTNICADTCKFCAFSAHRKNPNPYLMTHEEIMKIVDETVKRETKEVHIV
FT                   SAHNKDTTWQWYLEIFKMIKEKYPNLHVKAMTAAEIDFLHRRFKMSYEEVIEKMLEYGV
FT                   DSMPGGGAEIFDEEVRKKICHGKVSSENWLNIHKLWHEKGKQSNATMLFGHIEERHHRI
FT                   DHMLRLRDLQDKTNGFNAFIPLVWQRDNSFIQTDKIMDSEEILKTIAIARLVLDNIKNI
FT                   KAYWATMTLNLAMVAQEFGANDLDGTIEKESIQSAGGAKSAKGTGLKTFIDMIKTSNLI
FT                   PVERDSLYNELKTY"
FT   gene            259599..261947
FT                   /locus_tag="JJD26997_0283"
FT   CDS_pept        259599..261947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0283"
FT                   /product="GlnD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43520"
FT                   /db_xref="GOA:A7H1X2"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X2"
FT                   /protein_id="ABS43520.1"
FT                   /translation="MLNKELEIFKKNLSSYTQSCRKFFLKQGAFSLYHSKNMDNFIKKA
FT                   YDIVLKDYFDDFSPPSDNIPFCVLASKAYANNSLCFNESISLIFVYKDIKAFHLKPMIK
FT                   AFIEILNDAHLQIDSVILEFNGLYNASNELKTSIIQTRFICGSRILFKGIKTKFESILK
FT                   ENKNDFAKLLLENFKEFDIPFIKQEFNILKDFGGLNHLRSLESLLVLFKTSPKNYALNF
FT                   IDEKNLSELRLAGDFLLSLKSAMNLLSAKDEDEFLLINVHDLSELMYKKAKKHFGANEL
FT                   LVQKALQSMHTIGFYTHFLAKQIQDGLNHTLKQEYKFKTLVEVLEYLLKLEDKQVIFDL
FT                   HLVFSLRRLKYGKKDIEKALILFEKIFYKRHSFCVLKLLLDSGILKDLCKPFWTVRFLS
FT                   DEEGNYSFDEQVFLMLSEFEKYEDELEILQKLKTDEKMILKLVILLSAIESENEISLAG
FT                   IYRAYCSKFDLKNEILEWGLKIFKNNNALKDLVEKEDIYNPIVVSSLVSKLENLENLEL
FT                   LYTLTWLKAKALNYNAFYFRVLDKLLENAKQGFEDENLLEESARRVKKELTLKRSKIFL
FT                   EQDEILQDKIIHIKSNLFIIKNTFEDIVMISKLAKENDFKFWFSNETNLSLQIVAPLHF
FT                   NIAIILSSLTNLNLIFMNFFELFDDKIYLRFEYDNIISDEQKLKLCELLNSNLSGFNLK
FT                   KIKKPIIKKDELKLDLNYSKMYAKLGLNTKDQQGLMAYLMNVFNELELVLCAAKIQTIR
FT                   QRTRNIFIFQKNEKLEHSEQKLVNLLISE"
FT   gene            261951..263747
FT                   /gene="glmS"
FT                   /locus_tag="JJD26997_0284"
FT   CDS_pept        261951..263747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="JJD26997_0284"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44163"
FT                   /db_xref="GOA:A7H1X3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X3"
FT                   /protein_id="ABS44163.1"
FT                   /translation="MCGIVGYIGNNEKKQIILNGLKELEYRGYDSAGMAVMQEGELSFF
FT                   KAVGKLENLANKCSDFESQGYGFAVGHTRWATHGKPTEINAHPHLGQYSCVIHNGIIEN
FT                   YKEIKDKLEKEGVSFLSQTDTEVIVQLFEFYARNLGVFEAWQKTIKELRGAFATLLVTK
FT                   KDPNHVYFAKNAAPLIIGKNANKEWYFSSGDAPLIGSCDEVMYLEDLSLGYASKDELVI
FT                   YENDILKSLCFFKLSGDKAYAKKDGFRFFVEKEIYEQSRVMSEVLMGRIQGDEVVFDEL
FT                   NNEDLSQVDEITLCACGTSYHAAMASAYLFERIAKVKVKVEIASEFRYREAIIKKDSLF
FT                   IVISQSGETADTLEALKIAKEQGAKTFAICNVDNSNIVRLAHLSLLTRAGIEKGVASTK
FT                   AFATQVLTLWMLAIFMAQKRNLNVSAEIKALLHTPNCVSVKQALHEKIHRLSKRYLDGH
FT                   GFFFIGRDVFYPLALEGALKLKELSYFHAEGYPAGEMKHGPIALADSKLYTIALMPKHM
FT                   LYEKTKSNVEELIARDSTVLSISPLEFDLSDDFIKTNEQDHYMCEFFEMMVITQLLAME
FT                   ISIRLGNDVDMPRNLAKSVTVE"
FT   gene            263881..265272
FT                   /gene="fumC"
FT                   /locus_tag="JJD26997_0285"
FT   CDS_pept        263881..265272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="JJD26997_0285"
FT                   /product="fumarate hydratase, class II"
FT                   /EC_number="4.2.1.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00979"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44783"
FT                   /db_xref="GOA:A7H1X4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X4"
FT                   /protein_id="ABS44783.1"
FT                   /translation="MEYRVEHDTMGEVKVPNDKYWGAQTERSFENFKIGCEKMPKVLIY
FT                   AFANLKKSLALVNNKLGKLDDAKKNAIVQACDEIIAGEFDDNFPLAIWQTGSGTQSNMN
FT                   MNEVIANRATEIMGGNFRKEKLVHPNDHVNMSQSSNDTFPTAMSIVAVDQVEKKLIPVL
FT                   DELIATFEKKVKEFDGIIKIGRTHLQDATPLTLAQEFSGYLSMLLHSKEQIIASLPTLR
FT                   ELAIGGTAVGTGLNAHPELSQKVSEELTQLIGTKFVSSPNKFHALTSHDAINFTHGAMK
FT                   GLAANLMKIANDIRWLASGPRCGLGELIIPENEPGSSIMPGKVNPTQCEALTMVAVQVM
FT                   GNDAAIGFAASQGNFELNVFKPVIIYNFLQSLDLLADSMHSFNIHCAVGIEPNRAKIDH
FT                   NLHNSLMLVTALNPHIGYENAAKVAKNAHKKGISLKESAMELGLVSEEDFNKFVDPTKM
FT                   IGPKA"
FT   gene            complement(265302..266345)
FT                   /locus_tag="JJD26997_0286"
FT   CDS_pept        complement(265302..266345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0286"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44236"
FT                   /db_xref="GOA:A7H1X5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X5"
FT                   /protein_id="ABS44236.1"
FT                   /translation="MQNGKFFLISFILVILFLLLYLFKGFLLVIIIASLMAVATSNINA
FT                   KFLNLTKGHKFLASILTTACMVLLFFAPFVYGMIELAKALKNFDINLVTQTLDYVKNYQ
FT                   FTLPESFNFLEPKIKEFLASIDLNSISKQILSYASNFTKSGAKFLVDMVLICVFYFFAN
FT                   LYGTELVIYLKSIVPIDKKELDDVLSEVGNVMAVVLYSMVIVAIFQGALFGLITMFYGY
FT                   DGILMGVIFAVSSLIPAIGGALIYVPVSLYEFASNNLNSALVIFIYSVIIISFIADTLI
FT                   KPLIIKWINKKLVKTPTKINELLIFLAMIAGISTFGFWGIILGPAILTFFVSTLRMYVI
FT                   LKDKNLI"
FT   gene            complement(266349..267356)
FT                   /gene="ruvB"
FT                   /locus_tag="JJD26997_0287"
FT   CDS_pept        complement(266349..267356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="JJD26997_0287"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF05491; match to protein
FT                   family HMM PF05496; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44533"
FT                   /db_xref="GOA:A7H1X6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H1X6"
FT                   /protein_id="ABS44533.1"
FT                   /translation="MDRIVEIEKYSLDETYETSLRPSNFDGYIGQESIKKNLNIFITAA
FT                   KKRNECLDHILFSGPAGLGKTTLANIISYEMDANIKTTAAPMIEKSGDLAAILTNLSEG
FT                   DILFIDEIHRLSPAIEEVLYPAMEDYRLDIIIGSGPAAQTIKIDLPKFTLIGATTRAGM
FT                   LSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALR
FT                   LLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLAS
FT                   IAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASTKSYSALKLNYEKTLFEE"
FT   gene            267406..267858
FT                   /locus_tag="JJD26997_0288"
FT   CDS_pept        267406..267858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44348"
FT                   /db_xref="GOA:A7H1X7"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X7"
FT                   /protein_id="ABS44348.1"
FT                   /translation="MLEFILNFNNYGLKMGILTKLELDYEIDDIEKFLQFFRTMCDRFE
FT                   PLIIKLGSDSVRYKEAIKELETLAHNTAWAARRLNLKEVTDFCVFCEEMMAQANRFNGP
FT                   ASDEFTDWMLLMSDQFEKYCRSYENDDSVLAVFNPLIVNVPNIISK"
FT   gene            267859..268217
FT                   /gene="ssrA"
FT                   /locus_tag="JJD26997_0290"
FT   misc_RNA        267859..268217
FT                   /gene="ssrA"
FT                   /locus_tag="JJD26997_0290"
FT                   /product="10Sa RNA (tmRNA)"
FT   gene            268399..269601
FT                   /locus_tag="JJD26997_0292"
FT   CDS_pept        268399..269601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0292"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43228"
FT                   /db_xref="GOA:A7H1X8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X8"
FT                   /protein_id="ABS43228.1"
FT                   /translation="MLTQKDIDNLEIKDKRYMISVGEPKELYVRVNPTGKKVFYLRASK
FT                   FKQFITIGECQKGILNVTNAREKAKELLKSMYDGSFVSKSEKGVTLNKANELYIEIKAK
FT                   KLSRATIKKEQLVYGKYFNSTLGDKAINDLKKDDFLPIFDLMYKKGIFETISRSISFLC
FT                   RVLEFCRQRGDLKTDIILQLKDLKKFYNEANHNKVKHFKAIVEEQEIKNMLECMKEYKN
FT                   HPRTNTTIINAIYFTLLTAQRSKNIRFAKWSDIDFKNNLWVIKADEMKVSSNGDNIIPL
FT                   NKYALKVLEIQRILNGNKEYIFTNNNGIISESFGVKFFKTYNLEHTIHGFRSTFRSICT
FT                   EKSDELIKLGIGKDIAEMILHHINGNEVTRAYDRAKAIDLRVKLMQWYGNYLNSLCGFD
FT                   F"
FT   gene            complement(269598..269768)
FT                   /locus_tag="JJD26997_0291"
FT   CDS_pept        complement(269598..269768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0291"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44185"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1X9"
FT                   /protein_id="ABS44185.1"
FT                   /translation="MIEEYMSEKDLSKFLNISLTSLWRLRKENKIPYIKIGKTIRYEKN
FT                   AIIKWLNTHSF"
FT   gene            complement(269830..270303)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0293"
FT                   /note="pentapeptide repeat family protein; this gene
FT                   contains a premature stop which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00805"
FT   gene            complement(270291..270497)
FT                   /locus_tag="JJD26997_0294"
FT   CDS_pept        complement(270291..270497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43660"
FT                   /db_xref="GOA:A7H1Y0"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y0"
FT                   /protein_id="ABS43660.1"
FT                   /translation="MKMTNIILVLLFILFFILMFFNYKYQKAQVELLEQNKKTLELNIK
FT                   ILELNIKKIELLEKRIKEIKWEF"
FT   gene            complement(270533..271306)
FT                   /locus_tag="JJD26997_0295"
FT   CDS_pept        complement(270533..271306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0295"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44638"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y1"
FT                   /protein_id="ABS44638.1"
FT                   /translation="MKTLREQIEVMEAFERGEKIQANYKLKNFEYWEDTKNPIWDWHFY
FT                   DYRVKPRVKITEKEFNLIKERLTGWKYNKDLIYENQRESFFSNAFGELRKYFRAKNDLE
FT                   KVNALCNIVVYCFNDFDINCQEILEIHGFETNKITIFDIVRDLSSITTEFHRNEIPDYT
FT                   FIHRLVFDCFNLINNLGFNFYKCMLETIKDIESHAWYYDESLGKFVEKIGAYSEREAFD
FT                   LAINDFKLTNIPNKYFLDKEDKDYWYVKIEDNNGD"
FT   gene            complement(271318..271500)
FT                   /locus_tag="JJD26997_0296"
FT   CDS_pept        complement(271318..271500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0296"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43439"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y2"
FT                   /protein_id="ABS43439.1"
FT                   /translation="MEDKKKEFGDIEVVIEASYPDSHDNYLSYNIGICKEENIVAYIND
FT                   ENKGRKIFDNCLLLF"
FT   gene            complement(271524..271919)
FT                   /locus_tag="JJD26997_0297"
FT   CDS_pept        complement(271524..271919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0297"
FT                   /product="prophage Lp1 protein 30"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44645"
FT                   /db_xref="InterPro:IPR019096"
FT                   /db_xref="InterPro:IPR023385"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y3"
FT                   /protein_id="ABS44645.1"
FT                   /translation="MKLSDFDFRIWDNGIFRYPIKINNDIVDINLDIGVNAEIELFTGL
FT                   YDKNGKKIYEGDILEYTRWCEQYMEDAEHSETIYEIVCFDIRGGLYSKLLNGECGWFFE
FT                   HFMNNKNNTIEEMSIIGNIHENKELLK"
FT   gene            complement(271996..272157)
FT                   /locus_tag="JJD26997_0298"
FT   CDS_pept        complement(271996..272157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0298"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43303"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y4"
FT                   /protein_id="ABS43303.1"
FT                   /translation="MLSQIQNNTSIQVASFYEVTKNSIAKHFLRNSDELIENIHYFYDY
FT                   EQTKGGFK"
FT   gene            complement(272570..272794)
FT                   /locus_tag="JJD26997_0299"
FT   CDS_pept        complement(272570..272794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43679"
FT                   /db_xref="GOA:A7H1Y5"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y5"
FT                   /protein_id="ABS43679.1"
FT                   /translation="MEKENIVKEVCKELNITQAELGRQLDVPASTINTWATTKIPKMAE
FT                   LALNLLIENKTLKEKLEIFKKAHKIASEL"
FT   gene            complement(272796..273020)
FT                   /locus_tag="JJD26997_0300"
FT   CDS_pept        complement(272796..273020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0300"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44508"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y6"
FT                   /protein_id="ABS44508.1"
FT                   /translation="MASIKDIKKIKIICKECESEFSMFIGHSLYICPICGNNFGINELN
FT                   DPFFRIKQAFESFTNPKNCDIELICEIKD"
FT   gene            complement(273030..273407)
FT                   /locus_tag="JJD26997_0301"
FT   CDS_pept        complement(273030..273407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44419"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y7"
FT                   /protein_id="ABS44419.1"
FT                   /translation="MSENIELFESYTAKTLGELYSTFPIPSDFNFFDFIPKLEYEEFLI
FT                   HQLNAFHTINYLKANHFLDFKSIDIENGKVEKAILKPKALELLKQDGLGVQLKKALNTG
FT                   RDELIRSIVNKALEMSLKIMF"
FT   gene            complement(273549..273809)
FT                   /locus_tag="JJD26997_0302"
FT   CDS_pept        complement(273549..273809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43378"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y8"
FT                   /protein_id="ABS43378.1"
FT                   /translation="MEVYPSNYLEIAKIIPFSERRTSFCEFARKNEIKIEKINRKNHIS
FT                   QKELKKAYKIYKSKGSGRNLFGEKKLIVKAFEDVEKFLRSE"
FT   gene            complement(273790..274479)
FT                   /locus_tag="JJD26997_0303"
FT   CDS_pept        complement(273790..274479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0303"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43210"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Y9"
FT                   /protein_id="ABS43210.1"
FT                   /translation="MLPPFKASFEVANYAPSLEYLNEGGLYSGVFRKAFLYEKIASDGG
FT                   NNTFICFEFLTAKEQKLAIFNLFVAKNNNFTYMDKNGKKENYLGFRQLNAIMKFFEIDE
FT                   LDFSQKGNENVFGVQTEVIYLNSLVNKLLVLGFGLEEYLSKNGELANKIFLDRIFNEKM
FT                   QSMDEFENNKEPLSIKSFKARYKSLNNNKSFIPKENQSYNPYGNEVKNNNNEKYIEIGE
FT                   DDGSLPF"
FT   gene            complement(274479..275213)
FT                   /locus_tag="JJD26997_0304"
FT   CDS_pept        complement(274479..275213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0304"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44736"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z0"
FT                   /protein_id="ABS44736.1"
FT                   /translation="MSNEVVLKEENKSQINFNPYELALVKGDLSKLSDVERANYVKNLC
FT                   ESLGLNMLTKPFEYIVLNGKLTLYANKSATDQLRQVRKVSITKTEVAQVGDIYMVTAYA
FT                   ATPDGRTDCDTGALNIKNLGGDNLANAIMKAITKAKRRVTLSICGLGMLDESELETIKQ
FT                   KRFLNANEDLKVWDGDEKAIENKAQEIKALGAQLRKFMSDKGLSTEEQNNFIKKHSLFT
FT                   SEKIQEVLSNKDEFLTQLKGEL"
FT   gene            complement(275210..276070)
FT                   /locus_tag="JJD26997_0305"
FT   CDS_pept        complement(275210..276070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43551"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z1"
FT                   /protein_id="ABS43551.1"
FT                   /translation="MQYKTINLEQGSPQWCDFRKGKIGASMVASCVGIKGAFHSKEQAR
FT                   DIILGLKEVHQNDAMKKGMEKEPLIRSEVEKLHSVSITPIVLQSLENEMFMASLDGIDK
FT                   NGVIYEFKYSQDEYDFVKKNKKPSDKYYAQVQFALYISAKEKCLFVAMDKKEEIVECEV
FT                   LRDEAYQEGLVENVKEFILDYIIDQKSDYKELEDTKAKNLTIEIIRLANTIKPLEEKLE
FT                   SLKKELIALANGEKARCLDITIYPQSRTKVDYKGFLEQKNITVPKEFYKESISMCLKIK
FT                   KGDEK"
FT   gene            complement(276060..276803)
FT                   /locus_tag="JJD26997_0306"
FT   CDS_pept        complement(276060..276803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0306"
FT                   /product="DNA-binding protein Roi"
FT                   /note="identified by match to protein family HMM PF03374"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44089"
FT                   /db_xref="GOA:A7H1Z2"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z2"
FT                   /protein_id="ABS44089.1"
FT                   /translation="MNLEIFKKDENKEISLTSLEIAELTGKEHRNVTRDIETYLEKVVE
FT                   GGVLKFEQCYQSPKNGQSYKCYRLPKREVLILVSGYSVELRAKIIDRLEYLENELKKQS
FT                   YKPLTHKEALELGLKLLEENEKLELENVNLKNEAKENAPLIHFANRIKDTNDAILIRDF
FT                   AKILYEKNKIEIGEKRLFAFLRDNGFLMSDNKPYQKCIEQGLFKVSETTISTIKGDRLV
FT                   STTKITGKGQIKIANLLLERMNHAV"
FT   gene            complement(276806..277486)
FT                   /locus_tag="JJD26997_0307"
FT   CDS_pept        complement(276806..277486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0307"
FT                   /product="putative phage anti-repressor protein"
FT                   /note="identified by match to protein family HMM PF08346"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43419"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z3"
FT                   /protein_id="ABS43419.1"
FT                   /translation="MQLQLTFPHTELQGAFPANVENLFCYLEVNSKFADWIKNRINQYD
FT                   FIENQDYIIKEVFTGRRPRKEYYVTLDMAKELCMVENNEKGRQARRYFIDCEKRLKNLE
FT                   AEQMQKLAFRQSLGYKSQLAQQKEHYENKIKALQYDLEHKNELSFKRKLSQKEFLELRK
FT                   ILAKDYGMLCIKEWEFEFLAEKIALESSKMTTWDAVVKKLKQSLDYWQNYDEYEEKWKK
FT                   ILRR"
FT   gene            complement(277632..277787)
FT                   /locus_tag="JJD26997_0308"
FT   CDS_pept        complement(277632..277787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44164"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z4"
FT                   /protein_id="ABS44164.1"
FT                   /translation="MAEEKENKGSNIVQIRLSDKQKDELQKKADEVGLPLTQYIIFLIT
FT                   KDLKAL"
FT   gene            complement(277798..278091)
FT                   /locus_tag="JJD26997_0309"
FT   CDS_pept        complement(277798..278091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44263"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z5"
FT                   /protein_id="ABS44263.1"
FT                   /translation="MQNIGGFKALSKELITKLLNEFPKKSILFYDDFIKECEIYKIDFV
FT                   SCIYFLKECKVLKYDKENNGDFSGVLISPKAYLYFSKNDLKDIDDLIEFCIK"
FT   gene            complement(278101..278955)
FT                   /locus_tag="JJD26997_0310"
FT   CDS_pept        complement(278101..278955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43203"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z6"
FT                   /protein_id="ABS43203.1"
FT                   /translation="MTEENMSEQTYELRFEYFNEENATLFFQKITDFLLSIDKLNNSLV
FT                   SVFGIEIDINIQIKSIEKGSIRIWIAEKLSKISDDDIKHYVNNPRELLADLLIKSKKMI
FT                   LEKIQDKKCQDIPKEYKNIIEKSNLKDFGYNNNETNLLTCVSELTHKAKEFKHKPMIIF
FT                   EEKVYGISETFDYNPKTADGVKEQISKMQGAFIIKKPDLTGESKWEIIHDKIIKVKIND
FT                   ENFKNKLKNRTIKLSYGDMIEGSLICKTYISKDLEVLENEYFLEDIKGIIEPSYTQEKN
FT                   LFK"
FT   gene            complement(278992..279252)
FT                   /locus_tag="JJD26997_0311"
FT   CDS_pept        complement(278992..279252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44386"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z7"
FT                   /protein_id="ABS44386.1"
FT                   /translation="MFLNSKKNEKIRYLEKEIQRLKGVIALKDTAINEISLKLEEEIKT
FT                   NGKLSNFRIKMLDALGLIGVFKNDDKAIKEVKKLKEKELNL"
FT   gene            complement(279243..279512)
FT                   /locus_tag="JJD26997_0312"
FT   CDS_pept        complement(279243..279512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43391"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z8"
FT                   /protein_id="ABS43391.1"
FT                   /translation="MKAYHTKEKVIIKLSKEEYRKEMKLNKSLKDENKSLKTEIFNLEN
FT                   EKIELLKELKDQIEANMNNIKEIKSLQNKIYELLYAKERSKLCS"
FT   gene            complement(279760..279930)
FT                   /locus_tag="JJD26997_0313"
FT   CDS_pept        complement(279760..279930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44539"
FT                   /db_xref="UniProtKB/TrEMBL:A7H1Z9"
FT                   /protein_id="ABS44539.1"
FT                   /translation="MPRLADLLGFIKNKNKFDKITLFKWLISLGGEGAVFNDRKDFKYY
FT                   FLVIENSKKVD"
FT   gene            complement(280342..280614)
FT                   /locus_tag="JJD26997_0314"
FT   CDS_pept        complement(280342..280614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43625"
FT                   /db_xref="UniProtKB/TrEMBL:A7H200"
FT                   /protein_id="ABS43625.1"
FT                   /translation="MSFTDLYFDREEKRIYNQTKELIANEFESKENLENIFANLQDFKN
FT                   SLEISLEDDEDIATSLQAYGDEFINDVHDLLKKLRKFEKKYKKLF"
FT   gene            280765..280890
FT                   /locus_tag="JJD26997_0315"
FT   CDS_pept        280765..280890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44008"
FT                   /db_xref="UniProtKB/TrEMBL:A7H201"
FT                   /protein_id="ABS44008.1"
FT                   /translation="MTLTIENAIKVIKAMAKPFNAKVRVKKPNLEKELLNDEKEF"
FT   gene            complement(281220..281954)
FT                   /locus_tag="JJD26997_0316"
FT   CDS_pept        complement(281220..281954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0316"
FT                   /product="putative phage repressor protein"
FT                   /note="identified by match to protein family HMM PF00717"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43412"
FT                   /db_xref="GOA:A7H202"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A7H202"
FT                   /protein_id="ABS43412.1"
FT                   /translation="MGRNGDIFDFHFNTEKFKFYLKNRDKKVTYQDLMEILYKNGIESS
FT                   EATIKKWLMSKEDNKTKPKPQYIKILCNALDIPFNEVILQDVFRNDNQVDFRYFPDIYA
FT                   SAGFGTSSQSEEVKIVSVDENFLKEILDIPIKKSYDIIKINGDSMEPILSNGDFIIVDR
FT                   SKNSLGAISNADIVIFRKNDDLFCKKIKKEPFEDYIFLVSENKKYEDRKVDNVEFEQCE
FT                   ILGAVVSKMKIETFKNFIEVVG"
FT   gene            282064..282282
FT                   /locus_tag="JJD26997_0317"
FT   CDS_pept        282064..282282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0317"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44474"
FT                   /db_xref="UniProtKB/TrEMBL:A7H203"
FT                   /protein_id="ABS44474.1"
FT                   /translation="MNKIDFFDFTKILSNHYTVISVKKIRTNKSRPSFKKQIEFKKLYG
FT                   IPHEFWVDVRSNLTNIPKRGRKRKDRE"
FT   gene            282279..282467
FT                   /locus_tag="JJD26997_0319"
FT   CDS_pept        282279..282467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0319"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44720"
FT                   /db_xref="UniProtKB/TrEMBL:A7H204"
FT                   /protein_id="ABS44720.1"
FT                   /translation="MKVIELKVKMPDEYFELLQSVANDGGFNSINELIVDKIAHFIKLE
FT                   KYYQELDKKDILSLDKT"
FT   gene            complement(282464..282613)
FT                   /locus_tag="JJD26997_0318"
FT   CDS_pept        complement(282464..282613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0318"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43946"
FT                   /db_xref="UniProtKB/TrEMBL:A7H205"
FT                   /protein_id="ABS43946.1"
FT                   /translation="MDDKDLNLLKNIPYLMEKIKELENRIKQLEQAQQPQHYSLETPNY
FT                   LGEI"
FT   gene            282768..283982
FT                   /locus_tag="JJD26997_0320"
FT   CDS_pept        282768..283982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44033"
FT                   /db_xref="UniProtKB/TrEMBL:A7H206"
FT                   /protein_id="ABS44033.1"
FT                   /translation="MIPHFIASFEVANYTRKSLRQRKGYLKLSNTIAYGGLSVDALALY
FT                   IQLAKLSEKTIVSEIYLREFIKVKNNQRMSLNRLRMAKKELIELRLLEIKKLRKGSLNF
FT                   YEWILKDENYQIKKHFNQALTLLKSSDEKLSKTLKNNASSIDRKLTPENEKNQNSLYIE
FT                   TRTHARDNKFINNINNINNINNINNINNINNINNKEFIKKENLENLKNKETKEKENCVF
FT                   DKTPSFIVDFNKLDKEDLELMANKLNNKQALKAKAIKAYKERNITNFSLEDWILWVDYK
FT                   LEKEKAPTMATFNHNLNQLVSFGMSAKESISNSISSGWKGLFEVKAQSGFKKYDKNIKF
FT                   DFERDEKKMAEFEDMLDRVYGKSDGKREIDLDKMVGGNDDSLSWADMFNYKDKHTHLID
FT                   VEVLD"
FT   gene            283994..284644
FT                   /locus_tag="JJD26997_0321"
FT   CDS_pept        283994..284644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43328"
FT                   /db_xref="UniProtKB/TrEMBL:A7H207"
FT                   /protein_id="ABS43328.1"
FT                   /translation="MTKLELIEALFGLSKTQANIAEKRYFNNFNEAKINDFYDFFVETC
FT                   NNENIVGDNFFKLTSVFKIAELEFKKRFEDKESFLLWLTNKYKNRAFFRVFAGEFEYQY
FT                   FAYDSFGKRYEMTNKSIDMLVCLNQFKELTYQNGDLIENGVFKEALVDFIFKNQHRIGK
FT                   DIHLAITPAKIERVLTLDEMRELEKAEEKRLLNENKSRFEKILKSKMAFRNIS"
FT   gene            284715..285104
FT                   /locus_tag="JJD26997_0322"
FT   CDS_pept        284715..285104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0322"
FT                   /product="crossover junction endodeoxyribonuclease RusA
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF05866"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44150"
FT                   /db_xref="GOA:A7H208"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:A7H208"
FT                   /protein_id="ABS44150.1"
FT                   /translation="MQMATREYALYIELKDNPIPYKRTTQRAKFVSKDYLKYLEFKKLL
FT                   QMEFLRQNKVQCFKAFDEKKFYSIELEIGFKNKKHGDCDNILKGVLDALFKNDKNVIKG
FT                   EYELKSFEKSFLKVKISEFKGVENV"
FT   gene            285097..285468
FT                   /locus_tag="JJD26997_0323"
FT   CDS_pept        285097..285468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44259"
FT                   /db_xref="InterPro:IPR032066"
FT                   /db_xref="UniProtKB/TrEMBL:A7H209"
FT                   /protein_id="ABS44259.1"
FT                   /translation="MYKKKYTREEVERMMNEYFSEEKILLRTKERDIKEPKSMTGLALY
FT                   MKTTRQTLYEWGKDPNLSDLIEYAKTLCENEVITHSLVNLYNTQMSTFILKNNHGYVDK
FT                   QEILSDNVQKIEIIRSEIQ"
FT   gene            285465..286757
FT                   /locus_tag="JJD26997_0324"
FT   CDS_pept        285465..286757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0324"
FT                   /product="putative terminase B protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43460"
FT                   /db_xref="UniProtKB/TrEMBL:A7H210"
FT                   /protein_id="ABS43460.1"
FT                   /translation="MKLNLNFSYTRAQLKVFDDKNPRFITVAKGRRLGFTRGCVKYVIE
FT                   NLIEGKNVLWVDTIQANLQNYYELYFTPELKNLPKDFYSWSVQDKKLIINGAVLHMRSA
FT                   ERSENIEGFAYDLVILNEAGIILKDSKGGYLWYNSIRPMLLDNPKSRAIIGGVPKGKNL
FT                   FYELCRKELSDKNWKHFQFSSYDNPFLKEEQIKELIEEVGGESSDVVRQEIYGEFIDSS
FT                   SAELFSLSGIENAMSKNSFSTQKMQGENIWGLDVARYGDDKSVLAKRKGFVIDELKKYS
FT                   QLGTIELANKILAEYKQSEEKPKGIFIDTCGLGVGVYDVLLNYGLPVFEANSANSATSN
FT                   QYLNKRAQMYFTFAKNLKHMELVKDEELKNDMRRIEYEYSDKGLLKIVSKEQLKKNYGK
FT                   SPDLSDAVALTFFEKLYSKNNTHEDWSYDGW"
FT   gene            286747..287019
FT                   /locus_tag="JJD26997_0325"
FT   CDS_pept        286747..287019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44442"
FT                   /db_xref="UniProtKB/TrEMBL:A7H211"
FT                   /protein_id="ABS44442.1"
FT                   /translation="MDGEFFMIYDAIDVSKIKKLSNLSDEAIKSSLANEFLELVSGFDN
FT                   ISKKKFKREFAEFLFEKGVNEKDVLKITNLSKTTIWRIMNENKKN"
FT   gene            287000..288523
FT                   /locus_tag="JJD26997_0326"
FT   CDS_pept        287000..288523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0326"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44552"
FT                   /db_xref="UniProtKB/TrEMBL:A7H212"
FT                   /protein_id="ABS44552.1"
FT                   /translation="MKTKRTDRVSFLTQLISESKSGYENYKPHFKELQDAYLLENKIMQ
FT                   KLRKRNKSSIYIPKINAKVKYLITSLNEVYFNSERMADIETYINSDDTIIELWQNAIDF
FT                   YSGKINMFKIFQPLFLDVLLVGTSIAKLTWHKGMPRIERVGIDSIFFDPNALNSEDVGY
FT                   IVNEIYLTYNEIYERQKLGFYKKLETPKLLDEEDEYKKVKLYDIYERKNDDAWVVSTLF
FT                   ENHLLRNEVILQDGQPFVWGSMLPQLKKIDNENYVSAYGEPIMASAMPLQDEINITRNL
FT                   LIDAVRTHIMPKIMLPKSMGVSREDIETLGKPLYTDDPKGVQILPPPDVNSAGMNLQLL
FT                   ESELTEVTGVSPQNNGAQTAHNETATEISIKAQEGGRRSADYIRQYNETFIEPLFDRFA
FT                   MLVFKYGEDNFFKGFQREDIPSFRFKIQTGTGAMNKEIRRAGIQASMQVFSQLYQMYMS
FT                   IGDTNSAYGIINASKELTKELLPILGVKNVNSLFAFENKIQQGETNAEY"
FT   gene            288510..288713
FT                   /locus_tag="JJD26997_0327"
FT   CDS_pept        288510..288713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44209"
FT                   /db_xref="UniProtKB/TrEMBL:A7H213"
FT                   /protein_id="ABS44209.1"
FT                   /translation="MLSIEIKSDISKTKGGKKLIDFIKAKYSECFYIAKNNEEKELRLK
FT                   ALDTMAFLDLIIHKIKDEEDGK"
FT   gene            288703..289347
FT                   /locus_tag="JJD26997_0328"
FT   CDS_pept        288703..289347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43149"
FT                   /db_xref="UniProtKB/TrEMBL:A7H214"
FT                   /protein_id="ABS43149.1"
FT                   /translation="MENDVLKDLMNVITDDDKAQEANHEGDAIAENEATNEPTQVADNE
FT                   GDYKAMFEAYKSENDNKLNALMSELEALKNPKPREQNEQREQYLKELGLDGLDEKLKRL
FT                   EELDKKQKDKEEQDALIAKYAQVESELRKAYPDADLKAMAELATKLKGLGEGNIDSWKT
FT                   LLHLVGKSNNVKKAEDLSSTNNNVRLSDFNDKLKKGAVSEIDLGKELLSLI"
FT   gene            289358..289726
FT                   /locus_tag="JJD26997_0329"
FT   CDS_pept        289358..289726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44151"
FT                   /db_xref="UniProtKB/TrEMBL:A7H215"
FT                   /protein_id="ABS44151.1"
FT                   /translation="MDFITALKGGTGLGSSFADTLIKTSRFTPNLASSSGFLKGLKNSF
FT                   GAWLFQNSDANKITHLDRLGNVLGGAGALYGAYNQQKMAQKNYDLQKDGFTFNKYLANE
FT                   ELNRRKNMENKLQNVWSH"
FT   gene            289812..290267
FT                   /pseudo
FT                   /locus_tag="JJD26997_0330"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            290293..290916
FT                   /pseudo
FT                   /locus_tag="JJD26997_0331"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            290913..294578
FT                   /locus_tag="JJD26997_0332"
FT   CDS_pept        290913..294578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44288"
FT                   /db_xref="InterPro:IPR041092"
FT                   /db_xref="InterPro:IPR041110"
FT                   /db_xref="UniProtKB/TrEMBL:A7H216"
FT                   /protein_id="ABS44288.1"
FT                   /translation="MNIREFLLEKPQENNIISFLQDGVSQNTSGYLSNLKNEAINDFYK
FT                   NKYAKEYEKYNFKDENLTNPMGSISEYKRDLYDYNKNPSMNANDLSDYILDKQSKFNAS
FT                   KPFFADDNEVARKSNQFMRDLGDELQKSGRGRLLQDDDGSYWVQDNNGNYSKVQGSIGG
FT                   DLYRGLRANGASVALGTAGAIGGSMLGGVGMVAGGALGASLGAGYDYYANTKDTNEDMN
FT                   LKEALMLMGENAGLSLIGDAAFAGVAKGARALKNTYNMAKSGARAGKDMIDGVAVNGKN
FT                   VSDRIVDKITQKDIPIVGKFTDGGLQNAETIFTNLTKNVENKKQIDELIAKENPTYLEN
FT                   AKPTIEILKNIVEQGLNKNNPQFIQDSAKRTSAILKNISNALQGVPTTQRREVLLKSAQ
FT                   AYPEMGSFLEDVLKADKDASISFLNMIKGQDEVFKNKTGLKGEFDYKAWQKDNHAYENR
FT                   VNQEYGGAIAKLDELNNGNIVLNNEDLVKLENFKNNHFLEQDVKNNIQSYLDEVKGKNL
FT                   NAEQIFGLRTAINKQLNTGNKTYNTKKAYGIIKEILDDALIRNASDKTLAKEVLDNANK
FT                   NFALKENFKESYLGMMKPQETKEGLADRLVKGLRNINEDKNLQNAFKGMNEQERWVNET
FT                   HAMNALLEKHRIEGIGYDFKSLAKDMKDVEFSSKKLKAVKGVIDTYALIYNNNRDLIMT
FT                   ALTSSGKKTNSSIATTLKGALDRILISGILARLHALVPFMKSAKEQALRNQILDAIKLA
FT                   KTHKEILSNLKNIKIADGEQSRIFKDALNHYMKVDKEQNKRLKDALIKEGVIKGDNFFM
FT                   DKVNPKDNSLRFIGKNGKEYTINKDVRNEWMKTFNLKNIDDEYIPNIPKEAKIALKDRE
FT                   IKLTKGSLLKLIEKDRIKYIPHIKETLESPQVILKDKDDFIFIKNIGNQTYFTSIGKDY
FT                   ETHLTIVSNAPKKQNNIKNKMKNAEVVYNNNARALPTSRASSETKQVSFSNLNSTQAKP
FT                   KKNLMEELKENIKAKEVEQKNKKSVKQRLDEKIQNDKKASEDILKRYDNFLKESKNNKL
FT                   DFLDRMSLNTIEYNLSRQMIINAKESTNKGIKKDIPSALRGKIEQELNINPLKEFGENY
FT                   TEYYHDGKGALQKLLIEKQGQVAGAFHRKDLGDIDLVWGVEGSSRSDGYGLSKIVKYHN
FT                   EVLHQIDDIINEGELKRDNKGRLNIEYKNSIIGLRDNWKGEKNKNHWIITSYSKR"
FT   gene            complement(294729..294857)
FT                   /locus_tag="JJD26997_0333"
FT   CDS_pept        complement(294729..294857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44624"
FT                   /db_xref="UniProtKB/TrEMBL:A7H217"
FT                   /protein_id="ABS44624.1"
FT                   /translation="MKSITPNSKKSQNKSKENRKMTKTQAFIEGFIAKPIKNKPKN"
FT   gene            complement(294811..294996)
FT                   /locus_tag="JJD26997_0334"
FT   CDS_pept        complement(294811..294996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43598"
FT                   /db_xref="UniProtKB/TrEMBL:A7H218"
FT                   /protein_id="ABS43598.1"
FT                   /translation="MSNINAFLFGFTNMFNADILKATSLKDRKTLINDFHKKSEELRKH
FT                   SDEEYNAKFEKITKQK"
FT   gene            295491..296765
FT                   /locus_tag="JJD26997_0335"
FT   CDS_pept        295491..296765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0335"
FT                   /product="alpha-ketoglutarate permease"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44784"
FT                   /db_xref="GOA:A7H219"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H219"
FT                   /protein_id="ABS44784.1"
FT                   /translation="MQTTKLSKKAQIHSVIAASSGNLVEWFDFYIYGFAAVYFAHNFSN
FT                   ATSTLFQQIEIFGVFAAGFLMLPVGSIIFGKMADIKGRKKAMIVSIIFMAFGSFGIAFL
FT                   PDKQAIGDIAVVFLLLLRLIQGIAVGGEFGIVAAYLTEIAPQGKRGFVSSFQYVTIIGG
FT                   QLLAVASISLLFLFIDERQMQEFGWRILFFVGGVLAVLSLFFRSFIQDNSHKVLENYAD
FT                   RGSFKALFKSYKALLIVIGVTAGCTIGFYAITVYPKVFMINNGVDTILANNIMLGSLFV
FT                   LCVAIPFIGAISDKIGFKISLFIYLGFCLVGTYPLFMALKSVALSGSNEFLLFVVVCFM
FT                   CFMLSFYTAVAAISKTSLFPPQIRALGAGLGCMISVGLFGGSVNYVALQFKALGIEWGF
FT                   FVYFGVIACISLICTALIPKQRELD"
FT   gene            complement(296836..296985)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0336"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            297350..297677
FT                   /gene="ssrA"
FT                   /locus_tag="JJD26997_0338"
FT   misc_RNA        297350..297677
FT                   /gene="ssrA"
FT                   /locus_tag="JJD26997_0338"
FT                   /product="10Sa RNA (tmRNA)"
FT   gene            complement(297763..299847)
FT                   /gene="ppk"
FT                   /locus_tag="JJD26997_0339"
FT   CDS_pept        complement(297763..299847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="JJD26997_0339"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by match to protein family HMM PF02503"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43448"
FT                   /db_xref="GOA:A7H220"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H220"
FT                   /protein_id="ABS43448.1"
FT                   /translation="MQTSPDMFINRELSWLRFNSRVLDQCSKNLPLLEKLKFIAIYCTN
FT                   LDEFYMIRVAGLKQLFSAGVNASSSDEMTPLQQLKAIRKYLHQEKELLEHYFNEITSEL
FT                   EKENLFIKHYENLDENLKQKCDEYFFSNIFPVIVPIAVDATHPFPHLNNLSFSLAVKIF
FT                   DKAHPELVKFGMIRIPRVLPRFYEVSANIYVPIESIVHQHAEEIFPGYKLLASAAFRVT
FT                   RNADMVIEEEEADDFMMILEQGLKLRRKGAFVRLQIQKDADEQIVEFLNTHMKIFHKDV
FT                   YEYSILLNLPSLWQIAGNKNFTHLLSPLYTPKTLPPFDENLSIFDAVEKEDILIIQPFE
FT                   SFDPVYKFIKEASKDPEVISIRMTLYRVEKNSNIVQALIDAASDGKQVTVMVELKARFD
FT                   EENNLHWAKALENAGAHVIYGITGFKVHAKVSQVIRKQGDKLKFYMHLSTGNYNASSAK
FT                   IYTDVSYFTSKAEFARDTTSFFHILSGFSKNRRLQTLSMSPNQIKEKILEMIRIETSKK
FT                   NKGVIVAKMNSLVDSDIIQALYEASMEGVKIDLIIRGICCLKPDEEYSKNIRVRSIIGK
FT                   YLEHARVFYFKHSEPNYFISSADWMPRNLERRLELMTPIYDERSKAKLAQFLRLQLSDN
FT                   VLAYELKNNGEYEKIPSSEKTIDSQQTLEEYVSKIYKTLKKDTDQSRATHLASKLFKEN
FT                   "
FT   gene            300035..300550
FT                   /gene="nrfH"
FT                   /locus_tag="JJD26997_0340"
FT   CDS_pept        300035..300550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfH"
FT                   /locus_tag="JJD26997_0340"
FT                   /product="cytochrome c-type protein nrfH"
FT                   /note="identified by match to protein family HMM PF03264;
FT                   match to protein family HMM TIGR03153"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44451"
FT                   /db_xref="GOA:A7H221"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017571"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A7H221"
FT                   /protein_id="ABS44451.1"
FT                   /translation="MIILRRKILKKTSNLFIIFLVLLFVFFAVGFYTFYNAKGTSYLSN
FT                   ASESCNNCHIMNEVYNEYMAGSHSQKVKGEPRATCVDCHLPHNFVAKWIAKAQSGLGHA
FT                   YAFTFKLDELPTNLSATEKSRKMVQENCIRCHADFAQTAINATTNPHADKSLNCASCHK
FT                   DVGHKHGI"
FT   gene            300565..302397
FT                   /gene="nrfA"
FT                   /locus_tag="JJD26997_0341"
FT   CDS_pept        300565..302397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="JJD26997_0341"
FT                   /product="cytochrome c552"
FT                   /EC_number="1.7.2.2"
FT                   /note="identified by match to protein family HMM PF02335"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43488"
FT                   /db_xref="GOA:A7H222"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A7H222"
FT                   /protein_id="ABS43488.1"
FT                   /translation="MKKNILRLGIVVLVLLIAGVLWLNNDINQKKEDETNKNAIAANAD
FT                   FSLLSDDDPNFEKWGKVFPEQLKMYLTVEKEEPKATEFGGNLAYSKLIRFPQLTILWAG
FT                   YPFSLDFNEERGHFWVQVDQMKTARNNKDFLNAHGLAAFKGQPAACMNCHSGWTPWLIK
FT                   NVAKGDFTAFNSTNYWTMIKNIPAVDGIVENSPEHAGPHGGKRMGVTCADCHNPNDMSL
FT                   RLTRPAAINALVSRGYEKDPVQGVKATREEMRTLVCSQCHVEYYFKPTGEKVKVMGEII
FT                   VDDSSKKWWNGTQKNYDEYEFWRDGNKAKEIETDGIVLTFPWSEWKKGQPFRIEMLDDY
FT                   YDKVRGVFGADFTHKLTGAQIIKIQHPESELYSGGVHAANGVSCVDCHMPYVREGAKKV
FT                   TQHNITSPLRDINSACKSCHKQSEDYLKAQVLDIQNSIAHDQRTAEYTIVSLIMDTKKL
FT                   RDELGNMEKFQSDGKADAKKISEELKEVLELHRKAQMRADFVNAENSTGFHNPREASRM
FT                   LLQAVDMARMGQTKLVEIAAANGIKDFKTSNLGFKDIQKFNPGELYYKVDVNNHKAGER
FT                   YYADEKDVNGNPPKELLEHDKELAPYNYQVIDKK"
FT   gene            302534..303088
FT                   /locus_tag="JJD26997_0342"
FT   CDS_pept        302534..303088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44017"
FT                   /db_xref="GOA:A7H223"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:A7H223"
FT                   /protein_id="ABS44017.1"
FT                   /translation="MFNKNKLFRQVHIYLSLFFLPCALLFALTGIVYIFGINQDVGLKV
FT                   EQYQLSKVIESGKEREALIEYLKTNGLKVPSNTNIIKSKDKGITIGGTHYSANITQKST
FT                   NEYSITLKTRSLLGDMIMLHKDKGAWYFSVLSVGFGITLFMLYISGLMITLFANKKDRS
FT                   KQFAVLGVGVVVTLLLAYLSL"
FT   gene            303152..303241
FT                   /locus_tag="JJD26997_0343"
FT   tRNA            303152..303241
FT                   /locus_tag="JJD26997_0343"
FT                   /product="tRNA-Ser"
FT   gene            complement(303242..304123)
FT                   /locus_tag="JJD26997_0344"
FT   CDS_pept        complement(303242..304123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0344"
FT                   /product="phage integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43648"
FT                   /db_xref="GOA:A7H224"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A7H224"
FT                   /protein_id="ABS43648.1"
FT                   /translation="MYFKELAILFLDIKKGLYKISTYYKVEGIINNRLSLFFSYKISDI
FT                   KPSFIKFWLSSIDDVGSKSKKHYLNILNQIFKLALDDDLLSKNPCENIKIIYFKPKINP
FT                   FSSFEVNQILEKSLNYNYKLQIFLKIGFYTGMRTGEILALKIKEIDLEKRIIYINSTRS
FT                   RFGEGTPKTFYSIRKIPIFNILYTDLKNFVLSNKNNTYLFETQYNKPYRDDFVFCKFYK
FT                   QILKDLSLSYRRPYTMRHTFATNFLLNSNLSPLELSKILGHSSPEMVYKVYVKYIDDLK
FT                   DNFKRDIQIYKI"
FT   gene            complement(304113..305162)
FT                   /locus_tag="JJD26997_0345"
FT   CDS_pept        complement(304113..305162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0345"
FT                   /product="bacteriophage replication gene A protein (GPA)"
FT                   /note="identified by match to protein family HMM PF05840"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44272"
FT                   /db_xref="GOA:A7H225"
FT                   /db_xref="InterPro:IPR008766"
FT                   /db_xref="UniProtKB/TrEMBL:A7H225"
FT                   /protein_id="ABS44272.1"
FT                   /translation="MPVFLTITLNGCFRKALEGDFSTFTQKDKKYFDYSLSYKFENNIS
FT                   FTIKDLINFLNRQWNLFILRIHRKYKGINKYYIRCFEPHKKDGVPHIHALLYIPRYAFD
FT                   YIFKTYKDIFNAPQNLKQGNKLTQEQVLNGEINGFQWSLNNPTGYIMKYIYKTFINFNE
FT                   RQDLDFLSAWYVKYKVRRFLSSKMPVPLWIYKKVNFFKKDLYHLCKLIDNPDYLIEWSF
FT                   EKDYFIFFSDDEEIEYNQGYLTYKYKGRLLYEYKKEIQESIKHYYSYSFKNKDDVYKIN
FT                   LGLLKNPKPIKDYDLMTLINSENFKYSNCKKIAYYRNLAFERGLISEKLDINNVDDLEL
FT                   VEKAYKYVF"
FT   gene            complement(305393..305533)
FT                   /locus_tag="JJD26997_0346"
FT   CDS_pept        complement(305393..305533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44842"
FT                   /db_xref="UniProtKB/TrEMBL:A7H226"
FT                   /protein_id="ABS44842.1"
FT                   /translation="MIENTLNLFNQTEALEGGALQSEGSCQFNKKLLPLSLINLIKNSY
FT                   L"
FT   gene            complement(305552..306727)
FT                   /locus_tag="JJD26997_0347"
FT   CDS_pept        complement(305552..306727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0347"
FT                   /product="bacterial type II and III secretion system
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00263"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43580"
FT                   /db_xref="GOA:A7H227"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:A7H227"
FT                   /protein_id="ABS43580.1"
FT                   /translation="MKKILLLLVLCFNVVFSKSFENTIFDYAHLASASNNVDILVSSSI
FT                   SPQSYVFYTSKPYPKISLEVFEKALKLQNLKLAFTGDFYYVYEPGKDNNMTSFQKSVID
FT                   KDKNLRYIKLKNNSYDDIANLLSMYDINSTYLYRSNAVTFLCDDFIYSHIKSSIDDLDN
FT                   MDLPQLKFKITILETNLDFLKEKGSKLSSLFQGNPIKDFHLFVNLITIPYNSQNNIVSS
FT                   DKKGFYSTLNFLENQRITRIVSNPFLLARSNTEVFFSSVQNIPFLKNSTSVSDTRVSQN
FT                   TSYDYRDVGLQVTLKPVIIGDKVDFSLHLIVEDLLSNSNLTPVTSKKELKSSYTLKKGE
FT                   LLVLSGINKVTNTNYTSGIPYLKDIWFLGNLFKIQRKETNNSVLTLSIEVF"
FT   gene            complement(306690..307850)
FT                   /locus_tag="JJD26997_0348"
FT   CDS_pept        complement(306690..307850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43198"
FT                   /db_xref="GOA:A7H228"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H228"
FT                   /protein_id="ABS43198.1"
FT                   /translation="MAITYIVGNPGSGKTYFAVNQIYEYFVLPTLPNKRILGFEIKRKL
FT                   KIFDYLYCYTNINGLKFDISDKLISFDFDIFYLNLTHLYNLYNQGLNDDELNIKANELN
FT                   LFKVMFVIDEAHNFLKNKDDKILIWWLTYHRHLHQEIIFITQDLSLISNEYKRIAEFFY
FT                   KALDSGKRIYKNSLRYVQFSSYKLYQKDIVTRFSLSLNKEVFSLYKSGDNKPNKSFFLK
FT                   IFTFLLFSILTLIFCFYIFISFFKSDEIKENNISKESNINLNLNISPNTIKDKSENNLF
FT                   SNLELIDGSLKDLPLKNVDINNSSVYKILCIDTTCHIDDKNQNFMHFPLEYFHFILNEF
FT                   PPIYHYKNKVNKGYQHFIIFNFEVFNNLKKGVLKNEKDTSFTRSLF"
FT   gene            complement(307855..308283)
FT                   /locus_tag="JJD26997_0349"
FT   CDS_pept        complement(307855..308283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44364"
FT                   /db_xref="GOA:A7H229"
FT                   /db_xref="UniProtKB/TrEMBL:A7H229"
FT                   /protein_id="ABS44364.1"
FT                   /translation="MPYFITSIFAFFADIFKKFSVEVLLKGVVSAIYISFVLISFSLFI
FT                   ALLYYGVNIVVFAFNQTNTFLASLDTQTNIVSGTDNDIIGTVFSILRTLGLFKAFNDVL
FT                   AIFSPTFISYFVFKLSVLVYVALCKLIKSYTSLYHIIK"
FT   gene            complement(308286..310121)
FT                   /locus_tag="JJD26997_0350"
FT   CDS_pept        complement(308286..310121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0350"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43491"
FT                   /db_xref="GOA:A7H230"
FT                   /db_xref="UniProtKB/TrEMBL:A7H230"
FT                   /protein_id="ABS43491.1"
FT                   /translation="MMHRFVFILLLSLNAFAFYPVYYSPSDWLKRSFPNDFFPNPSFSG
FT                   KYSTNGLGLLVSQRGALYFKHTDFRFDYVDDGYPFSDYFFTKFNFYVPADVLKSTHILS
FT                   PVGITYTNIFADSAASLNGTSLGILMTFGKPVTLESIDNSCLVPVSAFYELANNYGNYM
FT                   YFDGGDTYFNSPLIMNSGDEPCRNSFLGGYFDLSPNINVQTVYLSYYEKVSEPCPDNHI
FT                   FRANSDNTITCEPCPSSTYADIFKNICVAKISSITNPFDYAKAQCSSIGSSLKYIEDSL
FT                   NIVNGGDNFYCETICNNGTKINNYNCPERINFGDIINYEPNCIKGNCGNGEGSQNTSSN
FT                   NYPYDKPYQPPSNSQKVEVSENEKGKICFSDDNCISIGGATVNDDKQICINGNCSNINS
FT                   GSDNRDNTVCINGDCYHLGNNGSINHNQICINGNCSSINSSISNGNNGASGNGGSVGSG
FT                   GSGASGNGGSNDNNNGLGGLCQNGECGNYDNSSLNSYFSTLDGLSANLGSFKENLEGTY
FT                   NNFKESVENTKKIFDNGFLNFRNTGSLKSCPLVFDYELGNGGKQNFNLDLCEFLFPFSN
FT                   LFYLIFYIFFSAIALLFSYKILKDVFHLILNSRSS"
FT   gene            complement(310118..310246)
FT                   /locus_tag="JJD26997_0351"
FT   CDS_pept        complement(310118..310246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43594"
FT                   /db_xref="GOA:A7H231"
FT                   /db_xref="UniProtKB/TrEMBL:A7H231"
FT                   /protein_id="ABS43594.1"
FT                   /translation="MEILTVTGVVSFDFFFSIFIYFIIGVIPILLSLVLLVIKWVK"
FT   gene            complement(310609..310749)
FT                   /locus_tag="JJD26997_0352"
FT   CDS_pept        complement(310609..310749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44745"
FT                   /db_xref="GOA:A7H232"
FT                   /db_xref="UniProtKB/TrEMBL:A7H232"
FT                   /protein_id="ABS44745.1"
FT                   /translation="MDNFGNVVDIGKLIIFSNSFIAILIIAFFIAKSILIALKMLNEVS
FT                   D"
FT   gene            complement(310762..311001)
FT                   /locus_tag="JJD26997_0353"
FT   CDS_pept        complement(310762..311001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43818"
FT                   /db_xref="GOA:A7H233"
FT                   /db_xref="UniProtKB/TrEMBL:A7H233"
FT                   /protein_id="ABS43818.1"
FT                   /translation="MFKKLSNFKQFSKKKALIGSFALLSSASIASAAVTVNSTTGVMSG
FT                   TLDMAPFFSAVTVVVAALAVIVAVKAGIRLLRGI"
FT   gene            complement(311105..311473)
FT                   /locus_tag="JJD26997_0354"
FT   CDS_pept        complement(311105..311473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0354"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44740"
FT                   /db_xref="UniProtKB/TrEMBL:A7H234"
FT                   /protein_id="ABS44740.1"
FT                   /translation="MQIISEDFNLSYSLKGGLVRSVAEGSYDGKKYSASVRIDATNLYD
FT                   VENEKTGGLDTIKKELVFKISCPDNTTAGQVLSFIREKFKSNQVLNLDGSIPDNNNVVK
FT                   VLTPVNYFLGVEIKKSKN"
FT   gene            311760..311993
FT                   /locus_tag="JJD26997_0355"
FT   CDS_pept        311760..311993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0355"
FT                   /product="cobaltochelatase, CobN subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43142"
FT                   /db_xref="UniProtKB/TrEMBL:A7H235"
FT                   /protein_id="ABS43142.1"
FT                   /translation="MDKKEIAKRINVSLGTLYNWEKTKPELIKLISYGLKYERNEIETN
FT                   EISKYFEQLEKIEQEFYLSEIKANVLRKKLRK"
FT   gene            312084..312569
FT                   /locus_tag="JJD26997_0356"
FT   CDS_pept        312084..312569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44314"
FT                   /db_xref="GOA:A7H236"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A7H236"
FT                   /protein_id="ABS44314.1"
FT                   /translation="MFVVAMILKNSKKLNTTDDKTQILPKTKNNQFNYFKNKKKGDLYE
FT                   IQIGKMYQKQGYKVYFKGINEKKKDAGIDLIAYKDNEVLLIQCKNWQNSQIKQEHLRIF
FT                   LGDCTAYLEKEKHKFKNKEIKRFFITSCDEIDFAVKKFLEQNEIFYLIVPFETNLKT"
FT   gene            complement(312601..312882)
FT                   /locus_tag="JJD26997_0357"
FT   CDS_pept        complement(312601..312882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0357"
FT                   /product="plasmid stabilization system"
FT                   /note="identified by match to protein family HMM PF05016"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43562"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A7H237"
FT                   /protein_id="ABS43562.1"
FT                   /translation="MQIIQTYRFLLDLEKIADFISLDSIKQANLFLDNLEKSIENIPFM
FT                   PYKNRKSLSFDNENIRDLIFKGYVIPYLIDKSKNEILILGIYKSNLWD"
FT   gene            complement(312882..313106)
FT                   /locus_tag="JJD26997_0358"
FT   CDS_pept        complement(312882..313106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44310"
FT                   /db_xref="UniProtKB/TrEMBL:A7H238"
FT                   /protein_id="ABS44310.1"
FT                   /translation="MNLEFSKETQHFLTNYCKDNNLSEKEALELALSYLEHKIRIDGYK
FT                   KDVELYKQGKLKTYTSDEVFAKIRAKINN"
FT   gene            complement(313435..314013)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0359"
FT                   /note="enterochelin uptake permease; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(314296..314871)
FT                   /locus_tag="JJD26997_0360"
FT   CDS_pept        complement(314296..314871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0360"
FT                   /product="putative molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44477"
FT                   /db_xref="GOA:A7H239"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H239"
FT                   /protein_id="ABS44477.1"
FT                   /translation="MQLNELNCVILCGGKSSRMGQDKSKLILKNQNLTQFQVNKFSKIF
FT                   KNVYVSAKEDKFENHFNLIKDSLEFEVYSPMLALYSILSNFKNEFVFVLSVDSPKVGEN
FT                   ELLKMLPFLEQNYKIIIAKTPLHKHPLCGFYHSSLAQTCKNFLEKNEQKIGFLFSEIKT
FT                   KFVEFENEDAFLNLNFYEEYEKFKSELK"
FT   gene            314933..316240
FT                   /locus_tag="JJD26997_0361"
FT   CDS_pept        314933..316240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0361"
FT                   /product="putative fibronectin/fibrinogen binding protein"
FT                   /note="identified by match to protein family HMM PF05670"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43158"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A7H240"
FT                   /protein_id="ABS43158.1"
FT                   /translation="MKYTELLQLQTFFSQFKKIDFIKRINDNILELSFDRERFIFDLTR
FT                   AMSAIYTAKFNAKNYNAPFDFMLKKYFSNAFIKEVKVLEGNRILCFSVKANKAYKSYEG
FT                   KIYFEFTGKNTNVILTDENDLIIEALRHIDKSYRIVKPNVILEPLKPYKMDENFEEIKD
FT                   FADYFSRKFTSIYESKIKQIKNLKLTQVDKKIQNLQELFSSLDEKNSLLLKALEYRKRA
FT                   DVLFANLSVLKDYEREFKLDDFEGKELEFKLEFNPKQSANLYYKNAKKLEQKAKNLNIQ
FT                   RQNLKEKLDFTLSLKELLFQAKSEVELEILLPKKNSKKNQDHKQEDLVANFYYNEFKIC
FT                   VGKNEKGNEFLLKNAKKDDLWLHARDIPSAHTLIVSNKQKISLDVIEFAARLCVSFSKL
FT                   KKGSYWVDYTLKNFVKIQQKAFVNYTNFKSIHITKD"
FT   gene            316242..316577
FT                   /locus_tag="JJD26997_0362"
FT   CDS_pept        316242..316577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0362"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44796"
FT                   /db_xref="UniProtKB/TrEMBL:A7H241"
FT                   /protein_id="ABS44796.1"
FT                   /translation="MPVSPLGNVNYINQNMAYPATQASNELAKEGFAATLNMAEFNEKE
FT                   KTLNKLEKVNEIHEIKEEIKEKAEQEKKKKHNQEAKTSDDEENEEDESKDPNFKDAQSI
FT                   HRLDISI"
FT   gene            316587..317312
FT                   /gene="cdsA"
FT                   /locus_tag="JJD26997_0363"
FT   CDS_pept        316587..317312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="JJD26997_0363"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44044"
FT                   /db_xref="GOA:A7H242"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A7H242"
FT                   /protein_id="ABS44044.1"
FT                   /translation="MFNTTRIISALVMIGAIIIIALIDQFFINFIVFAVLLYLSFSEAK
FT                   KLFALENISIIPLAIAFILGSLSYKALLFGILALLLVVGYLVYKKASLKPALIYIYPSL
FT                   PILALWQVYFDQGMFALFWLIIVVTACDSGAYFIGKLMGKTPFSPTSPNKTLEGVIGGL
FT                   ICASVIGTILGVFVYSFCLSLLCSFFVAIFAVIGDLLESYFKREAGLKDSGDLIPGHGG
FT                   VLDRIDAVIIAAFVMVALL"
FT   gene            317309..318379
FT                   /gene="dxr"
FT                   /locus_tag="JJD26997_0364"
FT   CDS_pept        317309..318379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="JJD26997_0364"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF02670;
FT                   match to protein family HMM PF08436; match to protein
FT                   family HMM TIGR00243"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43260"
FT                   /db_xref="GOA:A7H243"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H243"
FT                   /protein_id="ABS43260.1"
FT                   /translation="MILFGSTGSIGVNALKLAALKNIPISALACGDNIALLNEQIARFK
FT                   PQFVAIKDSKNKHLVKHDRVFIGQEGLEQILTECQDRLLLNAIVGFAGLKSTLKAKELG
FT                   KNIALANKESLVVAGSFLKGAKFLPIDSEHVALKFLLEGKKNIAKLYITASGGAFYKYK
FT                   IKDLNQVSVKDALKHPNWNMGAKITIDSATMANKLFEIIEAYHLYDFKESDALIEPRSL
FT                   VHAMCEFKNGASTAYFSKADMKLAISDAIFEKQDTPILEAVDFSKMPALKFHKISTKKY
FT                   PIFKLKNAFLKEPNLGVIINAANEVGVYNFLENKSGFLDIAQCIFKALDHFGAPKISSI
FT                   EEVFEYDFKTREYLRS"
FT   gene            318381..319775
FT                   /locus_tag="JJD26997_0365"
FT   CDS_pept        318381..319775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44266"
FT                   /db_xref="InterPro:IPR031489"
FT                   /db_xref="InterPro:IPR033397"
FT                   /db_xref="UniProtKB/TrEMBL:A7H244"
FT                   /protein_id="ABS44266.1"
FT                   /translation="MKFFLTILFFITSIFALELDFSVGENGKSLDDNNTVLILGGIQGD
FT                   EPGGFHAASLLLSDYNITKGKIIVAPNLAFDSIIKRSRGNNGDLNRKFASISPKDPDYK
FT                   RVQRIKELILLPEVSMVINLHDGWGFYKPIYIDAMQNPKRWGNSSVIDTSEINASKYPD
FT                   LENIATQTVNIVNSSLADPKHAYHLKNTKTQELGDTEMLKALTYFVISNHKAAFANEAS
FT                   KNLPVNLRAYYHLLAIENYLKTAGIEFSRDFELTPQGVDKAINKELEVKLFDDRILLSL
FT                   KNPRKLINYVPFPVNKELNYNTSNELTAIIAEGNSFYIQYGNRFQTRLYPEYLEFSDAF
FT                   NEVTFQVDGNETTVFFGTKVKVKENFLIPKIANVRVNIIGFDHSKDESGILVHKKNIRT
FT                   QYSLDMAGKIYRVEFYELRGANLQRLLEANTHGKLIKNAKNLDLNTLKMARSKDKFLGS
FT                   ILVEFE"
FT   gene            319772..320779
FT                   /gene="gcp"
FT                   /locus_tag="JJD26997_0366"
FT   CDS_pept        319772..320779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="JJD26997_0366"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43504"
FT                   /db_xref="GOA:A7H245"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H245"
FT                   /protein_id="ABS43504.1"
FT                   /translation="MKNLILAIESSCDDSSIAIIDKNTLECKFHKKISQELEHSIYGGV
FT                   VPELAARLHSEALPKILKQSKKYFKNLCAIAVTNEPGLSVSLLGGISMAKTLASALNLP
FT                   LIPINHLKGHIYSLFLEEKISLDRGILLVSGGHTMVLYLKDDANLELLASTNDDSFGES
FT                   FDKVAKMMNLGYPGGVIIENLAKNAKLKNISFNTPLKHSKELAFSFSGLKNAVRLEILK
FT                   HENLNEDTKAEIAYAFENTACDHIMDKLEKIFNLYKFKNFGVVGGASANLNLRSRLQNL
FT                   CQKYNANLKLAPLKFCSDNALMIARAAVDAYEKKEFVSIEEDILSPKNKNFSRI"
FT   gene            320780..321289
FT                   /gene="ctsG"
FT                   /locus_tag="JJD26997_0367"
FT   CDS_pept        320780..321289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsG"
FT                   /locus_tag="JJD26997_0367"
FT                   /product="transformation system protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44193"
FT                   /db_xref="GOA:A7H246"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A7H246"
FT                   /protein_id="ABS44193.1"
FT                   /translation="MRKAFTILELVFVIVILGILAAIALPKMSSSKDEAEISKSLNNLK
FT                   TLINDISIYTLKNDHLSSIKTMSNVSGVENADLSNFNGTKEVNFRVGDDKECLKLVFIN
FT                   RADFILMGISSNEASKNAIAANQTHEDLENVDFTSSSSNKACVILSKNENFKNLASKTY
FT                   LLIGQR"
FT   gene            321295..322538
FT                   /pseudo
FT                   /locus_tag="JJD26997_0368"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            322548..324365
FT                   /gene="maf-6"
FT                   /locus_tag="JJD26997_0370"
FT   CDS_pept        322548..324365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-6"
FT                   /locus_tag="JJD26997_0370"
FT                   /product="motility accessory factor"
FT                   /note="identified by match to protein family HMM PF01973"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43786"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A7H247"
FT                   /protein_id="ABS43786.1"
FT                   /translation="MLEKNIQALLSGVNEPLGNKLLNFIQNKTCFRFNMDENLNIYDKT
FT                   HNVFMYENLEEEINFFYQSILEKTLRYPFICIYGIGNALLIKNLAKHYKHLFVFESEIE
FT                   LFILALSTIDLSEELCSGKIYLVDIEEERVDIQLLILFDMKDMFEYLSLYEMFVNNVYY
FT                   KKFYEDIWHRADELCEKNIEVIVRNLISNLNIGFECYSHLLQNIPSMLESIPFQRILSQ
FT                   RKNRFENAIVVSAGPSLAKQLPLLKAYQDKAVIFCADGALSMLEKESIVPDYVTNLDFT
FT                   DLAMKFFQNKENKLSLNILSCATHPNLVCLLDNKSVILRDDPLYQRFNLNDFGYIDTGT
FT                   HVSHFSYTLALALGFKNIIMIGQDLAFDEKGNSHSKGFSYGEQFSGEKTVPTLQVPAYA
FT                   GKGEVLTHITWNDYRIKLEYLFACNDQKAKFYNATEGGARIHFTEELSFKECCEKLLTK
FT                   EKPKFELPKSLTKNRSDKLLVKFKEKIQKDQENAKRFLKDALALKRILENILAKDFILP
FT                   LEFLEKVYQNIENFNHSLDTDEFIQDGILKAVIYERGLRISLVYKENILDHASFISAYI
FT                   KAYHEWLLYFIEKLEQRINIIINSLKELP"
FT   gene            324362..326179
FT                   /locus_tag="JJD26997_0371"
FT   CDS_pept        324362..326179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0371"
FT                   /product="motility accessory factor"
FT                   /note="identified by match to protein family HMM PF01973"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43779"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A7H248"
FT                   /protein_id="ABS43779.1"
FT                   /translation="MNLLEKNIQALLSGVNEPLGNKLLNFIQNKTCSRFNMDENLNIYD
FT                   KTHNVFMYENLEEELNFFYQSILEKTLRYPFICIYGIGNALLIRNLAKHYKHLFVFESE
FT                   IELFILALSTLDLSEELKFYKIVLFDCAAEDLEIQIAMVFDQQSILEYLSLYEMFMGAH
FT                   YYLKYYETSILSLNELCIKSASVAIRNADISCFLPLLTHGQFLQNIPSMLTSIPFQRIL
FT                   SQRKNQFDNAIVVSAGPSLAKQLPLLKAYQEKAVIFCADGALSTLEKEGIVPDYVTNLD
FT                   FSHWALKFFQNKEILKQSIIALECATHPSMVEDLKNLNCMIVLRNKALYQRFNLNDFGY
FT                   IDTGTHVSHFSYTLALALGFKNIIMIGQDLAFDEEGNSHSKGYDFGTKVSSEESIEKFK
FT                   VPAYAGKGEVLTHITWNDYRIKLEYLFACNDQKAKFYNATEGGARIHFTEELSFKECCE
FT                   KLLTKEKPKFELPKSLTKNRSDKLLVKFKEKIQKDQENAKRFLKDALALKQILENILAK
FT                   DFILPLEFLEKVYQNIENFNHSLDTDEFIQDEVLRGAFAYRGKMIADVLKLHIQDKTHF
FT                   ISAYIKAYDEWLLYFIEKLEQKYESLLKV"
FT   gene            326255..327976
FT                   /locus_tag="JJD26997_0372"
FT   CDS_pept        326255..327976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0372"
FT                   /product="flagellin A"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700; match to protein
FT                   family HMM PF07196"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44097"
FT                   /db_xref="GOA:A7H249"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A7H249"
FT                   /protein_id="ABS44097.1"
FT                   /translation="MGFRINTNVGALNAKANADLNSKNLDASLSRLSSGLRINSAADDA
FT                   SGMAIADSLRSQANTLGQAINNGNDALGILQTADKAMDEQLKILDTIKTKATQAAQDGQ
FT                   SLKTRTMLQADINRLMEELDNIANTTSFNGKQLLSGNFINQEFQIGASSNQTVKATIGA
FT                   TQSSKIGLTRFETGGRISSGGKVQFTLKNYNGIDDFKFQEVTISTSVGTGLGALADEIN
FT                   KNADKTGVRATFKVETRGVAAVKGGSTGDDFAINGVKIGKVEFKDSDGNGALVSAINSV
FT                   KDTTGVEASIDENGKLLLTSREGRGIKIEGNIGGGAFINKDMKENYGRLSLVKNDGKDI
FT                   FISGSGLSFAGFGASNFISQASVSLRESKGQIDANVADAMGFGSVNKGMILGASSISAY
FT                   MSSAGSGFSEGSGFSMGKGSYSTTLSSACVLISATSAISQVYDVSAGSGFSSGSNLSQF
FT                   AKMKTSAGAFNVKAETAGVTTLKGAMAVMDIAETAIANLDQIRADIGSVQNQVTSTINN
FT                   ITVTQVNVKSAESQIRDVDFASESANYSKANILAQSGSYAMAQANAVQQNVLRLLQ"
FT   gene            complement(328007..329896)
FT                   /gene="maf-4"
FT                   /locus_tag="JJD26997_0373"
FT   CDS_pept        complement(328007..329896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-4"
FT                   /locus_tag="JJD26997_0373"
FT                   /product="motility accessory factor"
FT                   /note="identified by match to protein family HMM PF01973"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43129"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A7H250"
FT                   /protein_id="ABS43129.1"
FT                   /translation="MRKKEINFEKNIKALSGSEYDNLRKKLGDLKELKHFSFTQGKDNL
FT                   DINIIKKRNLKKMYQDPVKALEKDLEYFKDFTRYPVLFFYGIGNGILYKILLQNKNLKR
FT                   IIIFEKELELIFLAFNFVDFSKDLSLARLIIVHQDDVTLPKIEKIFRLVGDLFYRSYNL
FT                   HLANDFYEEYKEDILKLNKLNILTIKNHNLMHGNDPKDAMQGIEQFVYNLPKLISHPSY
FT                   KELLKKRKNAKETAIVVATGPSLTKQLPLLKKYASKATIFCADSAYPILAKHGIRPDYV
FT                   CMLERDEIVAECFNNDFGEFDKDIIFLVASLVHKKTITYLEKNKRNYMLILKGQPFARY
FT                   LELDDYGYINAGMSVSHMAYEFAENLGHKNIVLIGQDLAYAKDGQTHSKGFIHASWHNG
FT                   DYERDFGKFTTTAYGGEGKVESSEIWTLFRQIFENFISFSQSKAYNCTEGGARIESAIE
FT                   KPFKEVCKDFLENEKDKKFKKLKALNAKEQVKLGLKIYQKIKKNMSLALHFQKECKKIK
FT                   KQIHNLTHGKNKLSLDEINQNIDKIKEKLSSQKYSFSQEILGPTLHHEQSLLAPLYLKD
FT                   IKNEADKQNKLFAWVYAHEALIENIIELLEAQDKRLKIAILALQDFLEKKKAL"
FT   gene            complement(329893..331842)
FT                   /gene="maf-3"
FT                   /locus_tag="JJD26997_0374"
FT   CDS_pept        complement(329893..331842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-3"
FT                   /locus_tag="JJD26997_0374"
FT                   /product="motility accessory factor"
FT                   /note="identified by match to protein family HMM PF01973"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44066"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A7H251"
FT                   /protein_id="ABS44066.1"
FT                   /translation="MTFIPTQKELFNKNIEALSNVFLKESLKQIKSSKFELILGKDKLD
FT                   INLKDTSIKNNGGGYSENLLYQDPIKELQTMLNTYSDKYLLYPVLYFYGFGNGILFKAL
FT                   LQNKNHQHIVVFEKDIEIIWVIFHILDFSNELQNARLMILENDKLQTQDYNELCSSKPF
FT                   FQFSRIYFLELMSHYYERFHEDVLKINHKLAETFKKVILMHGNDSTDALQGIEQFVYNL
FT                   PSMITHPSYEELLAKRKHLSDTAIIVSTGPSLTKQLPLLKKYASKATLFCADSAYPILA
FT                   KQGIRPDYVLSLERVLETSEFFNNDFKEFDKDILFVLKSYAHPHTTKYLQKNNRNFMLV
FT                   STYANFINYLKLDDFGYFTMGFSVANMAYHLALLLQYKNIILIGQDLAYSKDGSSHPDE
FT                   HIFGTLDGEKKETISYDLQTTAYGGEGLVYTQEVWNLFRSIFEQDITNYHIPTYNCTEG
FT                   GARIEGAIEKPFLWACENLLAKDLNKPFEKLEPLSLKKQNEFLLKAYYKVCQSIKHCRD
FT                   FSKILSNDFENIQSIYLSLNEKEEYLNLAIRKIDEFKNKLEDIKQMQDLYEILGPLLTQ
FT                   FELNLARIYVLNPKTKEDVFNKSILWIKEHLEFMELVYGHIKAQESALIKNILPLEEKL
FT                   KERKLDKGMERVRR"
FT   gene            complement(331867..333708)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0375"
FT                   /note="motility accessory factor; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01973"
FT   gene            complement(333705..335648)
FT                   /gene="maf-1"
FT                   /locus_tag="JJD26997_0376"
FT   CDS_pept        complement(333705..335648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf-1"
FT                   /locus_tag="JJD26997_0376"
FT                   /product="motility accessory factor"
FT                   /note="identified by match to protein family HMM PF01973"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44311"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A7H252"
FT                   /protein_id="ABS44311.1"
FT                   /translation="MGIMTFTQKELFNKNIEALGNIFLKESLKQIKSSKFELILGKDKL
FT                   DINLKNTSDNTFLHENVINELNSMLNTYNDKYLLYPVLYFYGFGNGVLFKALLQNKNHQ
FT                   HIVVFEKDIEIIWVIFHILDFSNELQNARLMILQTSSLDIEFFSNFCSSKPFFQFSRIY
FT                   FLELMSHYYERFHEDVLELNKKLVQYFKDSILSHGNDPLDALQGIEQFVYNLPSMITHP
FT                   SYKELLAKRKHLSDTAIIVSTGPSLIKQLPLLKKYANKATIFCADSAYPILAKHNIKPD
FT                   YVCMLERSEFTAEFFNHDFGEFDKDICFIIKSVVHPNAIHYLNKKTDDFTLVSTYASFI
FT                   NYVKLDDFGYFNMGFSVAHMACYLSLHLKHKNIIFIGQDLAYAKNGNSHPDDYQNSATY
FT                   ESKAHEPILTKAYGGKGEVKTHHIWLMFKQNLEQDVEKIQKYLDTKVYNCTEGGARIEG
FT                   AIEKPFLWACENLLGKDLNKPFEKLEPLSLKKQNEFLLKAYYKVCKSIEHCRDFNDKFI
FT                   KSYKKIKNSFMSLQNSQENEILVKKIIKNIDKIKTQIDELYNTQKDLIQILGPLLTQFE
FT                   LNLARIYVLNPKTKEDVFNKSILWIKEHLEFMELVYGHIKAQENALIKNILPLEEKLKE
FT                   RKLNKWMERVRR"
FT   gene            complement(335636..336406)
FT                   /gene="ptmA"
FT                   /locus_tag="JJD26997_0377"
FT   CDS_pept        complement(335636..336406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptmA"
FT                   /locus_tag="JJD26997_0377"
FT                   /product="posttranslational flagellin modification protein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44456"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H253"
FT                   /protein_id="ABS44456.1"
FT                   /translation="MLENKIIFVAGACGRIGKALCQKILLNKGLVILADINKERLKKLQ
FT                   ENLETNFKTKLLSLELDITKQESLQIALQKSQERYGKIDAFVNSSYPFGKDWGKTPYYE
FT                   LKYEQICESLNLHLAGFMLAAQEFVKFFKQQGHGNIINLSSIMGVYAPKFENYEGTSMQ
FT                   SSLEYSVIKAGINHMGTWLAKELFNQNIRVNTLASGGILDNQNELFLKAYRKCCASKGM
FT                   LNADDICGTLVFLLSDESKFITGQTLVVDDGWGL"
FT   gene            complement(336406..337113)
FT                   /gene="ptmB"
FT                   /locus_tag="JJD26997_0378"
FT   CDS_pept        complement(336406..337113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptmB"
FT                   /locus_tag="JJD26997_0378"
FT                   /product="posttranslational flagellin modification protein
FT                   B"
FT                   /note="identified by match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43596"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H254"
FT                   /protein_id="ABS43596.1"
FT                   /translation="MAEILCTICARAGSKGVKNKNIKKINELEMIAYSIIQAQNSKLFK
FT                   HIVISTDSDEIASIAQKYGAEVFFKREAHLANDQAAKLPVMRDALLRSEVHFKTRFETL
FT                   IDLDASAPLRSSLDIKKAYESFVKNDNSNLITAVPARRNPYFNLIEIQNNKVVKSKEGN
FT                   FTTRQSAPKCYDMNASIYIFKRDYLLKNDSVFGEKTGLFVMDESTAFDIDSELDFKIVE
FT                   FLISLKNLSPKDF"
FT   gene            complement(337106..338011)
FT                   /locus_tag="JJD26997_0379"
FT   CDS_pept        complement(337106..338011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43360"
FT                   /db_xref="GOA:A7H255"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H255"
FT                   /protein_id="ABS43360.1"
FT                   /translation="MKVLIIGFGSIGKKHFLALKNLNYEVSLLSLSAKEEEFKNTPIYH
FT                   SLKECDLNEFDLFIIANITTEHFNTLKALNELVKDKIILVEKPLFEKAQNFTSSKNYIY
FT                   VAYLLRFHPVIVALKKLLKGEKIYFASLVCNSYLPHWRALDYRQNYSAKKELGGGVLLD
FT                   LSHEIDLAFFLFGNLELEYSQNAKISELDITSDDFAFLVLKNSQEAKIHIKLDYFSKFN
FT                   KREITIHTLEKSFKADLINNKIEIYHKNKNTECLNFENDTIKTLQNLHQAVFEKDKELC
FT                   DLKQALKVLELCDEVRRKNG"
FT   gene            complement(338008..339033)
FT                   /locus_tag="JJD26997_0380"
FT   CDS_pept        complement(338008..339033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0380"
FT                   /product="nucleotidyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44345"
FT                   /db_xref="GOA:A7H256"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H256"
FT                   /protein_id="ABS44345.1"
FT                   /translation="MDINKLKLTPHSSIKEALKIVGQERVRLGIIVDKKDKFLGVISDS
FT                   NIRKALIGGKTLKDSIKDIYTKNPITIKENTSKEELLKLSAKTDIYDFPVLDEKGQILS
FT                   IKSISSLLKANPNSIIIMAGGLGSRLKELTKDTPKPMLKVGKKPILESIVQRLKNQNFE
FT                   NFIFCVNYKKQIIEDYFQKGQKFGVKISYIKERKKLGTAGALSLIKQEFKESFIVMNAD
FT                   ILTELDFNALLKAHKKSKALMSVCVREFEQQIPYGVITQKQGFIENIEEKPTQKFLVSA
FT                   GIYVLENEILNLIAKNEYLDMPELIKIALQKGKVNTYIINDYWIDIGRPDEFLKANEDF
FT                   K"
FT   gene            complement(339042..340232)
FT                   /locus_tag="JJD26997_0381"
FT   CDS_pept        complement(339042..340232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0381"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43139"
FT                   /db_xref="GOA:A7H257"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A7H257"
FT                   /protein_id="ABS43139.1"
FT                   /translation="MLNTLKASCSLRKGVKKIMLISATRAEWYLLRNLCHEIQNDKDLS
FT                   LQIIATGAHLSPEFGLTYKEIEKEFKIAKKIPILLASDDKISLCKSMSLAFSAFSQAFE
FT                   DLKPDMVVILGDRYEMLSVASVCLLMHIPLVHLCGGELTLGAIDDSIRHSISKMSHLHF
FT                   VSHEIYKKRLLQLGEEEKRVFNIGSLASVIIKNMNFLSKKDLEKALEMKLDKELYLITY
FT                   HPLTLNVKNTQKEIKTLLKKLDTLKNASLIFTKANADENGLLINEILQNYCQKNSHKAK
FT                   LFDNLGSQKYLSLMKIAKAMVGNTSSGISESPFFKTPCINIGDRQKGRLRTQNIIDCEI
FT                   NDLDQAFEKLESKEFKQNLKNFKNPYDNDKNPNKIIKTYLKNVNLDTILHKNFIDL"
FT   gene            complement(340226..340876)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0382"
FT                   /note="GlcNAc-PI de-N-acetylase family; this gene contains
FT                   a frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF02585"
FT   gene            complement(340880..341791)
FT                   /locus_tag="JJD26997_0383"
FT   CDS_pept        complement(340880..341791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0383"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44303"
FT                   /db_xref="GOA:A7H258"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A7H258"
FT                   /protein_id="ABS44303.1"
FT                   /translation="MRIFFIGCVQFSHFALKKLLSLQNENLQVVGIATKEKSDFNSDFY
FT                   DLKQDIKNLPCLHVKDINDAQSLKFIHSLKPDIVYCFGWSSLIKKELLNSYPIIGFHPS
FT                   KLPYNRGRHPIIWALFLNLKESGSSFFVMDKGADTGRILSQKSIKISSKDNAKSLYEKI
FT                   TQKALKQIEDFTLKIYKKSLKNKDFKSILHTLSYKQTKGNTWRKRDFKDGKIDFRMNSL
FT                   AIYNLIRALAPPYIGAEVLYNNKIYKIYEAKIVKNSQNNLECGKILKVDQKGILVKSYD
FT                   GAILLTKHNFDILPKNGEYFKG"
FT   gene            complement(341788..342975)
FT                   /locus_tag="JJD26997_0384"
FT   CDS_pept        complement(341788..342975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0384"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44611"
FT                   /db_xref="GOA:A7H259"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A7H259"
FT                   /protein_id="ABS44611.1"
FT                   /translation="MSKRKICIVSATRAEWYLLRNLCHEIQNDKDLSLQIIATGAHLSP
FT                   EFGLTYKEIEKEFKITKKVEMLLSSDSEIGICKSMGLTQISFAEVLNELKPDIIVVLGD
FT                   RYEIFSCVASAMICKIPVAHLHGGEATWGLIDEAIRHSITKMSHLHFVATKEYQKRVIQ
FT                   LGESPLRVFNVGGFGLDNIANLKLLSKDELQKALNFTFQKRNFLITFHPVTLENQSSQK
FT                   QFQDLLKVLDLESKKENLGLIFTKSNADTNGRIINEMIDDFCSCHKNCIAFVSMGALNY
FT                   LSSMQFINAVVGNSSSALCEAPSFKIASINIGDRQKGRIKAKSVIDCEANFKSIEEAFK
FT                   KLNDKNFIKELKNTENPYGKAGAAKKTKEILKNFNLENILKKEFFDIDFSTEFEK"
FT   gene            complement(342968..343972)
FT                   /gene="ptmC"
FT                   /locus_tag="JJD26997_0385"
FT   CDS_pept        complement(342968..343972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptmC"
FT                   /locus_tag="JJD26997_0385"
FT                   /product="N-acetylneuraminic acid synthetase"
FT                   /note="identified by match to protein family HMM PF03102;
FT                   match to protein family HMM PF08666"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43980"
FT                   /db_xref="GOA:A7H260"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A7H260"
FT                   /protein_id="ABS43980.1"
FT                   /translation="MKKTLIIAEAGVNHNGDLNLAKKLIEIAADSGADFVKFQSFKAKN
FT                   CISTKAKKAPYQLKTTANDESQLQMVQKLELDLKAHKELILHAKKCNITFLSTPFDLES
FT                   VDLLNELGLKIFKIPSGEITNLPYLKKIAKLNKKIILSTGMANLGEIEQVLNVLCKNGT
FT                   KRQNITLLHCTTEYPAPFDEVNLKAMQSLKDAFKLDVGYSDHTRGIHISLAAVALGACV
FT                   IEKHFTLDKNMSGPDHKASLEPHELKMLCTQIRQIQKAMGDGIKKASKSERKNINIVRK
FT                   SLVAKKDIQKGEIFNEENLTTKRPANGISAMRYEEFLGKIATKNYKEDELIRE"
FT   gene            complement(344012..344440)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0386"
FT                   /note="putative methyltransferase; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(344410..344703)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0387"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(344721..345844)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0389"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(345933..346961)
FT                   /locus_tag="JJD26997_0390"
FT   CDS_pept        complement(345933..346961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43682"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H261"
FT                   /protein_id="ABS43682.1"
FT                   /translation="MSRISLENYLQANNRYSCLSSNDIYLNKKYAELYGETFDFSYSKN
FT                   GFVFKIIAIKEKIANSQFYDLQSPYGYGGIYCSSQNEDFIKEALKALQIEALKQNIIAF
FT                   FIRFHLFDENLKIYSKLLPFFTKSRETIIVNTEKDINNIRMNYSPRIRSYVKKAREELQ
FT                   INFATKKDCKDFFSLYGKTMQRNQADKFYYFSEDYFQKLFDFNESVILKASLNNEILAY
FT                   ASFFLCGDFSYYHLSANILKSNANAALLDFFFEYASNNNSKFCFLGGGVQDNDTLYKFK
FT                   EKFSILRASYYLGGMIFDKKNFDLLNKNLINKYFLKYRFNDFILPPPHPTNRLFFNFRN
FT                   KL"
FT   gene            complement(347021..347689)
FT                   /locus_tag="JJD26997_0391"
FT   CDS_pept        complement(347021..347689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0391"
FT                   /product="methyltransferase domain family"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43939"
FT                   /db_xref="GOA:A7H262"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H262"
FT                   /protein_id="ABS43939.1"
FT                   /translation="MNNSTLWENIFSQKEWGKYPSESLIRFIARNFYNVQDRSKINILE
FT                   LGFGTGTNLWFCAKEGFNVSGIEWSKTGVERFKQRLENENLSHCIQEIKIGDYEQKLDE
FT                   FEDESFDAIIDHCSLCCNDFEKTKKIFNKAIMKLKINGKFFSSTISKGIEGYDNANDDF
FT                   QLPKSGIYTHVGMIRYSNKKDLKKLYKNKYFKWTNLQTQSLEANNKLIDKLFIIEGERI
FT                   "
FT   gene            complement(347686..348405)
FT                   /locus_tag="JJD26997_0392"
FT   CDS_pept        complement(347686..348405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0392"
FT                   /product="methyltransferase domain family"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44473"
FT                   /db_xref="GOA:A7H263"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H263"
FT                   /protein_id="ABS44473.1"
FT                   /translation="MKKYISNEEISNNLGSNEKIWENIFSQKEWGKYPSENVIRFIARN
FT                   FYNVQDRSKINILELGFGTGANLWFCAKEGFSVSGIEWSKTGLERFKARMKDENLSDKI
FT                   KQIELGDYIDKLDSFKDDSFDAWMDNYSLAYNDFDKTKKIIDKAMKKLKKGGKFLSVTP
FT                   SLYNDGFEKDESLGYHLVKPTSGSDACTGIIRYCDEKDIKQLYQGKNYQITDIKINTLK
FT                   NLENNLSELYIIEGKKL"
FT   gene            complement(348449..349591)
FT                   /locus_tag="JJD26997_0393"
FT   CDS_pept        complement(348449..349591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0393"
FT                   /product="aminotransferase, DegT family"
FT                   /note="identified by match to protein family HMM PF01041"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43282"
FT                   /db_xref="GOA:A7H264"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:A7H264"
FT                   /protein_id="ABS43282.1"
FT                   /translation="MFEKEISFIKSLFNKENIALHEPCFIGNEKKYLLECIDSGFVSSV
FT                   GEFVTRFEEALKEKTKARFVIATNTGTAALHIALLANGIDENCEVITQSISFVATANAI
FT                   AYTGAKPIFLDIDENTLSLNPKALEHFLENQTYQKNGFSYNKTTHKLIKACIIMHTFGL
FT                   SAHIKALKELCEKYRILLIEDAAEALGSTYENKALGTFGKCGILSFNGNKIITGGCGGA
FT                   ILSNDENLAKLAKHLSTTAKIPHPYEYDHDRIAYNYRLCNVNAAILLAGLENLELFLKN
FT                   KRELAKIYKDFFKNHDKCKFIDEKNNEKSNFWLNTLLFKDENLRDIFLKECLENKIFSR
FT                   PIWKSLPSLKAFQNCQSDELINTKNLEKRLVNLPSSVRRK"
FT   gene            complement(349584..350555)
FT                   /locus_tag="JJD26997_0394"
FT   CDS_pept        complement(349584..350555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0394"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44719"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H265"
FT                   /protein_id="ABS44719.1"
FT                   /translation="MRNILVTGADGFIGSHLCESLIKKGFKVRALNQYNSFNFWGHLEK
FT                   SPFLKDMEVISGDLRDSFFCEKITKNIDAIFHLGALIAIPYSYTAPQSYVDTNVNGTLN
FT                   MLEAAKKNEISHFIHTSTSEVYGTAFYVPIDEKHPLQPQSPYSASKIAADMMALSYYNS
FT                   FNLNVNIARPFNTYGPRQSARAIIPTIITQILSGVKEIKLGDLSPKRDLNFVLDTCEGF
FT                   ISLLNLKHFGEVYNIGSGVEHSMQEVLDLIQKILDSKVKIIQDEQRLRPKNSEVFRLCC
FT                   DANKLKKATNWQSKISLEEGLRQSIEYFKENLENYKSELYNV"
FT   gene            complement(350552..352321)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0395"
FT                   /note="motility accessory factor; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01973"
FT   gene            complement(352305..352487)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0396"
FT                   /note="motility accessory factor; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(352484..353515)
FT                   /locus_tag="JJD26997_0397"
FT   CDS_pept        complement(352484..353515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0397"
FT                   /product="N-acetylneuraminic acid synthetase"
FT                   /note="identified by match to protein family HMM PF03102;
FT                   match to protein family HMM PF08666"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43430"
FT                   /db_xref="GOA:A7H266"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A7H266"
FT                   /protein_id="ABS43430.1"
FT                   /translation="MQIGNFNTDKKVFIIAELSANHAGSLEMALQSIKAAKKAGANAIK
FT                   IQTYTPDSLTLNSDKEDFIIKGGLWDKRKLYELYESAKTPYEWHSQIFETAQNEGILCF
FT                   SSPFAKEDVEFLKRFDPIAYKIASFEANDENFVRLIAKEKKPTLVSTGIATEEELFRIC
FT                   EIFKEEKNSDLIFLKCTSAYPAAIEDMNLKSIVSLKEKFNVEVGLSDHSFGSLAPIIAV
FT                   SLGARVIEKHFMLDKNIESEDSKFSLDFDEFKAMVDAVRQTESALGDGKLDLDEKALKN
FT                   RVFARSLYASKDIKKGEIFSEENVKSVRPSFGLHPKFYQELLGKKASKDIEFGDALKQG
FT                   DFQ"
FT   gene            353665..354801
FT                   /locus_tag="JJD26997_0398"
FT   CDS_pept        353665..354801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0398"
FT                   /product="flagellin modification protein, PseA"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44153"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:A7H267"
FT                   /protein_id="ABS44153.1"
FT                   /translation="MKFCKKCVMPDTKPDLHFDEEGVCDACRSQEAKNKKINWQEREKE
FT                   FFELVKKYKKHPVYDCVIGVSGGKDSTFQVVKMLELGLNPLCVCFEPSVPTKIGRKNLE
FT                   NLNHLGVDLIHIKRDPKVYQKLAREAFIRTGDNEWQNHLGIFTSVPRIAVNFGVPLIIW
FT                   GESPQIEYGGPASSKNKNILGREWLEEFGGLLGNRASDMLGVNGITEKDLFLYTYPSDE
FT                   ELERVGVTGLFLGYYFKWDYKKILEISKKYGFLTLDHPVETTYENFENLDCYSNHVHDY
FT                   LKYCKYGFGRATDNACLDIRLGYISREEGVRLVQKYDGKPPKKAIKKYLKFGGFSEEEF
FT                   QKIVDSFTNKKIFKRDENGKFIRDYDGSLVRKDECVLK"
FT   gene            354786..355403
FT                   /gene="hisH-1"
FT                   /locus_tag="JJD26997_0399"
FT   CDS_pept        354786..355403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH-1"
FT                   /locus_tag="JJD26997_0399"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF01174; match to protein
FT                   family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44208"
FT                   /db_xref="GOA:A7H268"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7H268"
FT                   /protein_id="ABS44208.1"
FT                   /translation="MCFKMIALIDYKAGNLNSVAKAFEKIGATNFIAQNPKDLQKADKL
FT                   LLPGVGSFKEAMKNLKELGFIEALKEQVLVQKKPILGICLGMQLFLEKGYEGGVCEGLG
FT                   FVEGEVVKFEEDLNLKIPHMGWNELEILKQEPLYQGMEDKSDFYFVHSFYVRCKDEFVS
FT                   AKAQYGHKFVASLQKDHIFATQFHPEKSQNLGLKLLENFVRL"
FT   gene            355404..356150
FT                   /gene="hisF-1"
FT                   /locus_tag="JJD26997_0401"
FT   CDS_pept        355404..356150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF-1"
FT                   /locus_tag="JJD26997_0401"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by match to protein family HMM PF00977"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44403"
FT                   /db_xref="GOA:A7H269"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020021"
FT                   /db_xref="UniProtKB/TrEMBL:A7H269"
FT                   /protein_id="ABS44403.1"
FT                   /translation="MLKTRIIPCVLLKNSQLVKSIEFKDFRTIGHLTSTVRIYNARNVD
FT                   ELIILDIDASKSGEIDFESIEDLAKECFMPLTIGGGIKTLEDIQKILNLGADKISINSK
FT                   ALEDMDFISKAANRFGSQCIVCSIDVKRKGGQFCVYDRGNLLEKSPLELALEYEKKGAG
FT                   ELLLTSVDFEGKARGYDLELLKIFQNKLKIPLIINGGLGKPSDGVEALNLGADALAGAY
FT                   IFHFSKYTPKDVKEELAKQGFAVRLL"
FT   gene            complement(356115..356588)
FT                   /locus_tag="JJD26997_0400"
FT   CDS_pept        complement(356115..356588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0400"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44704"
FT                   /db_xref="GOA:A7H270"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020036"
FT                   /db_xref="UniProtKB/TrEMBL:A7H270"
FT                   /protein_id="ABS44704.1"
FT                   /translation="MIKLKNFTELNSQEIELIFKWRNHPDISQFMKTKYIDFEEHLRFL
FT                   KNLHQDSSKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAIPDLKGVGQVLMNEIIKYA
FT                   FENLKVNTLKAYVFKSNHKALKLYQQNHFTIYDEDKDFYYVCLKQSHCKALLS"
FT   gene            complement(356585..357409)
FT                   /locus_tag="JJD26997_0402"
FT   CDS_pept        complement(356585..357409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0402"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43201"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:A7H271"
FT                   /protein_id="ABS43201.1"
FT                   /translation="MKVLFRSDSSSQIGFGHIKRDLILAKQYDDISFACLHLKGSLIDE
FT                   IPYPVYELSSESIYELINLIKEEKFELLIIDHYGISVDDEKLIKLETGVKILSFDDEIK
FT                   PHHCDILLNVNAYAKASDYEGLVPFKCEVRCGFSYALIREEFYQEAKENREKKYDFFIC
FT                   MGGTDIKNLSLQIASELPKTKIISIATSSSNANLKKLQKFAKLHSNIRLFIDHENIAKL
FT                   MNESNKLIISASSLVNEALLLKANFKAICYVKNQEPTATWLAKKGYEVEYRY"
FT   gene            complement(357484..358128)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0403"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF08889"
FT   gene            complement(358125..358799)
FT                   /locus_tag="JJD26997_0404"
FT   CDS_pept        complement(358125..358799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0404"
FT                   /product="putative flagellin modification protein FlmE"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43379"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H272"
FT                   /protein_id="ABS43379.1"
FT                   /translation="MHIKELKGLKFPDNAIIKFFFKNQLHTLQKQRVLEFACSNGNNLS
FT                   LFANYDYECLGVDLDDENIANANYNFTHIIKAKKFNFFKNNILEFPLLYPNIKADVFLI
FT                   PNVVNYLTREEFLNLLKLCEENKIYKKDAFFFIRTRSIKDYRYGLSEKIAHNCFKITND
FT                   DTTGELGCINTLYQEYELVEYLKQYLNLYNFKVLNYENTNIMGKDERLVNDSDIVIYGK
FT                   IK"
FT   gene            complement(358812..359456)
FT                   /locus_tag="JJD26997_0405"
FT   CDS_pept        complement(358812..359456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0405"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44732"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H273"
FT                   /protein_id="ABS44732.1"
FT                   /translation="MDLIRWFFKKNLDKLHNAKVLEFASHNGNNLSLFANYNYYCTGVE
FT                   LDQKNYENAIYNFKKIMKYNKFKFYNENMLDFATNFKNLNANVFLIPNVINYISKNDFK
FT                   NMLSNVRTNHLYKYGGGGYESFLFLKARSIKDHRYGLGKSVGNGSFILENDEFSGEKNC
FT                   LCTAYQEHELVEILQKYLNLYDFEVITSENINIKNKVYIKDSDIVIYGKIK"
FT   gene            complement(359486..360178)
FT                   /locus_tag="JJD26997_0406"
FT   CDS_pept        complement(359486..360178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0406"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43985"
FT                   /db_xref="GOA:A7H274"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR020039"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H274"
FT                   /protein_id="ABS43985.1"
FT                   /translation="MKNLCIIPARGGSKRIPRKNIIDFLGKPLIAYSIENALNSGIFDE
FT                   VILSSDDEEIIEVALKYGAKAPFVRDENLSDDYTSSTAVVQNAIEILQSQNQIYDNTCC
FT                   LYATAPLLNKDILKQAYEKFIQNQSKFLFAATEFEYPVQRAFYLNENNQVHMFDEKHYK
FT                   SRSQDLTKAYHDAGAFYFGTSKAWLEEDFMFKPHSSVFVLPRNLVCDIDTMQDLEFAKI
FT                   LYKANQCL"
FT   gene            360270..361502
FT                   /locus_tag="JJD26997_0407"
FT   CDS_pept        360270..361502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43306"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H275"
FT                   /protein_id="ABS43306.1"
FT                   /translation="MLINQTFEIDSCDDVELNIKRTSKLEYRISYDDEKEIKAIVFIIP
FT                   GFGGDADGNYRKHLVEYVAKEFQIMVVSVNYHCIKNRLQFGASLFMDNIDKFILQENCT
FT                   AFNIAIPIHLNKITDILSYLDENMEKLKNEEKIKENAKMSLSITLEPGKNEYQNFGVMQ
FT                   AQDLINALLHLKKEKYNLLENIPVIMIGSSHGGYLAHLAAKIAPWLVDGVIDNSSYAKT
FT                   PLQYLGFGKEIDYMRHYEACDISNSFKNLNLLFYSKTFWTSNKFLKNYFSKDKSLVRDI
FT                   LNYKHLNIMSNYDICFISYHSIQDDYIAPIGDKILLYDYLNKLNIDAELNIIRHKEQID
FT                   GRFIKNLEHGMGMSIKFLINNNLPKLFAKIQLKKRIVRQKTVSYPCQDLIYTFYEENNK
FT                   INLKIEENICS"
FT   gene            361493..362708
FT                   /pseudo
FT                   /locus_tag="JJD26997_0408"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            362721..363935
FT                   /locus_tag="JJD26997_0410"
FT   CDS_pept        362721..363935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44337"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H276"
FT                   /protein_id="ABS44337.1"
FT                   /translation="MLINQTFEIDSCDDVELNIKRTSKLEYRISYDDEKEMKAIVFIIG
FT                   GFGANANISFLDFDREYIAKNFDVVAVHVFYHCFCARQSIDQKYNPKLIPNQNDLERVN
FT                   GILKNINLGHLLANEDNFEQIIPFIEQRAGEIKQTGLVDESQKIELFCDFIPPNGDYQN
FT                   YGIMAAIDHINALKDLVKRFPKFADLPKIYGGGSYGGYLSLLIAKIAPWYVDGVIDNSG
FT                   VCLPFLPHILGRDMDQAEFVFEGDNHRIYPFVQKYWTRNVDSSFYFSDENYLVRVILNL
FT                   SHLKIQASYNAKIVFVSYHSQRDQGAPAENKIQLYEIYKILGYDATLHLIKDENDIDGR
FT                   FVKSLEHGLRMTDRALFRKELPLMLEKLQKRKSLMQENSISYPCGNKVFVFKDLEDKFE
FT                   LEMIN"
FT   gene            363957..365027
FT                   /locus_tag="JJD26997_0412"
FT   CDS_pept        363957..365027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44119"
FT                   /db_xref="UniProtKB/TrEMBL:A7H277"
FT                   /protein_id="ABS44119.1"
FT                   /translation="MTAYLHIGTTNTGNQEKQGFLMQNEEKLLKKAYIYPKSLRVANRH
FT                   WALVDMVLELVQKENILKEESVLSHITNERLLRTIENFKSESALHKDKKFIFSAEGIVW
FT                   DFSTKKHVEILEKIMRELGFTQIYIIVYFRDTLSYLNSHCSQDHKNNMGYYSADFSPQD
FT                   HPRRYVFDYEWICKTHAEVFGEENLIVRLLREDYVGGTLLKDFVYHLGLEWDESFVLKQ
FT                   TKNESFNLLGMELMSRLNQKDLKQDNLNSLLFMARRKFEGSKEKRLKFAVQKDIAKAYV
FT                   DYFASSLEWVKNKYFPHKNSLFAPVNWEEYEQNYTLTHTLSKDWDDVADFIAQIIVSKN
FT                   EIISSLKEQLELARKD"
FT   gene            complement(365024..365251)
FT                   /locus_tag="JJD26997_0411"
FT   CDS_pept        complement(365024..365251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0411"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43381"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A7H278"
FT                   /protein_id="ABS43381.1"
FT                   /translation="MQEIKQFFINIERTDINESMENLVSEDFIDSIDIMALVAEIEKFY
FT                   KKPLKAEFITPENFESFENIKKMLETAMKD"
FT   gene            complement(365254..365978)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0414"
FT                   /note="formyl transferase domain protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00551"
FT   gene            complement(365965..367473)
FT                   /locus_tag="JJD26997_0415"
FT   CDS_pept        complement(365965..367473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0415"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43908"
FT                   /db_xref="GOA:A7H279"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7H279"
FT                   /protein_id="ABS43908.1"
FT                   /translation="MTTHIYDFLEKSLIKFSNKTAFVEPFAKERKEITYKDFDLFSKKL
FT                   ASEILKTLKNDNPTQVPVLIILPKGIDCLISFFGVALSGNFYTLLDEKSPKERVEKVIE
FT                   VLKPKLFITSKDLNFNLDLPTLYTQDFESFDIDESLIKHAKEKHIDTNLLYVFFTSGST
FT                   GIPKGVSIAHKSVIDYTFWVCETFKFDENEILANQAPFYFDNSILDIFSSVKSGATLHL
FT                   LPNHLFAFPNKILECLEKEKVSTIFWVPSVLIYFANTEALNNFSLNTLKKILFCGEIMP
FT                   NKQLNIWRKHLPNALFANLYGPTEITDVCSFYIINRTFKDEELLPIGKACKNTELLVFD
FT                   ENMNFISPKQIGVKGELFVRGTSLSLGYYNDKEKTKQAFIQNPLHDNYLDLLYKTGDIV
FT                   SYNEFGELLCYGRVDNQIKYMGHRIELGEIESVINSHANIKNSACIFKEDIICFYESEE
FT                   EIDLKAFLKDKLPSYMIPKNFITIDKFKLNQNGKIDRKVLNEKI"
FT   gene            367534..368760
FT                   /locus_tag="JJD26997_0416"
FT   CDS_pept        367534..368760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44676"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H280"
FT                   /protein_id="ABS44676.1"
FT                   /translation="MLINQTFEIDSCDDVELNIKRTSKLEYRISYDDEKEMKAIVFIIG
FT                   GYGANANIHFLDSYRNYIAKKFDVATINVFYHCFCQRPSDVEKYSTLADFTKEDLRLME
FT                   KVLCKYNIPCDQLANNTVVSHCEYLSEIMTELKMLNRLPYDFEERLSATYIPSDGEYQN
FT                   FGIMPAIDHINALKDLIKHFPQFSNLPKIYGGGSYGGYLSLLIAKIAPWYVDGVIDNSG
FT                   SALPPLNYIIGRELEFESKDTNGDMYIQGNHFFVSCFLKTYWNRDENSPYFFAKENYLI
FT                   RALLNKEHLIIQSEKNTNIFYVSYHSKYDPLTPCKFKIAYIESLQYLGYDATLHIIDEN
FT                   KIDGRFAKDLTHGMGIPDKALFRKELPLMLEKLQGRISPMQENSISYPCGNKVFMFKDQ
FT                   GMQLKFTIN"
FT   gene            368770..369985
FT                   /pseudo
FT                   /locus_tag="JJD26997_0417"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(369999..370220)
FT                   /locus_tag="JJD26997_0419"
FT   CDS_pept        complement(369999..370220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0419"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43487"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A7H281"
FT                   /protein_id="ABS43487.1"
FT                   /translation="MTKTEFLEELKEAMHRDENLSEDMLLDDIDEWDSLAFVSVMVLYK
FT                   NLFALKITAEDLKNCQKVSDLINLAKLD"
FT   gene            complement(370220..371281)
FT                   /locus_tag="JJD26997_0420"
FT   CDS_pept        complement(370220..371281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0420"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /note="identified by match to protein family HMM PF08541;
FT                   match to protein family HMM PF08545"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43995"
FT                   /db_xref="GOA:A7H282"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A7H282"
FT                   /protein_id="ABS43995.1"
FT                   /translation="MKTRFDKAKISGICVSVPEHKICIDDELESVFSNDIKTLKRMKKV
FT                   IGLNTRYICDENTCVSDLGKHATNTLLQGLNIDKNSLDALIVVTQSPDFFMPSTACYLH
FT                   QLLNLSSKTIAFDLGQACAGYLYGLFVAHSLIQSGLGKILLVCGDTLSKFIHPKNMNLA
FT                   PIFGDGVSATLIEKTDFNEAFFDLGSDGRHFDKLIIPKGAMRIPKADIFNDDSLMQTEE
FT                   FRQLENLYMDGANIFNMALECEPKSFKEILEFSKVEEKDITFHLFHQSNAYLVDCIKEE
FT                   LKLNDDKVPNFIMEKYANLSACSLPALLCELDTPKEFKASLSAFGAGLSWGSAVLNFKD
FT                   LYTKDILIYTKEK"
FT   gene            complement(371271..372833)
FT                   /locus_tag="JJD26997_0421"
FT   CDS_pept        complement(371271..372833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0421"
FT                   /product="HAD-superfamily phosphatase, subfamily IIIC"
FT                   /note="identified by match to protein family HMM TIGR01681;
FT                   match to protein family HMM TIGR01686"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44652"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7H283"
FT                   /protein_id="ABS44652.1"
FT                   /translation="MNLFSPHLKRNELIKFAKELNFDKSQDLLINIHRNHAFEGIQSII
FT                   APFLHFANLKADFNFSSYDESLSFDGFKKANLELLWLDLTRYKNNVQNFLEERLLALRK
FT                   FSQSPILVLSLGEFKTDKKILNCEIFNVEKLVKEYFDEEDILDLAKEELTGSKLNNKAL
FT                   IFLAQILGLSLIPALIKPALKALVLDLDNTLYQGILGEEGIDNLKLNPLYKALQEKIKT
FT                   FKKQGFLLALASKNEEKDAKKLFETRKDFILQWDDFDARMINWEPKGENILKIAKKFNI
FT                   NANAMLFIDDNIAELENTKFTGVKTLLCDENILYKIKLFPNLLKLSNTKEDQIRAKDIA
FT                   VNALREELKSLSDEEYFQNLEISLNFSKNDLQNIPRISELLGKTNQFIANYTRLNQEKV
FT                   AQHMQKELIISVSMSDKLSDSGIIAIFVFSCKEGNLLIDDLCISCRALGRKLETRMFFK
FT                   AFELALKFFNLKNNNARLYYQKGERNMPFLSFLEQISKEFEKNSALVSFQNLNFKGLII
FT                   HEN"
FT   gene            complement(372830..373246)
FT                   /locus_tag="JJD26997_0422"
FT   CDS_pept        complement(372830..373246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43902"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A7H284"
FT                   /protein_id="ABS43902.1"
FT                   /translation="MLDKTLDLPLHHIGVACKNLEKERECFFKLGFYKEAEFIDEKQGV
FT                   RGEFIIPCNEVFPQYRFELLQNLSDKGPLDSYLKNNTKMYHLAYESKNIAQDLTLLEQQ
FT                   GGICIVPIMQASYFAKLCFIMMPNRLLIELVELK"
FT   gene            complement(373239..374132)
FT                   /locus_tag="JJD26997_0423"
FT   CDS_pept        complement(373239..374132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0423"
FT                   /product="methyltransferase domain family"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44467"
FT                   /db_xref="GOA:A7H285"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H285"
FT                   /protein_id="ABS44467.1"
FT                   /translation="MKENIEKLFQAITQKNPIHSKYLKKIEFSQEDEEEFDKLISYYIQ
FT                   DSISIEEQCDCYLLILNDTLEETKFFIENGTYRYSGFDEVKDKVYFNESYMKQYMIGLA
FT                   LSSFVWIAHIKVRKYFSQYLKNFTPKTTYFEIGPGHGEYFARAVKSGKFSAFYGLDISP
FT                   TSCELTQKMVKQQVGGLITKCDFLCQDFFTYDFDKKADLIVIGEVLEHVEKPLEFLKRS
FT                   KELLSDGGEIFATIPINAPAIDHIYLFSHPDEVKNLIEKSGLKLKTYECFMANDYSLEK
FT                   ALKFKNAITMAVVLNA"
FT   gene            complement(374129..374359)
FT                   /locus_tag="JJD26997_0424"
FT   CDS_pept        complement(374129..374359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0424"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43744"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A7H286"
FT                   /protein_id="ABS43744.1"
FT                   /translation="MEKQFYEILENILETKVDENTNLSMENCKNWTSLAHIDIIMSLEE
FT                   EFEIKFNKEDLSLLKSQNALLEKIQTLKAEK"
FT   gene            complement(374485..375180)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0425"
FT                   /note="aminoglycoside N3'-acetyltransferase; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(375201..375992)
FT                   /locus_tag="JJD26997_0426"
FT   CDS_pept        complement(375201..375992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0426"
FT                   /product="aminoglycoside N3'-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43530"
FT                   /db_xref="GOA:A7H287"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:A7H287"
FT                   /protein_id="ABS43530.1"
FT                   /translation="MKYFLEHNGKKYSDKDLIDAFYQLGIKRGDILCVHTELFNFGVPL
FT                   LSRNEFLQTILNCFFEVIGKEGTLLMPTFTYSFCKNEVYDKVHSKGKVGVLNEFFRTSG
FT                   GGVRRTSDPIFSFAVKGAKADIFLKENSSCFGKDSVYEILTREGGKFMLLGLNYGHALT
FT                   HYAEERNTSFCRYFKEFKGFVIDELGQKREKRINYYVRDLEKAYVCSLDKINEIVRQTR
FT                   YYKSIKFAGDFLESYDAKEYVKAIGNALKQDKFAIYEKLLL"
FT   gene            complement(375989..377296)
FT                   /locus_tag="JJD26997_0427"
FT   CDS_pept        complement(375989..377296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44245"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7H288"
FT                   /protein_id="ABS44245.1"
FT                   /translation="MDKLDFRSQDFSQTGKAMYELACELFPIPRSITGQGFRDSLEILN
FT                   KTLGGGILKFHSIKSGTKVFDWIVPDEWNVKEAYIITPEGEKICDFKKHNLHLLNYSEA
FT                   IDQEIELEELQDHLYSIEEMPDAIPYVTSYYKRRWGFCLTHNERKKLKKGKYKVYIDAK
FT                   HDENGFLDYADFILPSTQNSKDEILISTYLCHPSMANNELSGPVVAIFLAKWLLSLKER
FT                   RYNYRFVIIPETIGSIVYLSKHLEHLKKHVKAGFVLSCLGDDHTYSLIHTPKENTLSDK
FT                   VALHTLKNKENFKAFSFLDRGSDERQYNAPLVNLGIVGVCRTRYGDYDGYHNSKDDLNF
FT                   ISEKGLMGGLQSMQEMILNLEINAVYENTIVCEPNLGKRGLYHTLSAANDIPLACNFLA
FT                   YCDGENDIIDIANILNMQAYEFKELLEKIKFYGLVK"
FT   gene            complement(377289..378419)
FT                   /locus_tag="JJD26997_0428"
FT   CDS_pept        complement(377289..378419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0428"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43899"
FT                   /db_xref="GOA:A7H289"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:A7H289"
FT                   /protein_id="ABS43899.1"
FT                   /translation="MLTYSHQNIDQSDIDTLTKALKDEILTGGKKVNEFEEALCEYMGV
FT                   KHACVLNSATSALHLAYTALDVKEKIVLTTPLTFAATANAALITGAKVEFIDIKNDGNI
FT                   DEKKLEARLLKESENIGAISVVDFAGNSVEMDEISNLAKKYNIPLIDDASHALGALYKS
FT                   EKVGKKADLSIFSFHPVKPITTFEGGAVVSDNEELIDKIKLLRSHGIVKKRLWDSDMVE
FT                   LGYNYRLSDVACALGINQLKKLDHNLEKREEIASFYDKEFEKNPYFSTIKIKDYKKSSR
FT                   HLYPILLFPEFYCQKEELFESLLHAGIGVQVHYKPTYEFSFYKKLLGEIKLQNADNFYK
FT                   AELSIPCHQEMNLKDAKFVKDTLFSILEKVKKGYCG"
FT   gene            complement(378421..379425)
FT                   /gene="flmA"
FT                   /locus_tag="JJD26997_0429"
FT   CDS_pept        complement(378421..379425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flmA"
FT                   /locus_tag="JJD26997_0429"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43423"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H290"
FT                   /protein_id="ABS43423.1"
FT                   /translation="MFNGKNILITGGTGSFGKTYTKVLLENYKPNKIIIYSRDELKQFE
FT                   MASIFNAPCMRYFIGDVRDKERLSAAMRDVDFVIHAAAMKHVPIAEYNPMECIKTNIRG
FT                   AQNVIDACFENGVKKCIALSTDKACNPVNLYGATKLASDKLFVAANNIAGNKQTRFGVT
FT                   RYGNVVGSRGSVVPFFKKLINEGAKELPITDTRMTRFWISLEDGVKFVLSNFERMHGGE
FT                   IFIPKIPSMKITDLAHALAPHLSHKIIGIRAGEKLHEIMISSDDSHLTYEFENYYAISP
FT                   SIKFVDKDNDFSINALGEKGQKVKDGFSYSSDNNPLWASEKELLEIINHTEVF"
FT   gene            complement(379475..380035)
FT                   /locus_tag="JJD26997_0430"
FT   CDS_pept        complement(379475..380035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0430"
FT                   /product="putative deoxycytidine triphosphate deaminase"
FT                   /note="identified by match to protein family HMM TIGR02274"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43852"
FT                   /db_xref="GOA:A7H291"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H291"
FT                   /protein_id="ABS43852.1"
FT                   /translation="MGLKADNWIRKMALEHKMIEPFCEANIGKGVVSYGLSSYGYDICV
FT                   GREFKIFTNVNSTVVDPKNFVEENVVDFEGDVCIVPANSFALARTIEYFKMPDDVLAIC
FT                   LGKSTYARCGIIVNVTPFEPGFEGHITIEISNTTPLPAKIYANEGIAQVLFLQGDEKCD
FT                   TTYKDKKGKYQAQTGITLPRILK"
FT   gene            380180..380635
FT                   /gene="accB"
FT                   /locus_tag="JJD26997_0431"
FT   CDS_pept        380180..380635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="JJD26997_0431"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM TIGR00531"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44356"
FT                   /db_xref="GOA:A7H292"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A7H292"
FT                   /protein_id="ABS44356.1"
FT                   /translation="MTKEEIKELVNLFAETNISKIKIKEQDGFEIELERDMCCDVPAPV
FT                   CTPVPAPQPINVSVVNEAQPSQSAKSNKPSINSPMVGTFYQAPSPGAAPFVKVGSTVKK
FT                   GDTIAIIEAMKIMNEIEAEFDCRIAEILVADGQPVEFGMPLFAVEKL"
FT   gene            380637..381968
FT                   /gene="accC-2"
FT                   /locus_tag="JJD26997_0432"
FT   CDS_pept        380637..381968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC-2"
FT                   /locus_tag="JJD26997_0432"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF02785; match to protein family HMM PF02786;
FT                   match to protein family HMM PF08443; match to protein
FT                   family HMM TIGR00514"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43507"
FT                   /db_xref="GOA:A7H293"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A7H293"
FT                   /protein_id="ABS43507.1"
FT                   /translation="MEIKSILIANRGEIALRALRTIKEMGKKAICVYSEADKDALYLKY
FT                   ADASICIGKARSSESYLNIPAIITAAEIAEADAIFPGYGFLSENQNFVEICAKHNIKFI
FT                   GPSVEAMNLMSDKSKAKQVMQRAGVPVIPGSDGALAGAEAAKKLAKEIGYPVILKAAAG
FT                   GGGRGMRVVENEKDLEKAYWSAESEAMTAFGDGTMYMEKYIQNPRHIEVQVIGDSFGNV
FT                   IHVGERDCSMQRRHQKLIEESPAILLDEKTRTRLHETAIKAAKAIGYEGAGTFEFLVDK
FT                   NLDFYFIEMNTRLQVEHCVSEMVSGIDIIEQMIKVAEGYALPAQESIKLNGHSIECRIT
FT                   AEDSKTFLPSPGKITKYIPPAGRNVRMESHCYQDYSVPPYYDSMIGKLVVWAEDRNKAI
FT                   AKMKVALDELLISGIKTTKDFHLSMMENPDFINNNYDTNYLARH"
FT   gene            complement(382003..382818)
FT                   /locus_tag="JJD26997_0433"
FT   CDS_pept        complement(382003..382818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44006"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A7H294"
FT                   /protein_id="ABS44006.1"
FT                   /translation="MKKILLSFAFFASLASANTINAIAVVVDKEPITTYDIDQTMKALK
FT                   IDRNKALGILINEKMEISQMKQLGIVVNDLELDDAINKMLTQNKTTLNAFKANLKSKNQ
FT                   SYEQFRANFKKDLEKRKLYEKISNMAKTDFSDDGAKKFFEQNKDKFTFYTQINANIYLS
FT                   NNPQTLENIKNTKKIILKPQNASLNTSNTDPRLLGLLSQIPVGDFSPVLNGKNGYELYE
FT                   VKSKDGAQTPEYEQVKNEVLNAYVSEQRQNFIQDYFDKLRSKINIEYLR"
FT   gene            382883..384274
FT                   /gene="gltX-2"
FT                   /locus_tag="JJD26997_0434"
FT   CDS_pept        382883..384274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX-2"
FT                   /locus_tag="JJD26997_0434"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43292"
FT                   /db_xref="GOA:A7H295"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H295"
FT                   /protein_id="ABS43292.1"
FT                   /translation="MHEKLTTRFAPSPTGYLHIGGLRTALYNYLYARKNGGNFLLRIED
FT                   TDLKRNSKEATKAIIEAFKWCGLEHDGEVTYQSERFDLYKEYVKKLLDEGKAYYCYMSK
FT                   EELEELRAKQEAAKERPRYDGRYREFTGTPPQGIEPVVRIKAPQSGEIVFKDGVKGEVR
FT                   FKAEDIMDDFIIARSDGTPTYNFTVVIDDALMGVSDVIRGDDHLSNTPKQIVLYEALGF
FT                   KIPQFFHVAMIHGEDGKKLSKRHGATDVMEYKEMGILPQALLNFLVRLGWSHGDDEVFS
FT                   LEDLKKLFDPYHINKSASCYNAKKLEWLNTHYIKTLPFEEIKRQLKDLGFDLSVYEKAG
FT                   FLLDLLRERAKTLHDIINGAKSIVNAPQNYDENAVQKFVNENNLELLQAFANTLKDPKT
FT                   GKDFEDFTNDFLEKKEAKLKDLAQPIRIALTGSAVSPSIFEVLEFLGVDECKKRIENFL
FT                   KVRGK"
FT   gene            384276..385511
FT                   /locus_tag="JJD26997_0435"
FT   CDS_pept        384276..385511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0435"
FT                   /product="NADP-dependent malic enzyme, truncation"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44025"
FT                   /db_xref="GOA:A7H296"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A7H296"
FT                   /protein_id="ABS44025.1"
FT                   /translation="MNLKEEALKYHLGGKIDIVPSKPMATSHDLSLAYSPGVAEPCLEI
FT                   AKDNELAYTYTNKANLVAIVSDGSAVLGLGNIGAQASKPVMEGKACLFKKFANVNAYDI
FT                   EIDVHSIEEIVNFCKALAPAVGGINLEDIAAPKCFEIEAALQDLGIPVMHDDQHGTAII
FT                   STAGLMNAMEISGKKFKDIKVVVSGAGAAGIASAKMYRNLGVENIILVDSKGVISKDRN
FT                   DLTSRKLEFVVDSKEKTLKEALKGADVFLGLSAPKILDDEMVLSMAKDPVIFALANPIP
FT                   EVMPEDVARLRKDAIVGTGRSDYPNQINNVLGFPFIFRGALDVRASKITENMKVAAAKA
FT                   LADLAKLPVSDAVKKAYNLNHLEFGRDYVIPKPFDERVKAAVSTAVAAAAVKDGVAKVK
FT                   NFDEKAYFESLK"
FT   gene            385508..386055
FT                   /pseudo
FT                   /gene="upp"
FT                   /locus_tag="JJD26997_0436"
FT                   /note="uracil phosphoribosyltransferase; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            386137..386808
FT                   /locus_tag="JJD26997_0440"
FT   CDS_pept        386137..386808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02621"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43128"
FT                   /db_xref="GOA:A7H297"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:A7H297"
FT                   /protein_id="ABS43128.1"
FT                   /translation="MIFGKIDYINLLPLHVYLKKYPLPNGYKANMEYKKGVPSKLNKDL
FT                   FYRRIDAAIISSIESARKKYKNLDLGICANKRVLSVLVEKNSSNAKDPSSATSNALAKV
FT                   LKQDGKVIIGDKALKLYLKDPSKYIDLCAKWHEKTGLPFVFARFSCVQKKALYKQILKK
FT                   FPKTKIKIPYYILQNYARTRDLDIKDVRYYLDEVIYHKISTKEKTALKRFVKACKALNL
FT                   A"
FT   gene            complement(386805..387455)
FT                   /locus_tag="JJD26997_0439"
FT   CDS_pept        complement(386805..387455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0439"
FT                   /product="putative potassium uptake protein TrkA"
FT                   /note="identified by match to protein family HMM PF02080;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44147"
FT                   /db_xref="GOA:A7H298"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H298"
FT                   /protein_id="ABS44147.1"
FT                   /translation="MKNLNYGIIGLGKFGSVVADELIAGGHTVIVADKDEETLKSIQNP
FT                   PSYAYILDSTNISALKEAGFHDVEVVIVSIGENVEKSILTLMALKDIGVKNIIAKATSN
FT                   IHGQILSKLGATKVIYPEKESAKRLVKEFLTKDADYEVFDLSANTIRAIKINIDEKLAG
FT                   NSLKHVAQNMKVISYKKLNSDWEILPDLETTTVYSGDVVILLGTVKELREFEH"
FT   gene            complement(387466..388809)
FT                   /locus_tag="JJD26997_0441"
FT   CDS_pept        complement(387466..388809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0441"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="identified by match to protein family HMM PF02386;
FT                   match to protein family HMM TIGR00933"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44411"
FT                   /db_xref="GOA:A7H299"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A7H299"
FT                   /protein_id="ABS44411.1"
FT                   /translation="MKQFGLDRRTFKILLAGYIIIALFGALLLHSSRAHITPIDFLDAF
FT                   FTSTSAVSMTGLVVKNTAVDFTLAGQIIILALVQIGGLGYMGIGLFVYILIRKKVSFSA
FT                   RNLLKESLFYPSMDGLFKFFKKVLLFIFAIELIGAILLTMRFALEMNFKKALWFGIFHS
FT                   ISAFNNSGFTIFEHGLIAYKHDIAINLIITSLIIIGGLGYFVLVELYFFQRKKLQNLSL
FT                   HTKMVVVASIFLIFSSTLIIFAFEYSNPQTIGHFSFFDKILSSYFIAINYRTAGFNTLD
FT                   MGHLHDASLFFGSLFMVIGGAPGGTAGGMKVTTVMVLLLYAYWSIRDGRVRIFGHEIPR
FT                   ETISKAFIIAVGSAVYIVIAVILLSLLESKFDFIALLFETSSAFATVGISVGNGGTLSL
FT                   CALFSDPSKVIIIIMMLSGRIGVFAFLLSVFKQDKAIHLKFPEGKVNL"
FT   gene            388949..389024
FT                   /locus_tag="JJD26997_0442"
FT   tRNA            388949..389024
FT                   /locus_tag="JJD26997_0442"
FT                   /product="tRNA-Phe"
FT   gene            complement(389132..389208)
FT                   /locus_tag="JJD26997_0443"
FT   tRNA            complement(389132..389208)
FT                   /locus_tag="JJD26997_0443"
FT                   /product="tRNA-Met"
FT   gene            complement(389262..390362)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0444"
FT                   /note="putative rod shape-determining protein RodA; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts; identified by match to protein family HMM
FT                   PF01098"
FT   gene            390441..391409
FT                   /locus_tag="JJD26997_0445"
FT   CDS_pept        390441..391409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0445"
FT                   /product="ribosomal large subunit pseudouridine synthase,
FT                   RluA family"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43754"
FT                   /db_xref="GOA:A7H2A0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2A0"
FT                   /protein_id="ABS43754.1"
FT                   /translation="MQTFLVDKNSRLDVFLAKKLNQSRNQVALLIEKDCVQVNDKIQDK
FT                   NSFKLKNGDIISITSLKLYDEIKPQFEVDFDIDILYEDEDLLVLNKPSNLVVHGASSVK
FT                   NATLVDWLIEKKYTLSNLGGEIRAGLVHRLDKDTSGAILIAKNNFTHQKLSEQLADKSM
FT                   GRIYLALIDLPLKEDKIIVEKFLMRSPSNAIKKIAIDKENKFSKNAKSAFINVVKTENL
FT                   TLMAAKLFTGRTHQIRAHLASLNRHILGDSLYGYKGKYDCRIMLHAYFLYFIHPKTKEQ
FT                   IFVKAPLMEDFKNIMFEQINLGENDEKISLEFLLEFFNSFA"
FT   gene            391357..392586
FT                   /locus_tag="JJD26997_0446"
FT   CDS_pept        391357..392586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0446"
FT                   /product="fibronectin type III domain protein"
FT                   /note="identified by match to protein family HMM PF00041"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43443"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2A1"
FT                   /protein_id="ABS43443.1"
FT                   /translation="MKRFRLSFYLSFLTLLLSACSVLQMNSLASSKELTVNESLPKVES
FT                   LKSLSDMSNIAFEWESLYDENIKGFYLYRSSDENPDFKLVGTIKDKFQTHYVDTKLEPN
FT                   TKYRYTMKSFNEQGQISEDGKVIEVSTAPRLEAVPFVQAVTNLPNRIKLIWRPHPDFRV
FT                   DSYIIEKTKGDKEFKKIAEVKNRLNAEYIDNDLKSNENSSYRIIAVSFNGIKSEPSQVV
FT                   SSASKALPPQVEHLSASTDGSNKIILTWDAPTYEDFSYYKVYSTSLSFLPFSVLAKTDK
FT                   NSYEDIVEGAGKSKYYKVTMVDKDGLESPMPKDGVEGKTLSNPLAPSIILAQSTSEGIN
FT                   LEWSDGDTRAVEYEVRRYGGKQNAVFKGIKEKRLKDVKALPGVEYNYEVIAIDSVGLRS
FT                   KPSSKVKAAQ"
FT   gene            392586..393764
FT                   /gene="trmB"
FT                   /locus_tag="JJD26997_0447"
FT   CDS_pept        392586..393764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="JJD26997_0447"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM TIGR00091"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43838"
FT                   /db_xref="GOA:A7H2A2"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2A2"
FT                   /protein_id="ABS43838.1"
FT                   /translation="MPNFKSKKIKEINLPYSKDDVEFLWFAKNDNVSLIYTKVQEESFF
FT                   LQIKKAQNGFVIKGDKHTKPSKIGYLQKALKIFKEGFCEDIINEAFGLKNNALIEKTPF
FT                   IVDNFDELLSKLQGKIYIEIGFGSGRHLLYQAKENPNVLILGVEIYNPALTQVAKLAKA
FT                   QNVNNILLIQSDARLLLSVLKSKSVEKIFLHFPVPWGKKPHRRVIGKDFCKECARVLVQ
FT                   NGRFELRTDSFEYFNFTLEQFLTFPAPKFSLRKNENLEISSKYEDRWKKQEKNIYDLWV
FT                   WNFNQECQNYELNEFNLSSVEFSKEDLKKIEQNFKNITIKKDDFFLHFESIYKQDENLL
FT                   LKVAFGAFNKSEHCYLHLDKTIDFAFKEPFKIQENIKAINELKEILKVQFKI"
FT   gene            393826..394491
FT                   /gene="lolD"
FT                   /locus_tag="JJD26997_0448"
FT   CDS_pept        393826..394491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolD"
FT                   /locus_tag="JJD26997_0448"
FT                   /product="lipoprotein releasing system ATP-binding protein
FT                   LolD"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44798"
FT                   /db_xref="GOA:A7H2A3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2A3"
FT                   /protein_id="ABS44798.1"
FT                   /translation="MPNLIQANKLTLGYDELVIKEASFAFKNDDFVFITGKSGSGKSTL
FT                   LKSFYGDLEPISGKLEVCGSLMNKIGNLELLKLRQRIGIIFQDYKLVQEYSVEKNVMLP
FT                   LMIKGYSKKVCHDQVAKLLKHVNLTFKADKLPNQLSGGEQQRVAMARALAHNPKLLLCD
FT                   EPTGNLDEYSSDIIWTLLKSARELLGTCVIVVTHRIPSNLRVDYRRFNIENGKMNEIF"
FT   gene            394517..395284
FT                   /locus_tag="JJD26997_0449"
FT   CDS_pept        394517..395284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0449"
FT                   /product="putative cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43215"
FT                   /db_xref="GOA:A7H2A4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2A4"
FT                   /protein_id="ABS43215.1"
FT                   /translation="MLFMMFAFEFILITNATLKHYEELVNKDYNIIVVSKTELDQNVVK
FT                   TKIPFFSGLESLDPKDLIDRLKNDVSEKNLKVLKDSLPKFYTLKLNSLPDQNELNSIKN
FT                   QLLNIVGVSKVETFSKTHDKIYSLLILMKFVFWLFLFIIILLAFVLFLKQMRIWLYEHT
FT                   DRIEIMCLFGAPFWFRSFMLYKVVVVDCFIAFVILLAFFTQIFDLSIIQENLKAVDIIF
FT                   PPINFILHLTLIFLATLFICLLCVNTVMFKVKR"
FT   gene            395281..396474
FT                   /locus_tag="JJD26997_0450"
FT   CDS_pept        395281..396474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0450"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43914"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2A5"
FT                   /protein_id="ABS43914.1"
FT                   /translation="MRKNILIFFCFFLFVDISLANAINEKTKSLEENKRIQEQLNKKLE
FT                   DLASDILNGEKSLKDLSLQIESLNSQTSKLEASAKAQNQELNTLTSQNEDLLKSKSNME
FT                   GKLISLMAKDFAYDLPIPQGYIESEESFMAFEILGSLSKVLNEEIFKISKDYEGISRLI
FT                   DNKQAQIKRINESLKDYNAQLAKLQSLKQKQISEINKQKTDRAIYAKKLDDLQAQQEEL
FT                   RKTLNQLKIINHKEDTNSNKNDTKIVKNNQQIRQLGSSYQGSSVKRYTGKKTIAPLDSF
FT                   TVKQKFGNYIDPVYNLKIFNENVVLRSNKSDAVVKNVLDGKIVFAKDTSMLARVVIVEH
FT                   DNGIHTIYAHLDKIAPNIKVGKNIKKGAVVGRIKNDLTFEVTQKNFHINPLELISLN"
FT   gene            396526..397245
FT                   /gene="pyrH"
FT                   /locus_tag="JJD26997_0451"
FT   CDS_pept        396526..397245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="JJD26997_0451"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44550"
FT                   /db_xref="GOA:A7H2A6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2A6"
FT                   /protein_id="ABS44550.1"
FT                   /translation="MQERKRVLVKFSGEALAGENGFGIENSILKFIASEIKELIKNQIE
FT                   VGIVIGGGNIIRGVSAAKGGLIKRTSGDHMGMLATVINAIAIQEALERSGLEVRVQSAI
FT                   QMEAFCETYIMRRAQRHLEKGRVVVFAAGTGNPYFTTDTTAILRAVEIDADMVIKATKV
FT                   NGVYDKDPKQFDDAVFLNTLSYDEAMQDNIKVMDDTAIALAKDNKLPIVVCNMFEEGNL
FT                   LKIIQGDTSLCSIVKNN"
FT   gene            397256..397480
FT                   /gene="rpoZ"
FT                   /locus_tag="JJD26997_0452"
FT   CDS_pept        397256..397480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="JJD26997_0452"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43602"
FT                   /db_xref="GOA:A7H2A7"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2A7"
FT                   /protein_id="ABS43602.1"
FT                   /translation="MDKRIEEVAAKALEKMGNDRYRLSLVVAKRAEQLANGATPLVDFD
FT                   KNKNKLADIALYEIAENKITLEGLVETNR"
FT   gene            397488..399659
FT                   /locus_tag="JJD26997_0453"
FT   CDS_pept        397488..399659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0453"
FT                   /product="RelA/SpoT family protein"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM PF02824; match to protein family HMM PF04607;
FT                   match to protein family HMM TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44393"
FT                   /db_xref="GOA:A7H2A8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2A8"
FT                   /protein_id="ABS44393.1"
FT                   /translation="MLEQLIDNVKNCKDLEAAKALLFEICGHDAILEKAVDYCIFCHEG
FT                   QFRKSGEPYAVHPILVATLVGFLSENKSNILAALLHDVIEDTNCTEEELREQFGSEVLK
FT                   LVLGLTKIIEIREDNLISSKSKKSLTKSALTFRNMLLASIEDVGVLIVKLCDRLHNMLT
FT                   LDILREDKQKRISEETLVVYAPIAHRLGISSIKNYLEDLSFKYLMPDEYKLIDNYINSN
FT                   NQEMQLGLNEFISKIELLFLSNGFRQGSFEIQKRIKHSYSIYLKMQRKGIGIEEVLDLL
FT                   GVRILVEKVSDCYLALGILHTHFNPLVSRFKDYIALPKQNGYQTIHTTLFDAKSIIEAQ
FT                   IRTFDMHKIAEFGIAAHWKYKEDGSVVAPRLDWLTDISMQSINNLENAEDYNAIELYEY
FT                   AKDSLYVEDVAVYSPKGEIFTLPRGATVLDFAYEVHTKVGLHAKSAYVNRIKVPLLTEL
FT                   KNGDIVRVVTSNDKFYRCSWIDSVKTGKAKASIREFCKQKIREINLASSINMLSFIFGV
FT                   DKNRIETWIEKENLARRIRQVATDSAYLKDIVNGLKKYAKKSYWFDKYEIKEQKIGNFT
FT                   LYCNHKIANVDFDFCCHPKRGDAVLAFVKGGNAIVHHKLCDRADKMIDNNQDMVFIKWD
FT                   SNIPKSYKLIFSLENKKGVLAEFLAFLAKMQINLLTINLSSDLNLAVDYFEITMEIPDN
FT                   INPDSVKDRLKSRCKILDFTSLNDAYKEG"
FT   gene            399671..400876
FT                   /gene="tyrS"
FT                   /locus_tag="JJD26997_0454"
FT   CDS_pept        399671..400876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="JJD26997_0454"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00234"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43428"
FT                   /db_xref="GOA:A7H2A9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2A9"
FT                   /protein_id="ABS43428.1"
FT                   /translation="MDIKKILAEVKRGCAELIDEERIEKLIKNYYEKGENFFIKAGFDP
FT                   TAPDLHLGHSVVLTKMAFLQKHGAIVQFLIGDFTGQIGDPSGKSATRKKLDKEQVLINA
FT                   KTYETQVFKVLDKEKTQIKFNSTWLNELGAAGIVELASTFSVARMLERDDFTKRFKEQS
FT                   PISICEFLYPLLQGYDSVALKSDIEMGGTDQKFNLLMGRQLQRIYSIGKEQAVIMMPLL
FT                   EGLDGVNKMSKTLNNYIGVTEKANDMYAKILSISDELMFRYYELLSQKSLEEIAQIKKD
FT                   IEQGNLHPKKAKENLALEITERFHSKEEANNAKSEFDRIHSQNALPSDMAEFEIQGKIW
FT                   LAKALVECGLESSTSAARRSISANAVSVNSQKVSDEQMHLEQGEYILQIGKRKFAKLKV
FT                   KE"
FT   gene            400873..401964
FT                   /locus_tag="JJD26997_0455"
FT   CDS_pept        400873..401964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0455"
FT                   /product="oxidoreductase, 2-nitropropane dioxygenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44166"
FT                   /db_xref="GOA:A7H2B0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B0"
FT                   /protein_id="ABS44166.1"
FT                   /translation="MNLQPLQIGKHTIKYPIFQGGMGLGISWDRLASAVSLNGGLGIIS
FT                   SVGTGYYEERKYASKELNAKPYGSENFYSRKGLQALINNARKVCGDAPLGCNILCASND
FT                   YARIARDACEVGFNVIVSGAGLPTNLPEFTADFPDVALVPIISSAKALKIICKRWQSRY
FT                   NRLPDAVVLEGPKSGGHQGFTYEQCLDPNYQLEKLIAPVVEEVKNWGSFPVIAAGGIWD
FT                   KKDIKNAISLGASGVQMGTRFIGTFECDASEEFKSVLLASKEEDIELIKSPVGYPARGV
FT                   RTNLLNLVDKRMGPKINCISNCVAPCGRGKEATKVGYCIADRLFDAWSGKKETGLFFTG
FT                   ANGYRLDKLISVKELMEKLVNGE"
FT   gene            401964..403943
FT                   /locus_tag="JJD26997_0456"
FT   CDS_pept        401964..403943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0456"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01520"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43236"
FT                   /db_xref="GOA:A7H2B1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B1"
FT                   /protein_id="ABS43236.1"
FT                   /translation="MAKIFVFLVFVFTTLFGAYENELANFDKNFIGSKSEVQVKFHHQL
FT                   KSLYIQSIINEDEKTKMEILKRLIISSNTLNLDDKSYANELKESGISEASINALRKAVI
FT                   KDIKVQNISQDTEKSTFEPIKTVQKNEKKSSNEQVKNTEKTNSKTSQAPKSSIASKAKS
FT                   DDKIYVLKSSKTNQGVEFELNADLDKDQLKSFALDEKGNYRFISDFDGVLEGGKKEFKF
FT                   DDYRLVISQFNPKTIRIVVYAKEKIPIDISFKEEKLIFSKETVNQKKTEQDSKISEKKQ
FT                   DQKTEIKTKVLETKKQDKKTNNEKENQEPLYVLDVDKISNAVVLNLSDDLDEKEIAVFD
FT                   TKDQKFRYVVSFKGVLEGNRKSFTFGQNVITVTQYNPKTVRVVLSAPKEFKLLKELDNK
FT                   NLTLGFYTQTTNQNVNKKATQSSSKTLNTNYKSGKLVVIDAGHGGKDSGALSDKKGSLK
FT                   EKDIVLSTALKLGNELKKRGYKVLYTRSSDKFINLRDRTKYANDKRADLFISIHTNAAP
FT                   NATKAKSSEGVETFFLSPARSERSKKAAEKENQGDFEEINYFSKQSILNFLNREKIVAS
FT                   NKLAIDVQKNILTQTRKKYKIVDGGVREAPFWVLVGAQMPAILIEIGYITHPNEGKRIS
FT                   NKAFQDLLVKGIADGVESYFYNNR"
FT   gene            403940..405781
FT                   /locus_tag="JJD26997_0457"
FT   CDS_pept        403940..405781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0457"
FT                   /product="oxidoreductase, FAD-dependent"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF05430; match to protein
FT                   family HMM TIGR03197"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43848"
FT                   /db_xref="GOA:A7H2B2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2B2"
FT                   /protein_id="ABS43848.1"
FT                   /translation="MKKAKLIFKDNTPFSLDFDDFYFNSKDGLNESKFVYTHSFEWKNQ
FT                   ENFIITESGFGIGLNFFLTLKRFLETTPSKRPKKLFYISVEAFYIEKEQLREIYQKLRF
FT                   YEEFKELLEHFLKFYPKAKEGIYRFYFEDCFLDLVFEDITILKELDFKADVWYLDGFSP
FT                   NKNSQMFDENLIFEVARLSKKNTQICTFSSASFLQKNLKKYGFRVEKTKGFRKREMIKA
FT                   YLENELEFKDKEAYFSRTFSSLKNKKVAIIGAGISSAVLAYELSLRGFKIDVFEKHLEL
FT                   GKGASGNESGILSSLILKSKVKLGEFSELSFIEASRFYRQILDLNFKGVVEFAHNDLMQ
FT                   ERFDTQRENVLFKISKNQAFLEEGGVIFPKNLVKNLFEKSKACIYFNHEFQAYKFENEC
FT                   FTLKFKNDIVKSDYAVLIYAMGADTKDFVFYDEMKLSKVRGQVTHLKPFLDTQFPLSSK
FT                   AYICPIKDDLQVIGASYDRLDASLESKEEDDKQNIENIAEFIDKNTKLEIIGSKVGFRS
FT                   YSSDRFMIVGNAYDEAFYKEEYKALLWTKDKEQKPAKMSCNLYFNFAHGSRGFSTSVLA
FT                   ARYLCALINNEPLCLEKKYIHAIHPARFLVRKLKKGL"
FT   gene            405901..407040
FT                   /gene="hydA"
FT                   /locus_tag="JJD26997_0458"
FT   CDS_pept        405901..407040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydA"
FT                   /locus_tag="JJD26997_0458"
FT                   /product="quinone-reactive Ni/Fe-hydrogenase, small
FT                   subunit"
FT                   /EC_number="1.12.5.1"
FT                   /note="identified by match to protein family HMM PF01058;
FT                   match to protein family HMM PF08425; match to protein
FT                   family HMM TIGR00391; match to protein family HMM
FT                   TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44169"
FT                   /db_xref="GOA:A7H2B3"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B3"
FT                   /protein_id="ABS44169.1"
FT                   /translation="MIDYHQIESRLSALEKLPSLKDNDSIAKALEKSGFSRRDFMKWAG
FT                   AMTAFLALPASFTPMVAKAAELADRLPVVWLHMAECTGCSESLLRSDTPTIDSLIFDYI
FT                   SLEYHETVMAAAGWQAEENLESAIQKHKNKYILMVEGGIPMGDTEHFLTIGAHGKTGYE
FT                   LSKMASENALAIFAIGTCSSFGGIQAARPNPSNAQPLSKVTSKTVINVPGCPPSEKNIV
FT                   GNVLHYLLFGELPALDVYNRPKWAYGLRIHDLCERRGHFDAGEFVHAFGDEGAKQGFCL
FT                   YKVGCKGPYTFNNCSRERFNQHTSWPIQAGHGCIGCSEPDFWDTMGPFEEPMASRKFDT
FT                   VFGLGADSVSDKIGIGVLTLTGVAIAAHAVISSMQKDKE"
FT   gene            407043..408758
FT                   /gene="hydB"
FT                   /locus_tag="JJD26997_0459"
FT   CDS_pept        407043..408758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydB"
FT                   /locus_tag="JJD26997_0459"
FT                   /product="quinone-reactive Ni/Fe-hydrogenase, large
FT                   subunit"
FT                   /EC_number="1.12.5.1"
FT                   /note="identified by match to protein family HMM PF00374"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43720"
FT                   /db_xref="GOA:A7H2B4"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B4"
FT                   /protein_id="ABS43720.1"
FT                   /translation="MSQRIIVDPITRIEGHLRVEVVVDDNNVVKEAYAGSTLWRGIETI
FT                   VKGRDPRDAGFMTQRICGVCTFSHYKAGIVAVENALGITPPLNALLTRTLMNATLFLHD
FT                   HIVHFYQLHGLDWADVVSALSADVKKASDEAFKYTPNPYATGADKLLEVQQRLKTFVDK
FT                   GNLGPFANAYYGHPTYRLTPEQNLIVLSHYLECLRIQRIIAQCMAIFGAKNPHPQSLTV
FT                   GGVTCVMDLLDPARMGEYMVKFQEVQDFVNRAYYPDLAMAGKAYAHEASVLNDIGVNNL
FT                   YTFKEFQIGRDEWLFESGIIKNGDLSKVYEVEEDKITEEATHSWYADNEPLHPYEGKTN
FT                   PNYTGLVDGESMDHHGNNVHSKVFDTKGKYSWIKAPRYEGNPMQVGPLANIVVNYAKGN
FT                   PNVVPVVDEFLKETGLPLNAVFSTLGRTAARCIEAKIVANNALKAFNNLVENLKVDQST
FT                   CAPYVIDNSKEYKGRYMGHVPRGTLSHWCRIKNGVIENWQAVVPSTWNASPKDANGVGG
FT                   SYEQCLIGLKIADVKQPLEIIRKIHSYDPCIACAVHVMDTKGNNLSEYKVNVNL"
FT   gene            408745..409461
FT                   /gene="hydC"
FT                   /locus_tag="JJD26997_0460"
FT   CDS_pept        408745..409461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydC"
FT                   /locus_tag="JJD26997_0460"
FT                   /product="quinone-reactive Ni/Fe hydrogenase, cytochrome b
FT                   subunit"
FT                   /EC_number="1.12.5.1"
FT                   /note="identified by match to protein family HMM PF01292;
FT                   match to protein family HMM TIGR02125"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44824"
FT                   /db_xref="GOA:A7H2B5"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B5"
FT                   /protein_id="ABS44824.1"
FT                   /translation="MSIYKEAFMQNKEEKLQRKAEYEFSIGLRLTHWVRAVAIVILIGT
FT                   GYYLSYVFQSPISNGEPVNFMQAKYRLVHQAVGFVLIACIVFKVYLFFCDKISAKERRS
FT                   VWDIFNIKLWIEQVKFYIFLGKHPHLKGVYNPLQFVTYFFFYLVILGIILTGLILYTHT
FT                   YHEGLGGFLYHILRPLEAAMGGLADVRTYHRILMWVIMIFVPVHIYMAIFNAVKGKDGA
FT                   MDAIISGYKYVKEEKH"
FT   gene            409458..409994
FT                   /gene="hydD"
FT                   /locus_tag="JJD26997_0462"
FT   CDS_pept        409458..409994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hydD"
FT                   /locus_tag="JJD26997_0462"
FT                   /product="hydrogenase maturation protease HydD"
FT                   /note="identified by match to protein family HMM PF01750;
FT                   match to protein family HMM TIGR00072"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44591"
FT                   /db_xref="GOA:A7H2B6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B6"
FT                   /protein_id="ABS44591.1"
FT                   /translation="MKFLVLGIGNIMFADEGLGVHLCKQLEKNYKFSHPDFTLDFIDGG
FT                   TLALQLSYIIARYDRLIVLDCIEAENASIGDVFFFPYDAMPNKISWSGSAHEIEMLQTL
FT                   QYMELAGDLPKTHILACVPKRIEAMSFKLSDELIQGAEIMEKTLLNFLSKEGFVYEKIA
FT                   DFSLQELADISYKND"
FT   gene            complement(409991..410563)
FT                   /gene="recR"
FT                   /locus_tag="JJD26997_0461"
FT   CDS_pept        complement(409991..410563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="JJD26997_0461"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF02132;
FT                   match to protein family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43869"
FT                   /db_xref="GOA:A7H2B7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2B7"
FT                   /protein_id="ABS43869.1"
FT                   /translation="MAKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLA
FT                   HNIENAIRFIKPCEQCGALSENELCEICSDEERSKNILCIVESPKDILTLEESQSYNGL
FT                   YFVLDELNEEKLEKLKQILLKLNISELIFALTHSINSDATIFFIEDKFKDLNLTFSKIA
FT                   QGIPSGVNLENVDLISLNKAMNFRTKI"
FT   gene            complement(410563..411729)
FT                   /gene="racS"
FT                   /locus_tag="JJD26997_0463"
FT   CDS_pept        complement(410563..411729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="racS"
FT                   /locus_tag="JJD26997_0463"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43717"
FT                   /db_xref="GOA:A7H2B8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B8"
FT                   /protein_id="ABS43717.1"
FT                   /translation="MLFIVLLKIEGSAYNEEESLKQENLIKNLLISYENTSGAKIGSYL
FT                   ENSGFNAIQNPHLVKTIRNNGQLLFKADGELCTLSSLKYHSNLYFDIQCKNFDGLYEDN
FT                   TSDRVYNLLLIGFFSFSLLVVFMYFSVLKSLEPLKKLRRQVAEVTNGEQPDFLDYQEDE
FT                   VGKIAFEFQKAFKKNQELIQSRQLFLRTIMHELKTPIGKGRIISEMIKEDRQKERLIAI
FT                   FLRMDSLINEFAKIENLFSKNYNLHFKPSRFSAILEEAKEHLMRDDFNKVVKVDIRYDA
FT                   LINVDMEIFSVILKNLIDNALKYSSNGTCELFCCKECFTIKNPGKPLAEPIEHYLEAFT
FT                   REKHNQVKGMGLGLYIVSEVCKLHNFDLIYFYDDGKHCFKIFFGDKEK"
FT   gene            complement(411795..412466)
FT                   /gene="racR"
FT                   /locus_tag="JJD26997_0464"
FT   CDS_pept        complement(411795..412466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="racR"
FT                   /locus_tag="JJD26997_0464"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44441"
FT                   /db_xref="GOA:A7H2B9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2B9"
FT                   /protein_id="ABS44441.1"
FT                   /translation="MINVLMIEDDPDFSQLLSEYLAQFNIKITNFENPKSALNVGIRGY
FT                   DCLILDLTLPGIDGLEVCREIRQKNNIPIIISSARGDLSDKVVGLQIGADDYLPKPYDP
FT                   KEMYARIMSLIRRTKRVEHANNENINSAFKIDERRHEITYEDKALTLTPAEFEILEYLI
FT                   QQHGYSVSREQLVSRCKNLKDKDSKSLDVIIGRLRVKIGDSSKSPKHIFSVRGIGYKLI
FT                   G"
FT   gene            412620..413744
FT                   /gene="dnaJ-2"
FT                   /locus_tag="JJD26997_0465"
FT   CDS_pept        412620..413744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ-2"
FT                   /locus_tag="JJD26997_0465"
FT                   /product="co-chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44353"
FT                   /db_xref="GOA:A7H2C0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2C0"
FT                   /protein_id="ABS44353.1"
FT                   /translation="MEISYYEILEITQNADKETIKKAYRKMALKYHPDRNQGDKEAEDK
FT                   FKLVNEAYEVLSNDEKRAIYDRYGKDALKGGGFGSNSSGFGGFEDLGDIFSSFFGESFG
FT                   SSSRRRKSSNDEKIPSDFIFNLKLSFKEAVFGCKKNIDFTYKCSCKTCNGTGAKDGKLQ
FT                   TCPKCQGRGQVGVSQGFITFAQTCPDCQGSGEKASEKCNDCKGLGYNESKDSVELNIPE
FT                   GVDTGMKLRVNAKGNILKNNTRGDMYVKIIAAEDDTFIRDDDDIYIEFPVFFTQAILGQ
FT                   SIKVPTIRGEVTLNLPKGAKDGQRFVLEKEGVKDVHSSRIGNQIVQISIKFPTSLNDEQ
FT                   KELLEKLSESFGIKDGMHQEQKGLFEKIANWFKS"
FT   gene            complement(413861..415183)
FT                   /gene="porA"
FT                   /locus_tag="JJD26997_0466"
FT   CDS_pept        complement(413861..415183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porA"
FT                   /locus_tag="JJD26997_0466"
FT                   /product="major outer membrane protein"
FT                   /note="identified by match to protein family HMM PF05538"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43354"
FT                   /db_xref="InterPro:IPR008439"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C1"
FT                   /protein_id="ABS43354.1"
FT                   /translation="MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGILRYRFDSA
FT                   SFDKNFPSKESLNTSKQMHKYRAQLNFNSAIADNFKTFIQFDYNAQDGGYGAKQVRNDF
FT                   KPLNVRQVYLTYTNEDVATSIIAGKQQLNVLWTDNGIDGLVVTGVKVVNNSIDGLTLAA
FT                   FAVDSLMASEQEGDLIGTKDGIKTDDTSVYNDPFSPYVLGNQHKLSASGNLYGAAVIGS
FT                   YDFMGGQFNPQLWLAYWGKMAFFYGLDLAYSTTVFDGINWTIEGAYLGNSVDNRLEKEG
FT                   KIGNGNFFALRGSIEANGWDASLGGLYYGEKDKVTTTVIEDQGNLDSLLAGQEIFNTTG
FT                   SRLNGDTGRNIFGYVTGGYAFNETVRVGAEFIYGGTKSGSATYLGTSGSKKLEAVARVN
FT                   YKYSPKLNFSAFYSYLNLDQGKNTNKSADHSTVRLQALYKF"
FT   gene            complement(415435..415890)
FT                   /locus_tag="JJD26997_0467"
FT   CDS_pept        complement(415435..415890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0467"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43351"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C2"
FT                   /protein_id="ABS43351.1"
FT                   /translation="MKKILFICLGNICRSPMAEFIMKDLVKKANLEKEFFISSAGTSGE
FT                   HDGEGMHYGTKNKLAQLNIEHKNFTSKKLTQKLCDESDFLITMDNANFKNVLKSFTNTQ
FT                   NKVLKITDFSPSLNYDEVPDPWYSGNFDETYKILSLACKNLLVFLSK"
FT   gene            415944..417128
FT                   /locus_tag="JJD26997_0468"
FT   CDS_pept        415944..417128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0468"
FT                   /product="multidrug resistance efflux transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44217"
FT                   /db_xref="GOA:A7H2C3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C3"
FT                   /protein_id="ABS44217.1"
FT                   /translation="MENFNRTLLVCWFGVFTTSMGLSQIAPILPFYIKELGHVDTSEIA
FT                   FYSGLAFGITPLFMAIFSPLWAFLGAKYGYKNMLLRASFGMSVLTLWLSFAHSALEVVF
FT                   VRGLTGIISGFTSAAVVFIAVIAPKEKVAYALGTFSTASISGSLLGPLFGGFVAEFFSI
FT                   SAVFDVVAFLIACSFVTIYFFIHERKIQKEAKKNTQKVKENKTFIIVLFITTFVMQFGT
FT                   FGVMPILSIYVEQIHQGGNLALWAGIVVAASGISNLFFAPKLGKIADKIGPSKIIFGAL
FT                   IFCGICFYLQAVASNVYTLIFVRLLIGIGLGGLLPCVNALLKKSVSAKNLSVIFGFNQT
FT                   CQFLGNFCGAFGGGLMASHFSVEFVFTFVCLIFIINAFIFLAFEKKYIFSNQGL"
FT   gene            417147..417809
FT                   /locus_tag="JJD26997_0470"
FT   CDS_pept        417147..417809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0470"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44368"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C4"
FT                   /protein_id="ABS44368.1"
FT                   /translation="MEMILFVLVMILLVLLFIVLFRQYKSPKIEEKSTQSFSDIMQLKS
FT                   IGELSVFQVFSKEIVTKKDSAFNGIWKNLLGWSLSERQIALIFEFEITFLYDLRDKNFD
FT                   ILPLGDDAYKIIMPECRYKHSIIDMKFYDEKNAKFLPFLLPDSINSTGISFSESDKNKL
FT                   IKEAKDEVKDLSLNLIQNLESKIHKSAKDTLEAIAKGFGAKRVKFEFKDNTQKLDVN"
FT   gene            complement(417806..418015)
FT                   /locus_tag="JJD26997_0469"
FT   CDS_pept        complement(417806..418015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0469"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01361;
FT                   match to protein family HMM TIGR00013"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43466"
FT                   /db_xref="GOA:A7H2C5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C5"
FT                   /protein_id="ABS43466.1"
FT                   /translation="MPFVNIRITKENGEPTTEQKQELIAGVTDLLAKVLNKNKSSTVVI
FT                   IDEIDTDNYGLGGKSITQVRKEKS"
FT   gene            complement(418073..418555)
FT                   /locus_tag="JJD26997_0471"
FT   CDS_pept        complement(418073..418555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43882"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C6"
FT                   /protein_id="ABS43882.1"
FT                   /translation="MSEFLTHPFKPFFDKDSKILILGSFPSVKSRQYGFYYQHPRNRFW
FT                   PILETLFNVKLENITEQQAFLRKKHIALWDVLQSCKIKNSDDKTISYAKANDLNLILSQ
FT                   AKIQAIFTTGQSAYKFFVKFHPRLETIALPSTSPANLNFSFEQLLQNYEIIKKFTK"
FT   gene            complement(418552..420708)
FT                   /gene="pnp"
FT                   /locus_tag="JJD26997_0472"
FT   CDS_pept        complement(418552..420708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="JJD26997_0472"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF01138; match to protein family HMM PF03725;
FT                   match to protein family HMM PF03726"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44081"
FT                   /db_xref="GOA:A7H2C7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2C7"
FT                   /protein_id="ABS44081.1"
FT                   /translation="MQYSIEINKNTEIFDIDKVAKQATGVLMRQGKSVVLATVAREEKQ
FT                   VEEDFLPLTVQYIEKAYAAGKIPGGYVKRETKPSDAETLTARIIDRSLRPLFPKGYAYP
FT                   TQIVVMVLSADPKVDLQVMSLNAASVALYLSDIPMKAPVCGVRIGKIDGNFILNPNNEE
FT                   LQNSTLDLYVAGVKDELLMIEMRALPDQKENEIFIEAPYADVLTQTTSQNMNELSEDEI
FT                   LEALNLAQKAILNGSNAYEEAFSKHKKNSQIELKNEIEHPEILAFIENNFQKQIKKAIN
FT                   QMAKSERASELNKIAKEILNLEIAKDWSEESILNTLAKVKRKLIREQILNEGKRADGRS
FT                   LNEVRPISIETNILPNAHGSCLFTRGQTQALVVATLGGENDAQMIDLLTEKNPISERFM
FT                   VNYNFPGFSVGEASPIKAPGRRELGHGNLAKRALYPSVDENYPYVIRLVSEILESNGSS
FT                   SMATVCGGSLALKAAGVPSLKLVAGVAMGLIFEDNKYAVLTDIMGLEDHDGDMDFKVAG
FT                   SKDGITALQMDIKLGGIDQETLKQALYQAKEGRIHILNIMEEATKEIIVNEEVLPKLEL
FT                   FSVDPSKIVDIIGQAGKTIKEIIEKFGVSIDLDREKGEVKIAGSQNEQIKAAKDYIINI
FT                   TSSQKGTKKGSKDKDISDFELGQEFQGIVKKIAPFGAFVELKNGVDGLLHSSKIKHLDL
FT                   SENQSLKVKISEIKNGKISVDLCE"
FT   gene            complement(420778..422805)
FT                   /locus_tag="JJD26997_0473"
FT   CDS_pept        complement(420778..422805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0473"
FT                   /product="putative organic solvent tolerance protein"
FT                   /note="identified by match to protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44199"
FT                   /db_xref="GOA:A7H2C8"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C8"
FT                   /protein_id="ABS44199.1"
FT                   /translation="MLGTSIALNAAQVDIYALDAKKEGDILTANNDVIIFSDFYFITAN
FT                   KAIYNEKTGDVELFGNVNILRGQNERSHSDYAKINLDSNQADFSNFFFSNNNLEVWFQS
FT                   KTSHLNDKVFESKISAVSSCNVEDPDWEIRFSKGWLNRETNFVHLYNARLYVKNTPVFY
FT                   LPYFGFSADTHRQSGLLIPKIVLKSNEGLYYEQPIYIATQENWDLELDPQIRTNRGFGL
FT                   YSTLRFLDSPYSTGELNFGAFRENSSYFHDENLKNQTHYGIELKYSRDDLIKSLLSDNF
FT                   QEGLWIDATYLNDVDYLNLGSRDYRDLNSLVTSKINYFLADENNFYGAYARYYIDTSKL
FT                   SNNTTLQEYPSFQYHRFLNNLFDERLRYSFDASFHNFYRPAGSYANELNLDLPISYHNA
FT                   FFGDFLHFTFTERFYASFANYSNDPERNHEHYFRNTHDFNLYTDLSKAYENFFHTLNLG
FT                   VNYVLPGVKSGKITQDYLEEYDKENEHTSLYAVQYFYNNEGQKKLKHRISLDYLNKQNE
FT                   FYELENLLTYYFNENINLNSEVLYSYEQSRFTNVISQIEVNTNSKFNWMFSHAYQNDEY
FT                   GKYSFIGTRANYIATPNYNLFGGIWFDTQRAHANMWELGYTYQRKCWNYSLMYRERIDP
FT                   QLTSGGITAKNQSGVYFIFNFYPLGGVKYDFSLAESENKI"
FT   gene            complement(422816..423268)
FT                   /locus_tag="JJD26997_0474"
FT   CDS_pept        complement(422816..423268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44712"
FT                   /db_xref="GOA:A7H2C9"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2C9"
FT                   /protein_id="ABS44712.1"
FT                   /translation="MKENLQNRLERENLKIASFGKRVLAFLIDDMVISLIVFIIFYDHL
FT                   IQAKDLFETTQIIGNFYLGFILLHFSYQTIFTYLYGASLGKILCKIIVLDENLLDKPNL
FT                   IQSCIRSAIRQVSAMAFMLGFAWALSNDLRKAWEDYLARTIVVDVA"
FT   gene            complement(423265..424515)
FT                   /gene="purD"
FT                   /locus_tag="JJD26997_0475"
FT   CDS_pept        complement(423265..424515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="JJD26997_0475"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM PF02843; match to protein family HMM PF02844;
FT                   match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44407"
FT                   /db_xref="GOA:A7H2D0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2D0"
FT                   /protein_id="ABS44407.1"
FT                   /translation="MKIMILGSGAREYSIALALRRVDKNLEFYFAPGNGATESLGTNLN
FT                   LKDPVVLATYAKEKGFDLCIVGSESFLAEGVVDIFKQQGLAIFGPSKAAAMLETSKSFM
FT                   KSFLKKYRIKTAKFLNTNDIEKAKNFIYSLTPPIVVKADGLCAGKGVIIAKTHEEAIEE
FT                   TAKMLSGESFGDAGKLVVIEEFLDGYELSIFAVCDGNDFVLLPAAQDHKKLLDNDQGPN
FT                   TGGMGAYAPSSLANESLLRKVQKDIILPTLAGMKKEGVEFCGVLFIGAMIVGNKPYVLE
FT                   FNVRFGDPECEVLMPLIENPLELILAATQRRLRHAKIKIKKEFAVGVVCASENYPYKSS
FT                   PKSEITVNNIPENSHISYAGVSLENGKLMADGGRVLVCVGTGKSIEEAQKNAYKLCDNV
FT                   NFKGKQYRKDIAHQVLK"
FT   gene            complement(424754..426214)
FT                   /locus_tag="JJD26997_0476"
FT   CDS_pept        complement(424754..426214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0476"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43185"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2D1"
FT                   /protein_id="ABS43185.1"
FT                   /translation="MHGKIAIYMDSTGRGTVTNSANTFFDFNRQIWNDKKSMPSVGMLV
FT                   EFRTLSSEKKAEDGKPVQTSKTITGIKPSKFQEFKEGDFITEHDFWKTDNDNELEDLQN
FT                   SRRSAYITELYRTTDFDTIEKIPLSFTIPQAIQKYFAHEILSVETLQANLQDEKEIPCI
FT                   LDYLILKRFLFKAYDTLIFMDNSIDQTQFSALKSIMMHLENSYKQMIADQKPNITKIFN
FT                   ETFLSLQCHYQALVATIDTRKNRLASLEAQMKTLQSEINLKSNATNADPEKLKARQERL
FT                   AKLQKEAEYYGTTLKRLDAIREDFYKKNYNIFENAFKLSREKLFKKIITGLNLCATIMD
FT                   VKIWHLSLKSSGVKNSYFTMSNIENSFCSLSFAEHYLSRLNKSALNPFDQKLLVYIQKI
FT                   TKEQRKKFLVVTSDLDLLCKLKIENFSQNPYYLVKYAPKKVNYQSLMRDNTFDIVYIDE
FT                   KHVWENVADIILQGKHFDKSGKTKFKLI"
FT   gene            complement(426300..427835)
FT                   /gene="guaA"
FT                   /locus_tag="JJD26997_0477"
FT   CDS_pept        complement(426300..427835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="JJD26997_0477"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44516"
FT                   /db_xref="GOA:A7H2D2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2D2"
FT                   /protein_id="ABS44516.1"
FT                   /translation="MKKADILVLDFGSQYTQLIARRLREQGVYAEILPFNVSLADIKAK
FT                   EPKGIILSGGPASVYATDAYFCDKGIFDLGLPVLGICYGMQLMAHHYKATVAPAGHKEY
FT                   GKANIEVKKDSALFKNLPKKQTVWMSHSDKVENLSQGFEVLATSENSPFCVFGNEDKKF
FT                   FALQFHPEVQHSEFGKNILKNFAKYACNCESVWNMGSFAKTQAEKIREEVGNDKVLCAV
FT                   SGGVDSSVVAALLASAIKEQVIVVFVDNGLLRSGEKEQVEFMFKNTLGIDLISIDASEI
FT                   FLSRLANVRDPEQKRKIIGNTFIEIFEEEAKKHKDVKYLAQGTLYTDIIESSVVGASKT
FT                   IKSHHNVGGLPEKINLKLIEPLKEIFKDEVRALGLELGLSKEVVYRHPFPGPGLAIRIM
FT                   GEVNRPSLELLRKADVILLEELKSTGWYDKTWQAFCVLLNVKSVGVMGDNRTYDNAVCI
FT                   RVVDASDGMTATFSHLPYEVLENISRRIINEVEGINRVVYDISSKPPATIEWE"
FT   gene            complement(427839..427970)
FT                   /locus_tag="JJD26997_0478"
FT   CDS_pept        complement(427839..427970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0478"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43374"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2D3"
FT                   /protein_id="ABS43374.1"
FT                   /translation="MILAFLFLIFFCACGYKGNPQYTSYEQNGSVKTIKKYEQLHRW"
FT   gene            427974..428468
FT                   /locus_tag="JJD26997_0479"
FT   CDS_pept        427974..428468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44739"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2D4"
FT                   /protein_id="ABS44739.1"
FT                   /translation="MGKKNNIKMTKNASAVINELMDKPHYKPLKTLFFCKDFLSSFPLA
FT                   KQRLIAKIYVKNHILNIITLHPAAYQELNHDDSKIYIKFLIKAYGQKYPLSGFVDIKDI
FT                   KIFSQKYTYAVNKNKNDEKLPKNSYLELSKGEFKNCFEDEKLFKKFEDLRELIKKGSNL
FT                   D"
FT   gene            428461..430263
FT                   /gene="uvrC"
FT                   /locus_tag="JJD26997_0480"
FT   CDS_pept        428461..430263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="JJD26997_0480"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF01541;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF08459; match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43226"
FT                   /db_xref="GOA:A7H2D5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2D5"
FT                   /protein_id="ABS43226.1"
FT                   /translation="MTKEKLENELKTLPNSAGVYEYFNQEGKLLYVGKAKNLKNRVKSY
FT                   FAFTPNLHANPGNSLRIQKMIQETVHLEFITTNSEADALILENSFIKQLHPKYNILLRD
FT                   DKTYPYIYVDFKEEFPRFEITRKLVKKSKIKYFGPFFKGARELLDALYLYYPLKQKASC
FT                   KSPCIFYQISRCLAPCDKRISKEKYREILDEAMHALLNPSVLLKNLEKQMLVLAQNENY
FT                   EEAAKIRDQIATIKDLEVKVEIDIAKLEDFEVFALAFKNSMLSTLRFVVQNGKIISVNS
FT                   KITPIKNDIQWDKNEIYKQLILENFSMDIPLLASVIYVYEEFEDRMLLEKILSQRFDKK
FT                   ISIKIPKIGEKRKICDLAFQNALLNIEKEQKNHDFTIQKELKSYFELENLPNDIEIFDN
FT                   SHLQGVANVGAMVTYSVNSWDKSKYRKFHLKHKNDYDQMREVLTRRALDFDKIPPPDLW
FT                   LIDGGKVLLDLAKEIILSTGANVDILAISKEKIDAKAHRAKGGAKDKIHSLKGEFSLSV
FT                   NDKKLQFLQKLRDEAHRFAISFHQNTKKKQDLKSSKLANLGLSLGVIQKLLAYYGNFES
FT                   IYKADFKDLAMLVGKKAAQKIKEN"
FT   gene            430265..431452
FT                   /locus_tag="JJD26997_0481"
FT   CDS_pept        430265..431452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0481"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44497"
FT                   /db_xref="GOA:A7H2D6"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2D6"
FT                   /protein_id="ABS44497.1"
FT                   /translation="MILAGIIFIFNLILAYLSIDISKLDSVTEQLKIGMFSSIFALSFT
FT                   LFIFAFRQNRNINKIYQKIFCMQNDFLNFQKKIDVDSALDLLKEKFEITGQNLTKISHE
FT                   KDRYLHLLEENLYQLGNISNAMHCLNEGYNKEINSLILNALNSQKDQIRLELNEALEHH
FT                   KSIIGTSHGKVLQFEASVAIVNNDELENFLLANLLSYFGIESTCFKNLSFDVNDFHLIF
FT                   IKDKILNENVKKNYDFIVMGRHKNTHYEYFLTLPFEKKDLENILQNKLDKVCTLKFKTP
FT                   YQNNVLLFKQNDFDATLFFNIIEKQCDKNICINSFSQLKQELSKETYRLILLDYELIKF
FT                   DLEQMRNLLSAYKKQHPQSHIIFFSKEKVRDFDCVSEVLSDVSRNDLIALLRKYC"
FT   gene            complement(431457..432359)
FT                   /locus_tag="JJD26997_0482"
FT   CDS_pept        complement(431457..432359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0482"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43775"
FT                   /db_xref="GOA:A7H2D7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2D7"
FT                   /protein_id="ABS43775.1"
FT                   /translation="MKILFGPVSSRRFGRSLGIDLSPSKKQCNFDCVYCELDPKKAQEK
FT                   QDEIISIDKIISEVKAMLEKNVEFDFLTLTANGEPSLYPHLNELILSLRSITKNKKLLI
FT                   LSNGTAVLDEDKFNALLKLDVVKFSLDSAVAKTFYRIDRALKNIDLEKMIEKMADFRAR
FT                   FNGDLIMEILVVKDLNDNEEEFKALNQALKKIMPLRVDLSTIDRPPAYAIKKVSEEKLL
FT                   ELSKLIDSTPVLLAKRHYEGEKLSFNEEELLKILHLRSQSEIDIEAKFDEQSKTLLNQL
FT                   IKEKKVKILDLAGVKFYKV"
FT   gene            complement(432356..433378)
FT                   /gene="hemE"
FT                   /locus_tag="JJD26997_0483"
FT   CDS_pept        complement(432356..433378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="JJD26997_0483"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="identified by match to protein family HMM PF01208;
FT                   match to protein family HMM TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44844"
FT                   /db_xref="GOA:A7H2D8"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2D8"
FT                   /protein_id="ABS44844.1"
FT                   /translation="MIFIDACFKKPTPYTPIWMMRQAGRYLPEYMEVRKQAGDFLSLCK
FT                   DYKKASEVSLQPIDILNVDAAIIFSDILVVPLEMGMNLRFEKGEGPIFDNPISTLEDLE
FT                   KLDDQNAHKKLNYVYNALKLTREKLSQNKALIGFCGSPWTIATYMIEGSGSKNYAKCKK
FT                   MLYQNPELLHKILNKLTQVLKLYLEEQIKAGANAIQIFDSWASALEYDKFFEFSFSYML
FT                   EISNFIKSKYPNIPVILFPKGISGYLDRIDGNFDVFGVDWSTPLDLARDKLSHKYALQG
FT                   NMEPCRLYDKNAIKEGVEKILKTMQNKAHIFNLGHGILPDIPVENAKYFIKLVQESSAK
FT                   "
FT   gene            complement(433616..433879)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0484"
FT                   /note="hypothetical protein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(433935..435134)
FT                   /locus_tag="JJD26997_0485"
FT   CDS_pept        complement(433935..435134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0485"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44616"
FT                   /db_xref="GOA:A7H2D9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2D9"
FT                   /protein_id="ABS44616.1"
FT                   /translation="MQNYKKALFALTLSAFCMGVTEFVMAGVLVDVEAYFSVDAKTAGY
FT                   LTTLYAIGVVIGAPLITIPLSRFHRHTQLLINLGIFALANFIIFFSENFYLTAFARFIA
FT                   GTQHGVFFVIATLAVSAITPDDKKSSALAIMVTGLTVALVTGVPLGTFIGHYFGFKFIF
FT                   LLIFIITSLAFFGVWHMMPKNLHPSPTSLKNLIPAFSHQNLLKTYTITICSCGAQFVLY
FT                   TYLQKLLVEISGFRVQDTAYILLLYGICAICGNLWGGKIVDKKGAIFSLRLILSIQVLV
FT                   FLSVFLAMYSKILIIFSVALIGFFAFSTIPALKMLSIAKAKRHTYKVIDSTVSVNEAAF
FT                   NVGIALASFLGGVVLAGLGIEFNALFSALFVSPALIFALLFAKDKLNYKKFQRKSFKKV
FT                   "
FT   gene            complement(435180..436277)
FT                   /gene="pdxA"
FT                   /locus_tag="JJD26997_0486"
FT   CDS_pept        complement(435180..436277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="JJD26997_0486"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43783"
FT                   /db_xref="GOA:A7H2E0"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037539"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E0"
FT                   /protein_id="ABS43783.1"
FT                   /translation="MKKLAISIGDINGIGLEILVRSHEELSKICTPFYFIHESLLDKAL
FT                   KLLNLKLFNAKIVAFKDSKDYEFKFLKKENSLEIYSFCLPLGFKVDENFKIKAGKIDAK
FT                   SGLYGFLSFKVASYFVYEKHAHALLTLPIHKKAWEDAGLKYKGHTDALRDFFKKNAIMM
FT                   LGCKELFVGLFSEHVPLAKVSKKITFKNLSIFLKDFYKETHFKKMGLLGFNPHAGDYGV
FT                   IGGEEEKIMEKSIAFVNAFLHSKKDEKFFKKALKDENLQKELLLKFKGKGVYLPYPLVA
FT                   DTAFTKAGLKNCNRLVAMYHDLALAPLKALYFDKSINVSLNLPIIRVSVDHGTAFDKAY
FT                   KNAKINTKSYFEAAKFALEISHRYV"
FT   gene            complement(436274..437047)
FT                   /gene="pdxJ"
FT                   /locus_tag="JJD26997_0487"
FT   CDS_pept        complement(436274..437047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="JJD26997_0487"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="identified by match to protein family HMM PF03740;
FT                   match to protein family HMM TIGR00559"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43652"
FT                   /db_xref="GOA:A7H2E1"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2E1"
FT                   /protein_id="ABS43652.1"
FT                   /translation="MLLGVNIDHIAVLRQARMVNDPDLLEAAFIAAKYGDQITLHVRED
FT                   RRHAQDFDLENIINFCKSPINLECALNDEILNLALKLKPHRVTLVPEKREELTTEGGLC
FT                   LNHVKLKQSIEKLQNVNIEVSLFINPSLEDIEKSQILKAEFIELHTGHYANLHNALFSN
FT                   ISHTAFALKELDQDKKTLQTQFEKELQNLKLCAKKGTKLGLKVAAGHGLNYKNVKPIVK
FT                   IKEICELNIGQSIVARSVFTGLQNAILEMKELIKR"
FT   gene            437103..438077
FT                   /locus_tag="JJD26997_0489"
FT   CDS_pept        437103..438077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0489"
FT                   /product="phosphatase, Ppx/GppA family"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44399"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E2"
FT                   /protein_id="ABS44399.1"
FT                   /translation="MLGIDLGSNTLRAVQMDEKLNKLKEYEFVIGAAKNLNQSGEISKE
FT                   AIQRLKNALNILAKEQDLSKARAVATAAFRKASNTNEIFAHLKEEFGVDFKLIDAKSEA
FT                   KISVLGMQSGLRRLKIWGEFAYCDLGGASCELSFRESFKSFDFGIISFYEKNCHSYYKS
FT                   CISYKKLIKKYPKFIINIKDKKLKIHFLIANPYLKYLAFRAFDEVAMIKKELHSLGVKT
FT                   VVLNSGVPTTLSALKQNINYEKYEATRVNGKKLCHKDFLNYAIKLFHMEEKKTIKEVGM
FT                   MRKNYLSAGCLLFYALFDKHKLLVIDEGLREGVCLASMKNIKF"
FT   gene            complement(438074..439024)
FT                   /locus_tag="JJD26997_0488"
FT   CDS_pept        complement(438074..439024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02636"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44599"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E3"
FT                   /protein_id="ABS44599.1"
FT                   /translation="MKFSDFFYAWLHESYYKNAVSIGKNGDFFTAVSVGNLFGTLLAKH
FT                   FLNLIDKKILQPPLELVEIGANEGYLSRDFLAALLELRPEIFSQISFFIIEPHEKLRTL
FT                   QKKTLERVEFSHKNSLKECHFKNAFFFCNELFDSFTCELIDNDKMAFVENFKLIFKNMD
FT                   ENLITKCKALNLIKGELSLELENFFKDLDQACERFIFAGFDYGTLNPQNFSLRIYQKHE
FT                   VFNPFEVSLKDFFGKSDLTYNVNFTHLQKLIKEYNFKPLTFKKQSLALMDFGFEDLLEY
FT                   TKNKNIKTYESFLSQAKILFFNFDEKFHFFEFQKN"
FT   gene            complement(439021..439821)
FT                   /locus_tag="JJD26997_0490"
FT   CDS_pept        complement(439021..439821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0490"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43702"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E4"
FT                   /protein_id="ABS43702.1"
FT                   /translation="MSLTLWLFGAQNLELVKGQALFLELDKKDFLSLKNNDKNIPTFTH
FT                   PKNQEKILAIFSLPYKNPPQNTKLIAFYKDKKEEIFIKTLEGNYKSEKLQVENKKIFPP
FT                   KTVQERIAKELKEANAIYSSYTPKTLFNGAFNISLNSFITSDFGKARTFNGKVASYHSG
FT                   TDFRAATGTPIYAANSGIVKIAKDRYFAGNSVVIDHGFGIYSQYYHLSKINVKVGQKIE
FT                   KGELIGLSGASGRVSGPHLHFGILAGGKQVDPLDFVSKFNAIFQ"
FT   gene            complement(439839..441833)
FT                   /gene="glyS"
FT                   /locus_tag="JJD26997_0491"
FT   CDS_pept        complement(439839..441833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="JJD26997_0491"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44663"
FT                   /db_xref="GOA:A7H2E5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E5"
FT                   /protein_id="ABS44663.1"
FT                   /translation="MSELLIEIGTEELPAIPLLKELTNIEKKWKNILEEYRLVSDFKFY
FT                   YTPRRLVFFHENFADKQEDSFTEFIGAPKNVAYKDGVLTPAGQSFLQKAEISENELTFK
FT                   EIKGKEVLYHQKATKGLQSQEILGEMIEKFLKSLSFGKSMRWGANSFEFIRAIRSIACI
FT                   LNDKLVNFQSYGVKSAKKTFIHRSVSYDLQDFNNAKEYFELLEKNYIILDPIKRKEKIL
FT                   EQFKLIESQKNIQIGEDEELLAEVVAITEYPNALLGSFEEEFLEIPSEVIITSMRENQR
FT                   YFAVFNDKGLSNHFIVVSNAVCKDYSKIIHGNERVLRARLSDAMFFYQNDLQNGLKPEK
FT                   LAKMTYLEGLGTMQDKSLREIKIAEILCQMLHNDKIENISTALKYAKADLATQMVYEFT
FT                   DLQGIMGSYYAQKMGLDYEICLAIKEQYLPNSEQAPLPSTEFSSIVALANKLDSLIGLF
FT                   SIGKIPSGTKDPYALRRAANGIIKIALNLNKEFDIQILLEKLSSHYKSFDMQILKDFIF
FT                   ERLYTFYTVNASFVKAVLSSQNTDLIHINQSVNALIKLSKKDNFNENFTTFKRLANIAT
FT                   KNSHKVDENLFVQEAESKLYKAFQEKTKVNSLQEKLENLFALKPFIDEFFNQVMINAED
FT                   EKLKNNRQALVYEIYVEFLKIADLKELSL"
FT   gene            complement(441889..442509)
FT                   /locus_tag="JJD26997_0492"
FT   CDS_pept        complement(441889..442509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0492"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1 family protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43909"
FT                   /db_xref="GOA:A7H2E6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E6"
FT                   /protein_id="ABS43909.1"
FT                   /translation="MINVFFDMDGTLIDSANAISCAVNEIRQDLNLAPLSRKIIMQTIN
FT                   TPNIDWAKELYNIENFHHSSFKEGYEKYFIKHYEQSVVLFEGVKELLEFLKSKNCFLAI
FT                   ATNAPQSSLSNILKKHQIIPYFDKILGVSLSIEPKPHPMMLELLKSEAPYKTSVFIGDS
FT                   QKDKECAKNANLPYFHAKWYQKDLKENEFSNASELKGFLEKYL"
FT   gene            complement(442506..442838)
FT                   /locus_tag="JJD26997_0493"
FT   CDS_pept        complement(442506..442838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0493"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43912"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E7"
FT                   /protein_id="ABS43912.1"
FT                   /translation="MTKNKEKALRVKYLRNLEKFFNGAISALKKEDFDKTKFEERMLKN
FT                   AKFFEKNPAVNLNSTYAKNLEFFVNACLDFSKEKSELLNLANALDKQKKQGEKKEKHKN
FT                   YLKDYE"
FT   gene            complement(442848..444473)
FT                   /locus_tag="JJD26997_0494"
FT   CDS_pept        complement(442848..444473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0494"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43181"
FT                   /db_xref="GOA:A7H2E8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E8"
FT                   /protein_id="ABS43181.1"
FT                   /translation="MDNFLEIFLTTVTIAIVLNVIFKKFEIPTIIGYIATGKIISEIYH
FT                   LSGKGEITHIAEFGIVFLMFTIGLEFSFKHLMAMKQEVFLNGSLQMLTCGFVFMLLAIG
FT                   ILGLGDKSATIAGFALALSSTAVVLKILNDNGDINEQYGRKALGILLFQDIAVIPLLLL
FT                   VDIFSSNNQNIEKLLFTTLISALILITLLFFIGKYLVDRIFRLIIHTSSQEIFISTVLF
FT                   MVIGASFLANYFGFSYSLGAFIAGALIAETKYKHKIEADLIPFRDLLLGLFFITVGMQI
FT                   QLDAVAQNWFLIIVLTLLVMALKFGIVFGFLFLYTKKRVALKTAFAIAQIGEFALAIFS
FT                   LLQAKNMLDIKTSQILIVVSILTMIITPFILNNIRKITNVVEDIALNTNAVQNIDSNIK
FT                   LKNHLVVFGYGRLGQEVVQKLKNTGVPYLVLESDLNLVELGVSRGENVVFANAAQEETL
FT                   KIANIEECAVAIITVTNEAKLEILCQVLAHYPKPIDTIIHVNGTLKKMLFSSIDENIRI
FT                   IRSEKVIARNLVQEALECRIHKNT"
FT   gene            complement(444480..444854)
FT                   /locus_tag="JJD26997_0495"
FT   CDS_pept        complement(444480..444854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0495"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44127"
FT                   /db_xref="GOA:A7H2E9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2E9"
FT                   /protein_id="ABS44127.1"
FT                   /translation="MEHHYDEPVYLISVVAKVLSIHPQTLRQYEREGLIEPSRTDGKIR
FT                   LYSQRDIDRIKLILRLTRDMGINLAGVDVILKLKNQLHEFENLIDELRLELSKQQDKEA
FT                   ASKAVVKHKNSFDLIFYEKK"
FT   gene            complement(444870..445754)
FT                   /gene="dnaJ-1"
FT                   /locus_tag="JJD26997_0496"
FT   CDS_pept        complement(444870..445754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ-1"
FT                   /locus_tag="JJD26997_0496"
FT                   /product="co-chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43437"
FT                   /db_xref="GOA:A7H2F0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F0"
FT                   /protein_id="ABS43437.1"
FT                   /translation="MNSLYETLGVSKNASADEIKKAYRRLARKYHPDINKEKGAEEKFK
FT                   EINAAYEILSDEKKRAQYDQYGDSMFGGQSFHDFSRNAGGVNLDDILKDLFGGGFGGRS
FT                   REGFNSFSSKGFSSGFGGFEEENLDSNLELHIPFEKAVKGGEHSFNFQGETIKFKIPHG
FT                   IKEGEKLRIRSKGKQSRNGTRGDLIIIVKIEESPIYTREDDDLYQKVDISLKTALFGGK
FT                   INIKTLKEGKEEATINITPNSKNNQKIRLKGYGVQNRKSDIYGDMYLILNVVLPNLDTL
FT                   DKNFIELLKEKLP"
FT   gene            445955..447373
FT                   /gene="htrA"
FT                   /locus_tag="JJD26997_0497"
FT   CDS_pept        445955..447373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="JJD26997_0497"
FT                   /product="protease DO"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595; match to protein
FT                   family HMM TIGR02037"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43157"
FT                   /db_xref="GOA:A7H2F1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F1"
FT                   /protein_id="ABS43157.1"
FT                   /translation="MKKIFLSLSLASTLFAASINFNESTTTANRVNPAAGNAVLSYHDS
FT                   IKDAKKSVVNISTSKTITRANRPSPLDDFFNDPYFKQFFDFDFPQRKGKNDKEVVSSLG
FT                   SGVIISKDGYIVTNNHVVDDADTITVNLPGSDTEYKAKLIGKDPKTDLAVIKIEANNLS
FT                   AITFTNSDDLMEGDVVFALGNPFGVGFSVTSGIISALNKDNIGLNQYENFIQTDASINP
FT                   GNSGGALVDSRGYLVGINSAILSRGGGNNGIGFAIPSNMVKDIAKKLIEKGKVDRGFLG
FT                   VTISALQGDTKKAYKNQEGALITDVQKGSSADEAGIKRGDLVTKVNDKVIKSPIDLKNY
FT                   IGTLEIGQKISLSYERDGENKQTSFTLKGEKENPKGVQSDLIDGLSLRNLDPRLKDRLQ
FT                   IPKDVNGVLVDSVKEKSKGKNSGFQEGDIIIGIGQSEIKNLKDLEQALKQVNKKEFTKI
FT                   WVYRNGFATLLVLK"
FT   gene            447449..448123
FT                   /locus_tag="JJD26997_0498"
FT   CDS_pept        447449..448123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0498"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44214"
FT                   /db_xref="GOA:A7H2F2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F2"
FT                   /protein_id="ABS44214.1"
FT                   /translation="MTNILMIEDDLELAEITAEYLEKFDMKVDIAHEPYIGLSKLALKE
FT                   YQLIILDLSLPGLDGLEVCEEIRKKYDTPIIISSARHDITDKVNALELGADDYLPKPYN
FT                   PKELQARIKSHLRRISNTKSAIAKSVKDLVYDQYKHIITMKGQELTLTNAEFDILSYLI
FT                   KKEGGVVSREELVYNCSSISEDSSNKSIDVIISRIRQKMGDDPKTPKYIHSIRGIGYKL
FT                   TQ"
FT   gene            448195..449367
FT                   /locus_tag="JJD26997_0499"
FT   CDS_pept        448195..449367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0499"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43554"
FT                   /db_xref="GOA:A7H2F3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F3"
FT                   /protein_id="ABS43554.1"
FT                   /translation="MWLIEYDQQNYTRELNIKYSLIANARLLNFAGVISEKEFEEQTKN
FT                   YNKMDEITEAKQIRKILFRGDVLARVEVNNGLIEIISYNRQVYLNIIYDGKVYLYKDQD
FT                   YQTYRYFIIKAIAVAVICILVLLYIYIFKKLKPLKRLKKQIDKFAQGKLNDIEDVSTGV
FT                   DEISQVGEAFYQAIVQIRKLNQSRQFFLRNIMHELKTPITKGLLTLEMIEDNKYKERLN
FT                   GVFTRLEILINEFAAIEQITSGAAFINRKKYNILDVLDEAKEIAMRDDSNIRIFMEESF
FT                   FVNVDFKLFTTAIKNMIDNGIKHSEDGFVQIDIIDDYICFKNRGPELNNTLEYYTQAFT
FT                   QGSKQKSSFGLGLYIVNTILETHGMKLDYLYEDGVNLFFFRNLKSLIVKE"
FT   gene            449462..449536
FT                   /locus_tag="JJD26997_0500"
FT   tRNA            449462..449536
FT                   /locus_tag="JJD26997_0500"
FT                   /product="tRNA-Asn"
FT   gene            complement(449659..449871)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0501"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01402"
FT   gene            complement(449882..450091)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0502"
FT                   /note="non-heme iron protein, hemerythrin family; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            450312..450428
FT                   /locus_tag="JJD26997_0503"
FT   CDS_pept        450312..450428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44178"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F4"
FT                   /protein_id="ABS44178.1"
FT                   /translation="MIKNSAKSSLTSFLLIDLSDTTSTFAASSKAFYVVHQF"
FT   gene            450616..451281
FT                   /locus_tag="JJD26997_0504"
FT   CDS_pept        450616..451281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0504"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44083"
FT                   /db_xref="GOA:A7H2F5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F5"
FT                   /protein_id="ABS44083.1"
FT                   /translation="MAAKILLLEDDLSLSEIIEEFLNDEGYEVFLCDNVQEALDMAYER
FT                   YFDLWILDVKVPLGDGFSLLKELRKSGKQTPAIFMTSLNTTNDLKQGFDAGCDDYIKKP
FT                   FELVELSIRVKALLKRAFSHKNEDFEDLGDGFRFEFTTQILYHNNKALTLPSKEIKLLS
FT                   LLLKNKNNFLSTERIFEELWDYDEEPSDLSLTAYVKNLRKILGKEKIINQRGRGYCYG"
FT   gene            451379..452051
FT                   /pseudo
FT                   /locus_tag="JJD26997_0505"
FT                   /note="sensor histidine kinase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            452680..452844
FT                   /locus_tag="JJD26997_0507"
FT   CDS_pept        452680..452844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43757"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F6"
FT                   /protein_id="ABS43757.1"
FT                   /translation="MQAVCKYAEEQREDRAVPVATLIRLSMGYGISYTNAPDVGGQTYT
FT                   KRPPFGRCH"
FT   gene            452931..453077
FT                   /locus_tag="JJD26997_0508"
FT   CDS_pept        452931..453077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44063"
FT                   /db_xref="GOA:A7H2F7"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2F7"
FT                   /protein_id="ABS44063.1"
FT                   /translation="MTRFANFYGVIMVLSFIVSWQIFNAYFNFFVFLILFFVSYKIWQF
FT                   KKK"
FT   gene            complement(453112..454749)
FT                   /gene="groEL"
FT                   /locus_tag="JJD26997_0509"
FT   CDS_pept        complement(453112..454749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="JJD26997_0509"
FT                   /product="co-chaperonin GroEL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43566"
FT                   /db_xref="GOA:A7H2F8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2F8"
FT                   /protein_id="ABS43566.1"
FT                   /translation="MAKEIIFSDEARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGA
FT                   PSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLR
FT                   NITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIAD
FT                   AMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLF
FT                   DKKIANLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPGFG
FT                   DRRKAMLEDIAILTGGEVISEELGRTLESATIQDLGQASSVIIDKDNTTVVNGAGEKAN
FT                   IDARVNQIKAQIAETTSDYDREKLQERLAKLSGGVAVIKVGAATETEMKEKKDRVDDAL
FT                   SATKAAVEEGIVIGGGAALIKAKAKIKLDLQGDEAIGAAIVERALRAPLRQIAENAGFD
FT                   AGVVVNSVENAKDENTGFDAAKGEYVNMLESGIIDPVKVERVALLNAVSVASMLLTTEA
FT                   TISEIKEDKPAMPDMSGMGGMGGMGGMM"
FT   gene            complement(454770..455030)
FT                   /gene="groES"
FT                   /locus_tag="JJD26997_0510"
FT   CDS_pept        complement(454770..455030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="JJD26997_0510"
FT                   /product="chaperonin GroES"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44320"
FT                   /db_xref="GOA:A7H2F9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2F9"
FT                   /protein_id="ABS44320.1"
FT                   /translation="MNFQPLGKRVLVKRVEETKTTASGIIIPDNAKEKPLMGEVVAVSK
FT                   EITDIANGDKIMFAKYGGTEIKLDNNEYLVLNLDDILGILK"
FT   gene            455193..457733
FT                   /locus_tag="JJD26997_0511"
FT   CDS_pept        455193..457733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44215"
FT                   /db_xref="GOA:A7H2G0"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G0"
FT                   /protein_id="ABS44215.1"
FT                   /translation="MKKIFYGAIAFVVALLIAIYTILFTSFGNNIVANIAQKKIKESAG
FT                   LDVNITHFNLHFSSLELQANIANMADFNLKGALSPFKLGFDLDYIVSLNQNYAKNLGLN
FT                   LNQNLSFGGKIQGKASDFTLDGKGYLLGSNVLLNARMYNYGPIALNLDAQNLKIEEILH
FT                   LLSYPSYAKGFLNVQAKISAQNLKPDGNIIIKLDTSYINYEVIKKDFSLDLPLNSNPKA
FT                   EILANVKEDKIYAVSKIYNDYLNLQTQKTLYDISKNTLSTDFNLSIPSLAKLKKLTKTR
FT                   LNGSLAVIGEASVINNILSSLNAQVIGLGGEVKANLKNNKIFADINEASLEKLLALAGY
FT                   GGLVSGNLNAKLLDADLDFSNFDLEAKIDNAKINTNELKKITKIELPNTIFSLDAKANA
FT                   KNSNISYNALFASNLLNIKKFQGTYNLKNNELNTDLNAFIDDLSQFSVIAGQKLQGKAD
FT                   LNAKAHIIGTQIQNLNANANLADGVIKADSNGKKLDLNIDKLDLSKLFVITGMPNYASG
FT                   IVNAKVNLDNIDFSNLNGKVNLEAKGILNAATLSKILNKNFPNNTSYDLNTKINFKNNI
FT                   AQFDSVLNSSLADLTKLQGSFDIGKMLLNSDFNLKINDFSKLGFLLDRKLKGKAEFNGK
FT                   VGFDKSLNFVVNSPNLFEGKLQSTLKDNLLLADLNGVDLSSLAQGLDFMDVYQGKADVK
FT                   ANYNLLSEEGEVNLDMKEGKLKPNLITNALKILTLKDIANDVYRTANAKALIKKENIKL
FT                   DLNIQADRSHILVQSGALNSKSGALNLPFDIKLDRVNFKGSITGTTENPKVNLKAGSVL
FT                   NSIKNVVGGGVSNGAKNTGDKVDKAVNKLLNKIF"
FT   gene            457742..458353
FT                   /gene="ribE"
FT                   /locus_tag="JJD26997_0512"
FT   CDS_pept        457742..458353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="JJD26997_0512"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by match to protein family HMM PF00677;
FT                   match to protein family HMM TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43289"
FT                   /db_xref="GOA:A7H2G1"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G1"
FT                   /protein_id="ABS43289.1"
FT                   /translation="MFNGLIREIAKVQSYQNNTLSLKAKYRPNLGDSIAVNGACLSVTK
FT                   LYEGGFEVELSRESRTHIAIENLKDKVHIEPALRYGDRIDGHLMQGHIDFIGTLEKIQK
FT                   DENGVDFHISLPKEAMKFMAEKGSIAVDGVSLTINEILKNGIRLTIIPITFKETLFKDY
FT                   QVGRKINIESDLLVRYIYAQLQGKNKGLSWEEVERISYLY"
FT   gene            458317..458997
FT                   /locus_tag="JJD26997_0513"
FT   CDS_pept        458317..458997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02578"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44200"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G2"
FT                   /protein_id="ABS44200.1"
FT                   /translation="MGRSGKNFLSLLENDKVGIFCAFDKDYNVFRAKVYNENLFSHLGF
FT                   KDIEKCVFMDQIHSHKVIIYDKNLKNLSCDGLISKEKNTALCVLSADCLPLILYHESGI
FT                   IAALHSGRKGSFENILKECVDQIVMQNPHLDKNKFHLFILPGICAKNYEIDGEILEFAK
FT                   KEFREFVQDNKLDLKALVKFQAQNLGIGDIKDCGICNFDDESFFSYRRDKTPKRFVSVV
FT                   YLKD"
FT   gene            458999..459202
FT                   /locus_tag="JJD26997_0515"
FT   CDS_pept        458999..459202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0515"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44227"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G3"
FT                   /protein_id="ABS44227.1"
FT                   /translation="MYERKDLRVLKIIQKAREFGDGDLLNEALVKQLIDADFCEINEKE
FT                   KEELVTLLNSLINAKDKALLSN"
FT   gene            complement(459199..460359)
FT                   /locus_tag="JJD26997_0514"
FT   CDS_pept        complement(459199..460359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0514"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43559"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR040653"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G4"
FT                   /protein_id="ABS43559.1"
FT                   /translation="MKKLLLLFIFVVQSFAALSVEELTWDNGDTLLKFLQRNSIPMSLY
FT                   YGLDREDQELASDIAYKIKYQVLKDENNNIEQVLIPINDDLQIHIYKDKDGQYTLAFTP
FT                   VSYQKEDRILHLTIKSSAYQDVYEESGSSTLARAMVRAFRGSINFRNIQKGDEATLYYE
FT                   QKRRMGKLWGDINIKMAMVEINKSAREVFSYNDIFYDRDGKELESFLLTKPVNYTRISS
FT                   PFTTARYHPILKRYHAHLGIDYAAPTGTPVKSAGKGVVTFIGTKGGYGNVIQIKHDSGY
FT                   MTLYAHLSRFAKIKNGQKVNQGQVIAYVGSTGMSTGPHLHFGVYLNNKAINPASVIKIA
FT                   KSELSGKAKENFKHIIAGYEQVVKEALASNQPNPPKEEDFENYIEF"
FT   gene            460481..461206
FT                   /locus_tag="JJD26997_0516"
FT   CDS_pept        460481..461206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43307"
FT                   /db_xref="InterPro:IPR029276"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G5"
FT                   /protein_id="ABS43307.1"
FT                   /translation="MFKTIVCFLALNLSLFAVGFDLKPIKSELVKVDDIYGYIKDSDDI
FT                   KLYSSGVVVQHFSNSQSIIARASVIDKKNGLAKLEFSVFSALKQDALPLPNVLPKVGDE
FT                   VVLNFLYDRGLVIAPDEQTYNELVREFPQIYFTHIDIFGAQLIRTATLSPKRSDFRQFC
FT                   DDNAVGILVVALENQAEVVDCQDFNKLYEVPISKPTSVQVPFYSRIGGYKSNFFDFNSQ
FT                   EIGNYYRYYDALINLPKVQ"
FT   gene            461209..462591
FT                   /gene="glcD"
FT                   /locus_tag="JJD26997_0517"
FT   CDS_pept        461209..462591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="JJD26997_0517"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44415"
FT                   /db_xref="GOA:A7H2G6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G6"
FT                   /protein_id="ABS44415.1"
FT                   /translation="MKKEFEQYFKRFLGEENAYFDEIHKRAYSYDATKKHYLPDGVLFP
FT                   RNEEDIAQILKFCNENNIIVIPRGSGSGFTGGALAVNGGVVLAFEKHMNKILEIDLENL
FT                   VAVVQPGVINIHLQKEVAKYGLFYPPDPASMEYSSLGGNVSENAGGMRAAKYGITKDYV
FT                   MALRAVLPSGEIIRAGKRTIKDVAGYNLAGILIASEGSLAVLSELTLKLIPLPKFKKTA
FT                   LAIFPSVKSAMNAVYKSLASGVSPVSMEFLDNLSIRAVESKFNKGLPIEAGAILIADVD
FT                   GNVKEAIDEDLRNLEHYFLEAGASEFKIAKDEQETADIWFARRNCSQSIAMYGTLKLNE
FT                   DITVPRSKLPALLEGIDEISKKYGFKIPCFGHTGDGNVHTNVMVPDKNDKEQVKKGYEA
FT                   VEEIFKLTVKLGGTLSGEHGIGLSKAPFMNLAFSEAEMNLMRNIKKAFDPNNILNPFKM
FT                   GL"
FT   gene            462595..463425
FT                   /locus_tag="JJD26997_0518"
FT   CDS_pept        462595..463425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0518"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43802"
FT                   /db_xref="GOA:A7H2G7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G7"
FT                   /protein_id="ABS43802.1"
FT                   /translation="MKNFFTILLNLRDKEILNYAAALSFYTVLSLIPILFVCFSVFTQI
FT                   SSFKAYYEKAKQVIFAFLIPTQQDVVATYIDTFLKNSVNLGIVGLVAMAFTSLAFFSGY
FT                   DFVINRITKNEPKGLWQSISSYWTLLTLVPLGLGLSFYISGFIQQTLDDYKIGFNFFEI
FT                   LPFVIIWGLFFTSYSSSVHKGTLKSLALVSFGAGAIWYIGKNLFVYYVVYNKTYASVYG
FT                   SFSTILFFFIWIYISWIIYLFGLKLYYFLNHNHNEGNKIRKNTKKSQIFKSHRD"
FT   gene            complement(464604..465161)
FT                   /locus_tag="JJD26997_0519"
FT   CDS_pept        complement(464604..465161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0519"
FT                   /product="DedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43302"
FT                   /db_xref="GOA:A7H2G8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2G8"
FT                   /protein_id="ABS43302.1"
FT                   /translation="MQDMIDTLIKYGYIVLFFYSLGGGMVGILAAGFLSSQGKMDLSFC
FT                   IALAFIANTIGSTLLFILGKYYKKDIMPYFKKHRRKLALAMMKTKQHGIILLVTQKFIY
FT                   GLKTFIPIAAGMAKYNFLKFFIINTLASLAWAIVLGLTAYTFGYVIEAIFDKLSLYPYA
FT                   APLFLLILAGIIWLYLSKFSKK"
FT   gene            complement(465170..466723)
FT                   /locus_tag="JJD26997_0520"
FT   CDS_pept        complement(465170..466723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0520"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM PF08668; match to protein family HMM TIGR00277;
FT                   match to protein family HMM TIGR03319"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43601"
FT                   /db_xref="GOA:A7H2G9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2G9"
FT                   /protein_id="ABS43601.1"
FT                   /translation="MIESLIALIAAIVGLGIGYLVAKKINDAKYEIFVEQAKAKAKAIE
FT                   YEAELILKDAKNSILNAELEVKKKYEEKTHKIQKDFNQKLDDLFKKEQKLQQEEEKLKE
FT                   DKEYLCKSQKHIQDLQSDVDKLKNKYQEKLDDVLKILEHSTRLTQNEAKEIILKKVEEN
FT                   SREQIAHIVRKYEEEAKNEAKRKANFIIAQATSRFAGEFAAERLINVINIKNDELKGRI
FT                   IGKEGRNVKTLEMVLGVDIIIDDTPGAIIVSCFNLYRRAIATKVIELLVEDGRIQPARI
FT                   EEIHEKVCKEFDSAILEEGEIIVMDLGLNKIHPEIVKLIGKLKYRASYGQNALAHSLEV
FT                   AHLAGIIAAECGGDENLARRAGILHDIGKALTHDFEGSHVDLGAELCNRYKEHPVVINA
FT                   IYAHHGHEEATSIESAAVCAADTLSAARPGARREVLEAFLKRVSELEDIAKSKEGIKNA
FT                   YAINAGREIRIIANAQLVNDDESVLLAKEIAAEIQEKMQYPGEIKVNVIRELRAIEYAK
FT                   "
FT   gene            467353..467910
FT                   /locus_tag="JJD26997_0521"
FT   CDS_pept        467353..467910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0521"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43489"
FT                   /db_xref="GOA:A7H2H0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2H0"
FT                   /protein_id="ABS43489.1"
FT                   /translation="MKIKKILLLVAISCLFVACSNDKEKQQNDVNLSTEASINQSDDMN
FT                   FKLNLIDGESISVKKENAVLNFNDEDKATLFVFFTTWCTPCIAEIPHLNKLQEKYNNDF
FT                   NIVGVLLEDKSNDEIQKFIEQHKISYKVANGENNYLLVKALGGVNGIPTMFLYNKHSKL
FT                   INQYLGLIPEEMLEIDIQKAIL"
FT   gene            467910..468776
FT                   /gene="ftsY"
FT                   /locus_tag="JJD26997_0522"
FT   CDS_pept        467910..468776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="JJD26997_0522"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43734"
FT                   /db_xref="GOA:A7H2H1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2H1"
FT                   /protein_id="ABS43734.1"
FT                   /translation="MFNFFKKGLAKTLENIVGVKGENKKITKDLLEEILLEADVSYEIV
FT                   EEIIYYLPPQNEVKKEDLKRVMGSYFLYEKKETNQEKPFVELILGVNGAGKTTSIAKLA
FT                   YLYKNQNQKVILGACDTFRAGAIEQLKLWAQKVDVDIVLTAQGHDPSAVAFDTISKAKA
FT                   KDFDRVIIDTAGRLQNQKNLAHELEKIVRISNKALEGAPHRKILVLDGTQGNAGILQAK
FT                   AFNELVKLDGVIITKLDGTAKGGVLFSIARELELPIFYVGVGESKEDLIEFNINAFLDT
FT                   ILESVFQ"
FT   gene            468852..469010
FT                   /locus_tag="JJD26997_0523"
FT   CDS_pept        468852..469010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43432"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2H2"
FT                   /protein_id="ABS43432.1"
FT                   /translation="MKKSKKFMSIFLKNLHSLNNPYLAHKLQNLKENRFVKIDNGGGGD
FT                   KFLGYKK"
FT   gene            469048..470748
FT                   /pseudo
FT                   /locus_tag="JJD26997_0524"
FT                   /note="motility accessory factor; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01973"
FT   gene            470792..472132
FT                   /gene="radA"
FT                   /locus_tag="JJD26997_0525"
FT   CDS_pept        470792..472132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="JJD26997_0525"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44065"
FT                   /db_xref="GOA:A7H2H3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2H3"
FT                   /protein_id="ABS44065.1"
FT                   /translation="MAKKHILFECQTCGNQQSKWLGKCPDCGAWDSFVELKAEQIKVLK
FT                   ELAQVNMKTSEAVCIEDVELEYFTRYSTDDNELDLVLGGGLVEGSLVLIGGSPGVGKST
FT                   LLLKIASNLAKQDKKVLYVSGEESKAQIKLRADRLEANTPNLFLLTELCLENILEELHK
FT                   KDYSILIVDSIQTLYSNKITSAAGSITQVREITFELMRVSKAYNISTFIIGHITKEGAI
FT                   AGPRVLEHMVDVVLYFEGDATKEIRLLRGFKNRFGGTNEVGIFEMTSKGLISAKDLANR
FT                   FFTRGKAISGSALGVVMEGSRALVLEVQALVCESSYPKRSATGYEKNRLDMLLALLERK
FT                   LEIPLGHYDVFVNISGGVKVSETAADLAVVAAIISSFKNRPLSKDSIFIGELSLNGEIR
FT                   EVFSLDTRLKEAKMQKFKNAIVPSKPSEDIGLKCFVAKELSQVLEWM"
FT   gene            472202..472882
FT                   /gene="atpB"
FT                   /locus_tag="JJD26997_0526"
FT   CDS_pept        472202..472882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="JJD26997_0526"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44513"
FT                   /db_xref="GOA:A7H2H4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2H4"
FT                   /protein_id="ABS44513.1"
FT                   /translation="MKDLFLFSSLLDASHTFSYFFHIGLVALIAVIVAMMATRSMQLVP
FT                   RGMQNLAEAFLEGVLSMGRDTMGSEKGVRKYLPLVATLGIIVFFSNIIGILPGFHAPTA
FT                   SLNLTLSLAIIVFVYYHFEGIRAQGFIKYFAHFMGPIKLLAPLMFPIEIVSHLSRVVSL
FT                   SFRLFGNIKGDDLFLMVILALVPYIAPLPAYVLLTFMAFLQAFIFMILTYVYLAGATVV
FT                   EKGH"
FT   gene            complement(473055..473903)
FT                   /gene="metF"
FT                   /locus_tag="JJD26997_0527"
FT   CDS_pept        complement(473055..473903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="JJD26997_0527"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219;
FT                   match to protein family HMM TIGR00676"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43969"
FT                   /db_xref="GOA:A7H2H5"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2H5"
FT                   /protein_id="ABS43969.1"
FT                   /translation="MCSFSFEIFPPRRDENIKNLNAILDDLGQLSPNFISVTFGAGGSI
FT                   NSKNTLETASLIQEEYKIPSIVHLPCIHSSKEKIISILQECKERQLDKILALRGDVCND
FT                   LEKSKDFSYASDLISFIQKQGEFEIYAACYPEKHNESKNFIEDIHHLKTKVNAGTDKLI
FT                   TQLFYDNEDFYTFKQNCALAGIDIPIYAGIMPITNKRQVLKISQLCGAKIPPKFAKILE
FT                   KYENNTLALEDAGIAYACDQIVDLITSGVDGIHLYTMNKPKAAIKIYEAVKHLLKEELR
FT                   A"
FT   gene            complement(473913..476177)
FT                   /gene="metE"
FT                   /locus_tag="JJD26997_0528"
FT   CDS_pept        complement(473913..476177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="JJD26997_0528"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="identified by match to protein family HMM PF01717;
FT                   match to protein family HMM PF08267; match to protein
FT                   family HMM TIGR01371"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44267"
FT                   /db_xref="GOA:A7H2H6"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2H6"
FT                   /protein_id="ABS44267.1"
FT                   /translation="MKNSIISYPRIGANRELKFAIEKYFKAQSSKEELLETAKNLRARH
FT                   WKDIQNAGIDFIPSNDFSLYDNVLDTAVLFNIVHTKYKNLNLDALDEYFAQSRGYQGEN
FT                   GDVTALAMKKWFNTNYHYLVPECDDASIIALTGDKIFKEYLEAKELGIESKPVLIGIFT
FT                   LFKLIAFKDKKTQKLAKEKLLNAYIELFDKLNELKVTWLELDEPYLVYDLSKEDIALFE
FT                   EFYQELLNHKKDLKILLQSYFGDLRDIYPKLLESKFDALGLDFIEGKQSLALVQQYGFA
FT                   KDKILFAGLINGKNIYANDYAKSLKLIKELQKYTQNIILNTSCSLLHVPYSTEFESKLD
FT                   PSYLKLFAFAKEKLQELKDLKEILNSSEENPLFKANQELFKNIPERLDEKVKARLKALK
FT                   KEDFTRTPSFKERALIQKEFLKLPLLPTTTIGSFPQSADVRSNRLAFKQKKISAQNYTE
FT                   FNQQKIKECIQIQEEIGLDVLVHGEFERNDMVEYFGENLKGFLFTQNGWVQSYGTRCVK
FT                   PPIIWGDVSRTKPITLACSKFAQSLSQKIVKGMLTGPVTILNWSFPREDISLKESTEQI
FT                   ALAIRDEVLDLENAGIKIIQIDEAALREKLPLRKSDWHSEYLDWAIPAFNLVHSGVKAK
FT                   TQIHTHMCYSEFSDILKEIDAMDADVISFEASRSNLSLLDTLKAVHFKTEVGPGVYDIH
FT                   SPRVPSVEELSLTIEKILNKLPKEQIWINPDCGLKTRAYEEVIASLKNLVTATQKIRKQ
FT                   L"
FT   gene            complement(476200..476970)
FT                   /locus_tag="JJD26997_0529"
FT   CDS_pept        complement(476200..476970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0529"
FT                   /product="lipoprotein, nlpa family"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43689"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2H7"
FT                   /protein_id="ABS43689.1"
FT                   /translation="MTLFTKAFCVATLFTGFAWANEELKVGSSITPHADILRFIKSALQ
FT                   KQGYDLKIYEFNDGVIPNVMVENGELDANYFQHEPYLKEFNQRQGTHLVKVASIHIEPM
FT                   AVYSKKHKKFNPEEGQSISIPNNPTNESRALRIVASKGLIEVKDNELITPLDITKNPKK
FT                   LKFVELKDAQLTRSLDDVDYSLINSNFAILAGLNPVKDGLYTESKYSEYGNIIAVKEGN
FT                   ENLPKIKALVKALQSDEVKKFIEEKYQGALIPTF"
FT   gene            complement(476980..477972)
FT                   /locus_tag="JJD26997_0530"
FT   CDS_pept        complement(476980..477972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0530"
FT                   /product="oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /note="identified by match to protein family HMM PF03171"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44029"
FT                   /db_xref="GOA:A7H2H8"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2H8"
FT                   /protein_id="ABS44029.1"
FT                   /translation="MNLPILDLQDYEKDKKTFLKNLREITSKIGFFYLTNFGVDRKLNK
FT                   HLFKLGKDFFNLPRSSKELISMVHSPQFRGYTSEGFEYTAGAKDYREQLDIGTERDALN
FT                   WNLNSPLWQRLEGPNLWPKEIPELKNTFLAWHEQTKKACLKLLQAFAECLSLPSDAFNQ
FT                   LYGVNSYEHCKILRYPKRSPKSKQGVGSHKDGGLITFVFQEEQSELEAFIDGKWLSIPP
FT                   LEDSVVVNIGEFLELATNGYLKATIHRVNLSSKERFSIAYFLGVQLDKNIPVFTLSPEL
FT                   AKESKGVDTDPKNPLLRNVASNYFKRMIRSHPDVARIYHSDLIEKFSFA"
FT   gene            complement(478283..478777)
FT                   /gene="luxS"
FT                   /locus_tag="JJD26997_0531"
FT   CDS_pept        complement(478283..478777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="JJD26997_0531"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /note="identified by match to protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44077"
FT                   /db_xref="GOA:A7H2H9"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2H9"
FT                   /protein_id="ABS44077.1"
FT                   /translation="MPLLDSFKVDHTKMPAPAVRLAKVMKTPKGDDISVFDLRFCVPNK
FT                   DIMSEKGTHTLEHLFAGFMREHLNSNAVEIIDISPMGCRTGFYMSLIGTPDEKSVVKAW
FT                   ENSMQDVLKVKSQEDIPELNIYQCGSCKLHSLDEAKQIAQKVLNSGIGVMNNAELKLEN
FT                   L"
FT   gene            478892..480310
FT                   /gene="gatB"
FT                   /locus_tag="JJD26997_0532"
FT   CDS_pept        478892..480310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="JJD26997_0532"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43321"
FT                   /db_xref="GOA:A7H2I0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2I0"
FT                   /protein_id="ABS43321.1"
FT                   /translation="MFEVVIGLEVHTQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPG
FT                   ALPVLNEEAVKKAIAFGKAVNAAINKKSVFNRKNYFYPDLPKAYQISQFDIPIVEKGEL
FT                   FINVNGENKRIGITRAHLEEDAGKNIHENNFSKVDLNRAGTPLLEIVSEPELRSSDEAV
FT                   AYLKKLHSIIRFLDISDANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFRFIQKA
FT                   IDFEVKRQSEAWEDGTYEQEVVQETRLFDTTNLVTRSMRGKEEAAEYRYFPDPDLLPVL
FT                   LKDEFLQIKIPELPDEKKMRFVSELGIKESDAEVIISSLEMSRFFESLISQNLSPKLCV
FT                   NWLNTELMGFLKGELTIENSPVDAQKLGDLIKRIEDGTISAKAAKDVLAFVFENTNVEI
FT                   DEAIEKLGLKQVSDDSAIEAVIEQILNANADKVAEYKSGKDKLFGFFVGQTMKEGKRAF
FT                   NPAKVNEILKAKLG"
FT   gene            480310..481203
FT                   /gene="gpsA"
FT                   /locus_tag="JJD26997_0533"
FT   CDS_pept        480310..481203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="JJD26997_0533"
FT                   /product="glycerol-3-phosphate dehydrogenase,
FT                   NAD(P)-dependent"
FT                   /EC_number="1.1.1.94"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44261"
FT                   /db_xref="GOA:A7H2I1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2I1"
FT                   /protein_id="ABS44261.1"
FT                   /translation="MRIAVIGAGKWGSALHLALKENHTCFISSLHQRDLEDFVSIKEAL
FT                   ECEYLIFALSSQGMRVWLKENFINKGQKILIASKGIEDQSCQFLDEIFLDFVPKENFCV
FT                   LSGPSFAAEVMQKLPTALMISGINQELCKKFASFFPDFIKTYIDDDVRGAEICGAYKNV
FT                   LAIASGISDGLKLGNNARAALISRGLIEMHRFGKFFGAKEETFLGLGGAGDLFLTATSV
FT                   LSRNYRVGLKLAQNQKLDSILAELNEVAEGVKTAYAIEKLAKMKGIYTPIVNEVVAIFK
FT                   GKSVQEATQNLLKQND"
FT   gene            481213..482391
FT                   /locus_tag="JJD26997_0534"
FT   CDS_pept        481213..482391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0534"
FT                   /product="putative dihydroorotase"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43422"
FT                   /db_xref="GOA:A7H2I2"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2I2"
FT                   /protein_id="ABS43422.1"
FT                   /translation="MIIKNAKIYGDSLQDIEIKEGKITNIGSNLQGEEILDAKGMTLLP
FT                   SFVDLCVSLKNDKFSLANLELLENECLKGGISSIVLRDCMDFDEESFALFLQNLAQRKM
FT                   QIFSSMRVKDANGKLKNLATLLNKGACALELDSSLDANILKVSSQYAFMKDSPIFVRCY
FT                   DKDFDDNGVMNDCEMSFELGLIGMSKIAETSQIAKMKELAKFYKNKVVFDLLSLKDSLV
FT                   LLDEKDLKLVSIHHLIKDDSACEDFNTAAKLMPPLRSKEDVLALREALKEGKISFLTSL
FT                   HSAKSISLKDLAFNEAAFGIHSVCEFISLCYTFLIKEGSLNWQELCQFTSKNSSEFLGL
FT                   NSGVIEVGKEANLVLFDENEEIFTPKSSLYSEDKLFGRVKMHIIKGKNILEK"
FT   gene            complement(482399..483925)
FT                   /locus_tag="JJD26997_0535"
FT   CDS_pept        complement(482399..483925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0535"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44572"
FT                   /db_xref="GOA:A7H2I3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2I3"
FT                   /protein_id="ABS44572.1"
FT                   /translation="MQKDNLIAFVIFTISTIAFVIWGFGYISQHQLILFILASIFGIFM
FT                   AFNIGGNDVANSFGTSVGAKTVTIKQALIIAAVFELSGAIFAGAEVTKTIRSSIVIFPN
FT                   SLDPMLFVIIMLAALLSSGVWIFIATKKGLPVSTTHSIVGGIVGASIMMGVLKFDGIQT
FT                   LSMVKWSEILRITISWVASPLLGSIVAYIIYSYIDKKILKPSEKLNDDLKNIKKERKKF
FT                   KEEYFLNLKTKSQEEQIKELSAIALDEGEQENNFYRNKMKEFKDQEKDIDIYSILKTHM
FT                   PIIACIAAAIISAMFLFKSLNNVNTLDILQNFWIIGIIGTISYVVTFAIVKIVKKTELN
FT                   KTTDRIFSWFQIFTASSFAFSHGANDIANAIGPFAAILDVLKNGTINATSPVPFAALAM
FT                   FGVALVVGLWFLGKEVITTVGSKLATIRPTTGFSAELGTSIVILLATQFGIPVSSTHIL
FT                   IGAILGIGVYNKNANWIMMKPIGLAWIITLPAAGVMAALVFLGFKLSLGI"
FT   gene            484217..484426
FT                   /pseudo
FT                   /locus_tag="JJD26997_0536"
FT                   /note="putative periplasmic protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            complement(484537..485835)
FT                   /gene="dctA"
FT                   /locus_tag="JJD26997_0537"
FT   CDS_pept        complement(484537..485835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA"
FT                   /locus_tag="JJD26997_0537"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44672"
FT                   /db_xref="GOA:A7H2I4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2I4"
FT                   /protein_id="ABS44672.1"
FT                   /translation="MIIGIIAGIVLGYTDKELAIASKPGVDYFIGALKVLIGPIIFVTL
FT                   VLGIISLESLKKVGSIGAKAVIYFEVVSTLALAIGIFMANVMQPGHGMNLDPSQLDTKS
FT                   VQKYISQTTEVSASSEIMHILKDAMPTDIITPFAEGKTIQVLVIAIITALIISLMRIED
FT                   KQAIQRVFEVVQNFVFKILQIIMYFSPIAAFSAMAVLIAQYGIGSLINLAYLLLVMLIS
FT                   CLVFIFGILGLICYFAKVNIFKFMRFISREVLIVFATSSSESALAPLMRKLEKAGLSKA
FT                   TVGLVLPTGYSFNLDCTNIYLAMSLIFLAQAFNVNLSLAHEISILIVLMIASKGAVGVT
FT                   GSGFIVLGSTLAALGNMKISEANATLAQVLPVAAIGVLLGVDKFMSEMRAVGNLCGNSV
FT                   AALIVAIWDKQIDWEKFRYAMDNPEKFHNAGMN"
FT   gene            486166..486408
FT                   /pseudo
FT                   /locus_tag="JJD26997_0538"
FT                   /note="methyl-accepting chemotaxis protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            486795..488174
FT                   /locus_tag="JJD26997_0539"
FT   CDS_pept        486795..488174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0539"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44445"
FT                   /db_xref="GOA:A7H2I5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2I5"
FT                   /protein_id="ABS44445.1"
FT                   /translation="MVKNGLLLTIFLSIIGILSVIFFHIYVGAIIFILIAVLMIYLLRQ
FT                   YKDEQIMIDKFLVLCRELKEGNFDNRIIYVKTKSKKLAEIADNLNNTIDGLEAYLREIN
FT                   TSISCSQKGEFYRKALPEGLKGIFAHNIEFINKALANIEVTARSIFKNALSRTLMDLSL
FT                   GNQNKDMSQISNSLNQDISRMKNVYDTVDAIAHTATENGSEVDSLQSAMGTLMDVVNSS
FT                   KETVQTFVANSQNITSVVEVIRDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRKL
FT                   AERTQRSTSEISIAIQTMQQDFVNIQSGSEQVFNIVSESEERINKFSQAFKRLEENSSA
FT                   LGVNFGSFAKRLILSVVKIDHILYKSNIYLNLNGAQNFNLESVDPISNLCQDEKARDVI
FT                   NELSSETELNLAKEFIKDNAKKAIEESNQDYIDQKAYDVIVNDIKSLEQRSAEILAKLK
FT                   I"
FT   gene            488192..488692
FT                   /locus_tag="JJD26997_0540"
FT   CDS_pept        488192..488692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0540"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF08447"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44060"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2I6"
FT                   /protein_id="ABS44060.1"
FT                   /translation="MSREIFLQEDSLITSKTDLKGKIVYANDDFLKYAGYSTMGEVLNK
FT                   PHNIVRHKEMPKTIFKYLWDYMKEGKEIFAYVKNKTKDNNYYWVFANVTPSIDINNNII
FT                   GYYSVRRMPNKSAISTIESLYSDLLRVEQQQGLNKSVEMLENFCKDADKTYNELIFSLQ
FT                   EAK"
FT   gene            488780..490639
FT                   /gene="gidA"
FT                   /locus_tag="JJD26997_0541"
FT   CDS_pept        488780..490639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="JJD26997_0541"
FT                   /product="glucose inhibited division protein A"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43449"
FT                   /db_xref="GOA:A7H2I7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2I7"
FT                   /protein_id="ABS43449.1"
FT                   /translation="MFDVIVIGGGHAGVEASAAAARMGKKTLLLTTLIEQIGAASCNPA
FT                   IGGLAKGHLVKELDAMGGFMGEITDEAGIQFRILNESKGVAVQGSRVQIDMDKYRIIAR
FT                   NKLLKLPNLEISQEQVSALIVENDKVKGVKTNLENIYFAKKVILTTGTFLNGLIHVGEN
FT                   KLQAGRVGELASVNLGNYLQTLGLKMGRLKTGTCPRVDATSIDFSVLEIQDGDVNPKAF
FT                   SFRSRNFNPTQLPCYIARTNTTTHEIIKNNFYRAPLFTGQIEGVGPRYCPSIEDKINRF
FT                   SDKESHHLFIEPQTIDATEYYINGFSTSLPYEVQTQMLHSVKGFENAKITRFGYAIEYD
FT                   YIEPTELKHTLELKKIKNLYCAGQINGTTGYEEAAVQGFMAGINASLSIDMKEPLILRR
FT                   DEAYIGVLIDDLVVKGTKEPYRMFTSRAEFRLLLREENAILRLGKYGYVLGLLSEQDFA
FT                   YIQNIANNLQKGLEFLLSKEFTPNNQNNAFLESLGEDKISSIVNFQKIVARASFDIEKL
FT                   KKLDPMFETMDNYSLREILNEAKYCHYISMQKAQVEKMKNLSELKIPENFDFKSVSGLS
FT                   NEVVEKLNHHKPPTIFAASQISGITPAALDILQIYIKMQKKKA"
FT   gene            490640..490888
FT                   /pseudo
FT                   /locus_tag="JJD26997_0542"
FT                   /note="arsenical pump membrane protein; this gene contains
FT                   a frame shift which may be the result of sequencing error"
FT   gene            491086..491589
FT                   /gene="petA"
FT                   /locus_tag="JJD26997_0543"
FT   CDS_pept        491086..491589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="JJD26997_0543"
FT                   /product="ubiquinol--cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM TIGR01416"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44581"
FT                   /db_xref="GOA:A7H2I8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2I8"
FT                   /protein_id="ABS44581.1"
FT                   /translation="MATSESRRSFMGFAFGSVAAVGGVFSLVAMKKTWDPLPSVKAAGF
FT                   TTVDLSGMQDGELRTIEWRKKPIFILKKDASMPKDEKRDVVVDNVAYTVVIGLCTHLGC
FT                   IPAYQPSEQLFKCACHGGEFDTSGKNVFGPPPKPLEIPPFKIDGTKLVLGEESPEYKKM
FT                   IAEA"
FT   gene            491591..492841
FT                   /gene="petB"
FT                   /locus_tag="JJD26997_0544"
FT   CDS_pept        491591..492841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="JJD26997_0544"
FT                   /product="ubiquinol--cytochrome c reductase, cytochrome b
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by match to protein family HMM PF00032;
FT                   match to protein family HMM PF00033"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44610"
FT                   /db_xref="GOA:A7H2I9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2I9"
FT                   /protein_id="ABS44610.1"
FT                   /translation="MAQIRKANGLVDWLDQRLAVHKLLDVLMVKYWIPKQINFLWAMGV
FT                   ILTTLFAVLFVTGLLLVMYYKPDTALAFDSVNKTIMQEVDYGWLWRHMHGVAASVVFLI
FT                   IYIHMLTGIYYGSYKKGREMIWVSGMLLFVVFSAEAFSGYMLPWGQMSYWAAQVITNLF
FT                   GGIPFIGSELVIWIRGDYAVSDPTLTRFFMLHVCLLPIVIITIIAFHFYSLRIPHVNNE
FT                   ISEELDFDLEAEKYMAGDTKGSKVIPFWPGFLSKDFMYISFFMIFFFYLVCFKFEFAMD
FT                   PINFDPANALKTPAHIYPEWYFLWSYEVLRGFFFDIAGIKAFDIGLAAFGIAQVIFFLL
FT                   PWLDRSDVVKPAHERPLFFIWFWILLIDLIVLTVYGKLPPTGVNAWVGFYASIVFLLLL
FT                   IVVLPVITIIERKGAKQ"
FT   gene            492838..493962
FT                   /gene="petC"
FT                   /locus_tag="JJD26997_0545"
FT   CDS_pept        492838..493962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="JJD26997_0545"
FT                   /product="ubiquinol--cytochrome c reductase, cytochrome c1
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43627"
FT                   /db_xref="GOA:A7H2J0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021195"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2J0"
FT                   /protein_id="ABS43627.1"
FT                   /translation="MREIKIFLVVVVFTALVYWGVEPYAHSVMKPHVVPANFDFAVEDT
FT                   TFAKGIVEAKELALKDAQASGDAKRIESANKELEKAKEELSKVETLWADVAKIDFAKGD
FT                   AKKGKEFFENNCFACHGVKEDGIAANITDSSMGVIPPDLSAAGAIFDEKFLAALIMHPA
FT                   FALKVDHKFGDAFIMTAYNKDTSGESEETTNANIANVIAYLKDVSVKFEANEDATIKKD
FT                   VEAKYAKMENSAQKTALMEKDIKFAKDKATFIEACGRCHDMKYDSFFTPSNQNDLKTYL
FT                   GSVPPDLSMMIRSRGEQYLHDFINNTQKLLPGTAMPRVGLTEAAQAKVVSYIDQVGDSK
FT                   KEERKTTGIYVMIFFVILSIFAIGWKRSVWSKLH"
FT   gene            494090..495253
FT                   /locus_tag="JJD26997_0546"
FT   CDS_pept        494090..495253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0546"
FT                   /product="putative cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /note="identified by match to protein family HMM PF02353;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43513"
FT                   /db_xref="GOA:A7H2J1"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2J1"
FT                   /protein_id="ABS43513.1"
FT                   /translation="MLEKQMIKFILSKWNYGNFRIVFWDQEEFHVGNQPAKFSLIFKEK
FT                   IPFLKLFSDTSLVFAKHYMESKLEIEGDYDEIAKVLYYFSNKRFLKNTEDILSKIAQKQ
FT                   ESKNIKSHYDIGNDFYKLWLDDTMSYSCAYFKEPNNTLYEAQINKIEHTLKKLDLKEGE
FT                   KLLDIGCGWGWLSIMAAQKYGVKVVGITISEEQCKKAKERVKELGLEDKIEIRLQNYQD
FT                   LEFENYFDKVVSVGMFEHVGKENLGLYFMKVKQVLKPGGSMLLHSILAMFEGKTNAWID
FT                   KYIFPGGYLPSLREVVSAMSEWDFHLLLAESLRMHYAKTLDLWDENFNKVLDKVREKYD
FT                   EEFIRMWDLYLRSCASAFRVGSVDLFQFLITKEINNNLSLTKDYIYK"
FT   gene            495369..496160
FT                   /gene="rpsB"
FT                   /locus_tag="JJD26997_0547"
FT   CDS_pept        495369..496160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="JJD26997_0547"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44239"
FT                   /db_xref="GOA:A7H2J2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2J2"
FT                   /protein_id="ABS44239.1"
FT                   /translation="MVSMRDLLECGVHFGHQTRRWNPKMKKFIFGERKGIYVIDLQKTL
FT                   RYFRYTYNIVRDAAAEGKTILFVGTKKQAGGALKEYAEKCGMPYVNHRWLGGMMTNFGT
FT                   IRQSIRKLEVIEKMEEDGSIKLLTKKEALMLTRKKEKLLAYLGGIRYMKTQPDMIFVID
FT                   TVKEKIAVQEANRLRIPVVAPLDTNCDPDLVTYPIPGNDDAIRSVQLFCQEMAEAINEG
FT                   KALREQDGEALPNEEKEITDEEKKEVLDESMSEEDFGEEQE"
FT   gene            496160..497233
FT                   /gene="tsf"
FT                   /locus_tag="JJD26997_0548"
FT   CDS_pept        496160..497233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="JJD26997_0548"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44242"
FT                   /db_xref="GOA:A7H2J3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2J3"
FT                   /protein_id="ABS44242.1"
FT                   /translation="MAEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKG
FT                   LGKAAKKADRLAAEGLVSVKVSDDFTSATVSEINSETDFVAKNDQFIALTKDTTAHIQN
FT                   NSLQSVEELHSSTINGVKFEEYLKSQIATIGENLVVRRFATLKAGANGVVNGYIHTNGR
FT                   VGVVIAAACDSAEVASKSRDLLRQICMHIAAMRPSYLSYEDLDMTFVENEYKALVAELE
FT                   KENEERRRLKDPNKPEHKIPQFASRKQLSDAILKEAEEKIKEELKTQGKPEKIWDNIIP
FT                   GKMNSFIADNSQLDSKFTLMGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGE
FT                   GLEKKTEDFAAEVAAQL"
FT   gene            497246..497881
FT                   /locus_tag="JJD26997_0549"
FT   CDS_pept        497246..497881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0549"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43505"
FT                   /db_xref="GOA:A7H2J4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2J4"
FT                   /protein_id="ABS43505.1"
FT                   /translation="MELLRAENLSHSFDYPLFEGLNLTLNTKDCIAIQGSSGCGKSTLL
FT                   HILSSLLIPKKGEVFFKGSSLYQIDENERLKIRRYDFGIIFQTHYLFKGFSALENIELA
FT                   SVLSDQDLDEKILKRLGIDTLLHQKIGKLSGGQQQRVSIARVLCKKPKIIFADEATGNL
FT                   DFDNAKNVIELLISYVKENDAALFFVTHDSKLASFCDETYTINANGIC"
FT   gene            497868..498635
FT                   /gene="fliR"
FT                   /locus_tag="JJD26997_0550"
FT   CDS_pept        497868..498635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="JJD26997_0550"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="identified by match to protein family HMM PF01311;
FT                   match to protein family HMM TIGR01400"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43620"
FT                   /db_xref="GOA:A7H2J5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2J5"
FT                   /protein_id="ABS43620.1"
FT                   /translation="MEFVNYLGDKNVVTFMLLLARMSGLIVFFPFFSHNSIPMVIKSTI
FT                   VLFLTMYLYPLARLESLHLDSFFVLQLISEVIFGMIAGLMLQIIFAIIMMAGEQIAFTM
FT                   GFTMASILDPSSGTSMPITAQILNLLALMFFLAFDGHHLMLLFLSHSLGYISLGGFYPH
FT                   ENLMHYLNIGMFNIFIIGFTMSFPILGISLLADVIFGLLMKTMPQFNLLVIGYPIKIAL
FT                   GFVVLIAILLVMMQYFKNLILELFTHMQTLFFS"
FT   gene            498692..500002
FT                   /locus_tag="JJD26997_0551"
FT   CDS_pept        498692..500002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0551"
FT                   /product="highly acidic protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43365"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2J6"
FT                   /protein_id="ABS43365.1"
FT                   /translation="MKILLLNENPVVSRLVGLSAKKMSYDFEELNAYSENLGNYDVIVV
FT                   DSDTPAPLKILKEKCDRLIFLAPRNQNVDIDAQILQKPFLPTDFLNLLNNKDANKHTSI
FT                   DLPMLSNDENPYADISLDLDNLNLDDLPDENSLDINSEGMEDLSFDDAQDDNANKTLET
FT                   QNLEDENLEQETTKEQTQEDIQTDLDLTLEDSESEKEDLSQEHTALDTEPSLDELDDKN
FT                   DEDLEDNKELQVNISDFDDLLVVEEQEKEMDFDDLPEDAEFLGQAKDNEESEEILEEFA
FT                   PVVEDIQDEMDDFTSNLSTQDQIKEELDQLDELDYGIDSDNSSKVLEDFKDEPILDDKE
FT                   LGTNEEEVVVPNLNISDFDALKESDIQEALREEILEKNEESIVSDATKDDSSEEIVNEL
FT                   SQSIAGAITSSIKDDTLKAALKGMNINININISFKED"
FT   gene            500005..500622
FT                   /locus_tag="JJD26997_0552"
FT   CDS_pept        500005..500622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0552"
FT                   /product="putative guanylate kinase"
FT                   /note="identified by match to protein family HMM PF00625;
FT                   match to protein family HMM TIGR03263"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43856"
FT                   /db_xref="GOA:A7H2J7"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2J7"
FT                   /protein_id="ABS43856.1"
FT                   /translation="MQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREG
FT                   EKNGIHYHFISHEEFQKGIDSDHFLEWAKVHENFYGTSLKHTQDALDNGKIVVFDIDVQ
FT                   GFKIARQKMADKIVSVFITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSEYD
FT                   YLIINNELKQSYEALRAILIAYKFRTKGQNLGQIQNIWNEGE"
FT   gene            500624..500863
FT                   /locus_tag="JJD26997_0553"
FT   CDS_pept        500624..500863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0553"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43207"
FT                   /db_xref="GOA:A7H2J8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2J8"
FT                   /protein_id="ABS43207.1"
FT                   /translation="MGGWSSPSHWLIILLIVVLLFGAKKIPELAKGLGKGIKTFKDEMN
FT                   NDDEVAKNTQKIEENKNTTNNTNADASIDETKKA"
FT   gene            500875..502467
FT                   /gene="argS"
FT                   /locus_tag="JJD26997_0554"
FT   CDS_pept        500875..502467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="JJD26997_0554"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44529"
FT                   /db_xref="GOA:A7H2J9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2J9"
FT                   /protein_id="ABS44529.1"
FT                   /translation="MKSIIFNEIKKILECDFALENPKDKNLAHFATPLAFSLAKELKKS
FT                   PMFIASDLASKFQNHDCFESVEAVNGYLNFRISKTFLNELANQALTNPNDFTKGEKKQE
FT                   SFLLEYVSANPTGPLHIGHARGAVFGNTLTRLARHLGYKFDTEYYVNDAGNQIYLLGLS
FT                   ILLSVKENILHENVEYPEQYYKGEYIADLAKEAFEKFGKEFFSEENIPSLADWAKDKML
FT                   VLIKQNLEQAKIKIDSYVSERSYYDALNATLESLKEHKGIYEQEGKIWLASSQKGDEKD
FT                   RVIIREDGRGTYLAADIVYHKDKMSRGYGKCINIWGADHHGYIPRMKAAMEFLGFDSNN
FT                   LEIILAQMVSLLKDGEPYKMSKRAGNFILMSAVVDEIGSDALRYIFLSKKCDTHLEFDI
FT                   SDLQKEDSSNPVYYINYAHARIYQVFAKAGKKIDDVMGADLQSLNQDGINLLFEALNLK
FT                   AILNDAFEARALQKIPDYLKNLAANFHKFYNENKVVGSANENDLLKLFSLVALSIKTAF
FT                   SLMGIEAKNKMEH"
FT   gene            complement(502485..502793)
FT                   /locus_tag="JJD26997_0555"
FT   CDS_pept        complement(502485..502793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0555"
FT                   /product="multidrug resistance protein, SMR family"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43535"
FT                   /db_xref="GOA:A7H2K0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K0"
FT                   /protein_id="ABS43535.1"
FT                   /translation="MYIFIIVLSALLDIVSNLLLKKSDGFKHKIWGLAAIINAILAFFL
FT                   LSFSLKYVPLSIAYSTWGAIGIIGTCLGGWILYKEKLNKIGILGIVIVIIAVFLLNY"
FT   gene            complement(502793..503134)
FT                   /locus_tag="JJD26997_0556"
FT   CDS_pept        complement(502793..503134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0556"
FT                   /product="multidrug resistance protein, SMR family"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44312"
FT                   /db_xref="GOA:A7H2K1"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K1"
FT                   /protein_id="ABS44312.1"
FT                   /translation="MNIAKKELFVAWFFLIAAIVFEVLGTSFLKMENQILGYIFMALFI
FT                   AFSYFFMGKAIKKIQVGIAYAVWELLGIILILLVSFIVFKESLTLTQILGIILSIVGII
FT                   MINIGEVKE"
FT   gene            503244..503951
FT                   /locus_tag="JJD26997_0557"
FT   CDS_pept        503244..503951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0557"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43140"
FT                   /db_xref="GOA:A7H2K2"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2K2"
FT                   /protein_id="ABS43140.1"
FT                   /translation="MGRAFEYRRASKEARWDKMSKLFPKLAKAIQVAAKEGGIDPDMNP
FT                   KLRSAIATAKANNMPKDNIDAAIKRASGKDSADIKNIHYEGKAAHGALVIVECMSDNPT
FT                   RTVANVKAIFSKNGGEVLQNGSLGFMFTRKAVFHLEKFAGDLEELELDLIDAGFEELEQ
FT                   NEEELVISGDYTAFGELSSAIEAKGLVLKKAGLEYIPNNPVSFSKEQLSDIEKLLDKLE
FT                   DDDDVQAVYTNID"
FT   gene            503961..504443
FT                   /gene="ppiB"
FT                   /locus_tag="JJD26997_0558"
FT   CDS_pept        503961..504443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="JJD26997_0558"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43165"
FT                   /db_xref="GOA:A7H2K3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K3"
FT                   /protein_id="ABS43165.1"
FT                   /translation="MIKTIDTSKVNEYKFALIKTEKGIMKLKLFGDEAPQTVCNFATLA
FT                   NEGFYKDLNFHRVIPNFVIQGGCPHGNGIGGPGYEIICECDDQEHKHERGALSMAHAGR
FT                   DTGGSQFFICHSPQAHLDGVHTVFGQIDPKDEESLEVLDSIRQGDKILDIKICDKI"
FT   gene            504588..505030
FT                   /pseudo
FT                   /locus_tag="JJD26997_0559"
FT                   /note="50 kDa outer membrane protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            505031..505447
FT                   /pseudo
FT                   /locus_tag="JJD26997_0561"
FT                   /note="50 kDa outer membrane protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            505493..505621
FT                   /pseudo
FT                   /locus_tag="JJD26997_0562"
FT                   /note="50 kDa outer membrane protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            505632..505877
FT                   /pseudo
FT                   /locus_tag="JJD26997_0563"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            505997..506152
FT                   /locus_tag="JJD26997_0564"
FT   CDS_pept        505997..506152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44374"
FT                   /db_xref="GOA:A7H2K4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K4"
FT                   /protein_id="ABS44374.1"
FT                   /translation="MVVLFGWLYSYFWYYIGQNEELIKTYLTQILIIIIIFVILASLIY
FT                   IKIKKP"
FT   gene            complement(506159..506941)
FT                   /locus_tag="JJD26997_0565"
FT   CDS_pept        complement(506159..506941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0565"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF02866"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44632"
FT                   /db_xref="GOA:A7H2K5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K5"
FT                   /protein_id="ABS44632.1"
FT                   /translation="MSAIHFSYTKIFHVLNLENLASCDIIILAFRKESLKELPSRLVEL
FT                   QNNILELKDIVLTLKNANFKGKYIVATNPNDTITYYTQVLSQLPKNHVFGSGTNLDSSR
FT                   LKKLLAKDLNINSKDIFACMIGEHGDSQFAALSNASVLGQNLLDFYKQKLGKDLDIQEL
FT                   EKAVISEGYFIYERKGRTEFGIGTSCTNLAKAILEDRKSLHPVSVIFDDIAFSMPAIIG
FT                   KDGIEKVFELKFNEKEKTKLENSKQQIKNAIQSVKDKI"
FT   gene            507374..507613
FT                   /locus_tag="JJD26997_0566"
FT   CDS_pept        507374..507613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43861"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K6"
FT                   /protein_id="ABS43861.1"
FT                   /translation="MLCPVCNVDLVMSDRSGVEIDYCPKCRGVWLDRGELDKIIERSVP
FT                   NTANFNQDPIQESRYNDSAYHQHNGFYKKKKKVG"
FT   gene            507709..508659
FT                   /locus_tag="JJD26997_0567"
FT   CDS_pept        507709..508659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0567"
FT                   /product="cation efflux family protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43849"
FT                   /db_xref="GOA:A7H2K7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K7"
FT                   /protein_id="ABS43849.1"
FT                   /translation="MYKFLSHEPLANKSCHHDHEEHSHEHHHSHADARSMDKKILKISL
FT                   LMTFSMMLVQFIYSILSNSLALLSDTLHMFSDVFALALSFLAIIAVEKWQDHQKTFGYF
FT                   RLEVLVAFINALTIILSALFIIYEAIEKFINPKEIDAKTMIIVAILGFLVNGINALMMF
FT                   KGANLENVNMKSAFLHMMSDLLGSLAVIIGGIVVYFSGIVYIDTILAIILSILLLRWAI
FT                   ILLKQSANVLLESSPVNIEKVRQVLLLNPSVDEVVDLHITQITNKMLVASMHLKVRICD
FT                   LKEFEKLSQDLSHKLLHEFKIGHITIQPIRSENEI"
FT   gene            508679..508843
FT                   /locus_tag="JJD26997_0568"
FT   CDS_pept        508679..508843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44836"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K8"
FT                   /protein_id="ABS44836.1"
FT                   /translation="MNCVNLIKNSLEGEFGNIEVDLEKKILSLNLEENQVSNFTKEFQD
FT                   LGFEIVERL"
FT   gene            508843..510942
FT                   /locus_tag="JJD26997_0569"
FT   CDS_pept        508843..510942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0569"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43188"
FT                   /db_xref="GOA:A7H2K9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2K9"
FT                   /protein_id="ABS43188.1"
FT                   /translation="MEELRIKIGKMTCVNCSNAIERACKKIDGVKDASVSYVNSSGVFL
FT                   LEDQEKRKDIIAKIKNLGFEILEDEQSLNAYKAKKHLELRKNLLLSIVLSVIIMYFEMF
FT                   VKSSFSQNIQMALSFFGIFYCGRDFFSHAFLGLKSKNLDMNTLVALGTLSAFVYSFLVY
FT                   LQIFKEEDLYFSGAMMIISFVLLGKYLESKAKFKAQDYQRILENIDTKKTKILLEDESI
FT                   KEISSSFVKSGDVLLVKEGESIVADGVVLLGSAELDMSFLNGEFLPVLKKEGDEVQAGG
FT                   VVLNGALRIKANKKAIDSTLEQIKNLVFEAGNIKSPLANLADQISKYFVGGIIFFAFLV
FT                   FIFWVVKADLNTAFLHACAALLISCPCALGLATPVALVVASANAAKNFILIKNPAALEK
FT                   LALVKYAFFDKTGTLTKENLSIFKHNLSKDDFDKLCQIESLSSHPIAKALHKDQIFDLK
FT                   GEGRVIVGSGIKYKEDSDIYLAGSAQFLHENEIDTKESDIFFDTFKEYIRVYFAKNKKC
FT                   LGGVLLSNALKDGAKELVLNLKKQNLKTFILSGDHVKNVEKIVKELQIDEFYAQLKSEE
FT                   KLHIIQKFEKTLFVGDGINDAAALSAASVSMSFSKANELAKKTGDFILIKDDLSAIFKC
FT                   FKLAKKTRSIIKLNLFWAFIYNVLCIPVAAGFIPFITLSPHIAAFAMCFSSITVVLNSL
FT                   LIFKF"
FT   gene            511269..512810
FT                   /pseudo
FT                   /locus_tag="JJD26997_0570"
FT                   /note="putative sugar transferase; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(512970..514499)
FT                   /gene="dnaX"
FT                   /locus_tag="JJD26997_0571"
FT   CDS_pept        complement(512970..514499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="JJD26997_0571"
FT                   /product="DNA polymerase III, gamma/tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44013"
FT                   /db_xref="GOA:A7H2L0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L0"
FT                   /protein_id="ABS44013.1"
FT                   /translation="MLQALAIKYRPKTFDELIGQKTVSVSLKYALNHNRLAHAYLFSGL
FT                   RGSGKTSSARIFSRALVCEQGPSDTPCGTCKHCIAALEGKHIDIIEMDAASNRGLEDIQ
FT                   ALIEQTKYTPSMARFKIFIIDEVHMLTPQAANALLKTLEEPPSYVKFILATTDPLKLPA
FT                   TVLSRTQHFRFKQIPQSEILNHLKEILHKENVKFEEEALKFIARSGNGSLRDTLTLLDQ
FT                   AIIFCQNEINTSKITDMLGFLDPQKIKAFYQAILAKNKEKVFAYLEELQDYEASSVIDE
FT                   MLFYLKESFFAKSTEFSTLIYERFFRILSKAKNMLCDDDGFTLCVMTFMMMEASHLKEI
FT                   DTQIQEIKQENITNITPKITATPIIPNLEKKIEKNAYEILLDSIYNRNFELGECFKQST
FT                   KFISFENNTLNISSNAQGQNRDMLNKNFKLIQELFKTEFGENTKINVQKALTIDENKLQ
FT                   SLTQELPNNENKNIDIQSSINMLKEGAKKFDPQEDLKEALKDCFGEPSIEN"
FT   gene            complement(514503..515801)
FT                   /gene="rho"
FT                   /locus_tag="JJD26997_0572"
FT   CDS_pept        complement(514503..515801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="JJD26997_0572"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43788"
FT                   /db_xref="GOA:A7H2L1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L1"
FT                   /protein_id="ABS43788.1"
FT                   /translation="MEKEKKQHQRTHVPVEGYKIEELKLLDLENLVKIANECEIENPRE
FT                   LRRQELIFEILKAQTKKGGFILFTGILEISSEGYGFLRGMDSNLSDSVNDAYVSNSQIR
FT                   KFALRVGDIVTGQVREPKDQEKYYALLKIEAINYLPLQEAKERPLFDNLTPIFPTEKIK
FT                   LEYDAMKLTGRILDLFTPIGKGQRGLIVAPPRTGKTELMKELATAIAKNHPEMHLIVLL
FT                   VDERPEEVTDMQRCVKGEVFSSTFDLPAYNHVRVAELVIEKAKRMVETGKDVIILLDSI
FT                   TRLARAYNTATPSSGKVLSGGVDANALHKPKRFFGAARNIENGGSLTIVATALIDTGSR
FT                   MDDVIFEEFKGTGNSEIVLDRNISDRRIYPAINIIKSGTRKEELLQGVANLQKIWAIRS
FT                   AISQMDDVEALKFLYSKMLKTKDNVELLSIMNE"
FT   gene            515916..518267
FT                   /locus_tag="JJD26997_0573"
FT   CDS_pept        515916..518267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0573"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44154"
FT                   /db_xref="GOA:A7H2L2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L2"
FT                   /protein_id="ABS44154.1"
FT                   /translation="MKCEHCRLDYKQVQMIEYKGKFFCCKGCESVWEILHESGLDEFYE
FT                   KLGNQTLSPVNFQNEMKNYDEFITKTKEGFSEIYLMIHGIECAACVWLNEKILTKQEGI
FT                   LELDINHLNHKARIVFDEQSISLVQILRLIESIGYKASAYDASKASKKADLLKREFYSK
FT                   LVVAIACVMNIMWIAVAKYAGFFSGMDKDTKDILNFAEFILCSPVLFYTGSHFYKSAFK
FT                   TLKMHSLNMDVLVISGASLAYVYSLWAMFFRVGEVYFDSVAMIVCFVFIGKYLEMFSKK
FT                   CALDTIDGLNDFLRNEVLVFNGKEFTPKEVQKVCLGDRILLKTGDKILIDGVCKSGEMS
FT                   VDTSSLNGESIPKLIQKEDEIFSACIVLDGSVEYEATKLYKDSKLSQIIGLLELASSKK
FT                   AKLESLVNSLSAYFSRTVLLIAFICFAFWFFYKEASFEISLVNAIAVLIIACPCALALA
FT                   TPVSNLVALGRALKKHILFKSSSVIEDLSKCDYVVFDKTGILTKIELELKEVFLDKMLD
FT                   LNEFYNFVKLSKHPISQNIASYLKQKGAKDLNLDFKKHSSIQAKGLSAELNKGLLLGGS
FT                   SKFLQEKGIATKEFDNTHFIFAKEGKILAFFEFDSVLREGVKELIAYLKKEKKELMILS
FT                   GDHQKAVEKIAKKLEIQNYQAFCLPEDKMKTIENLSKNYKVLFVGDGVNDALALKYASV
FT                   SMTLREGSDLAIESSDVLLLKNDLLSLKKAIKLSKNTFKIIKQNLAFSLFYNACTIPLA
FT                   FLGMINPLFAAISMSFSSTIVVLNALRIKE"
FT   gene            518264..518470
FT                   /locus_tag="JJD26997_0574"
FT   CDS_pept        518264..518470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0574"
FT                   /product="putative cytochrome oxidase maturation protein,
FT                   cbb3-type"
FT                   /note="identified by match to protein family HMM PF03597;
FT                   match to protein family HMM TIGR00847"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43246"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L3"
FT                   /protein_id="ABS43246.1"
FT                   /translation="MNSIIMMMIGVSILAFFIILATLLWGIKNKQFDDDYKFTTLNDDE
FT                   DSLRDAIELERRKKEALNKKRLS"
FT   gene            complement(518493..518795)
FT                   /gene="cyf"
FT                   /locus_tag="JJD26997_0575"
FT   CDS_pept        complement(518493..518795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyf"
FT                   /locus_tag="JJD26997_0575"
FT                   /product="cytochrome c553"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43582"
FT                   /db_xref="GOA:A7H2L4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L4"
FT                   /protein_id="ABS43582.1"
FT                   /translation="MKKLLVVSALACLGVSAFAADGATLFKKCAVCHGANADKVYLNKV
FT                   PALKTLSSAERLQYMKEYSEGKRNAYGQGAIMKLNLKGFTEEDFKAIEAHIETLK"
FT   gene            518877..519434
FT                   /locus_tag="JJD26997_0576"
FT   CDS_pept        518877..519434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0576"
FT                   /product="putative hydrolase"
FT                   /note="identified by match to protein family HMM PF08645;
FT                   match to protein family HMM TIGR00213; match to protein
FT                   family HMM TIGR01656; match to protein family HMM
FT                   TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43465"
FT                   /db_xref="GOA:A7H2L5"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L5"
FT                   /protein_id="ABS43465.1"
FT                   /translation="MFIFFLKKLYYNVFMKTKALFLDRDGVINIDKKYVYKIEDFEFCD
FT                   GIFELCRYFLARNYLLFIATNQSGIARGYYKESDFFKLCDYMLKEFAKQDIKIDKIYYC
FT                   PHLEGCECRKPKAGMLLKAKDEFDLDMKNSIFIGDNLSDMQAGLNADIGTLILVNEEKK
FT                   GNFFKQFKNLKEILRFLKEKDI"
FT   gene            519435..520388
FT                   /gene="waaD"
FT                   /locus_tag="JJD26997_0577"
FT   CDS_pept        519435..520388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaD"
FT                   /locus_tag="JJD26997_0577"
FT                   /product="ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF04321; match to protein family HMM PF07993;
FT                   match to protein family HMM TIGR02197"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43804"
FT                   /db_xref="GOA:A7H2L6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L6"
FT                   /protein_id="ABS43804.1"
FT                   /translation="MKIAITGGAGFIGSQLALNLQEKHEILIIDKMRSSATFENGNLQS
FT                   FGHFKNLLEFDGELFAGDINDEKVLKKIEDFKPEIIFHQAAISDTTVFDQTKVLQTNLN
FT                   TFKDFIELSIDLNAKLIYASSASVYGDAKSPQTVDKDEEPKNPYAFSKLMMDKLVKKYY
FT                   DKAHLVGLRYFNVYGKGEFYKNKTASMVLQFGHQILAGKNPCLFEGSDQIYRDFTYIKD
FT                   VISANLVALDSKCGVYNVGSGKARTFQDIVDILQKELKTDLPCEYIPNPYVKSYQFHTE
FT                   AKLDQTWDYQPKFSLEEGIKDYLGEIKRLFEKEVNA"
FT   gene            520381..521766
FT                   /gene="hldE"
FT                   /locus_tag="JJD26997_0578"
FT   CDS_pept        520381..521766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="JJD26997_0578"
FT                   /product="D,D-heptose 1-phosphate
FT                   adenosyltransferase/7-phosphate kinase"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM PF01467; match to protein
FT                   family HMM TIGR00125; match to protein family HMM
FT                   TIGR02198; match to protein family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44615"
FT                   /db_xref="GOA:A7H2L7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2L7"
FT                   /protein_id="ABS44615.1"
FT                   /translation="MLEFLSQQKPKILIIGDFMVDNYTWCDCSRISPEAPVLVAKTLKE
FT                   DKRLGGAANVYANLKSLGADVFALGVVGDDESGKFLQENLKGEFLIQKGRKTPFKNRIM
FT                   AHNQQVLRLDEEDTSEILLENELIALFDEKIKDFKAVVLSDYAKGILTPKVCKALIKKA
FT                   KALNIPVLVDPKGSDFSKYSGATLLTPNKKEALEALKFENLEGENLEKGIKKLKEDFAL
FT                   RYSIITLSEAGIALFDKSLKIAPAKALEVYDVTGAGDSVIAVLAFCLANGVEIFKACEL
FT                   ANEAAAVVVGKIGSVSVSFDEIKSFNRVDFEKKIKSKEELLTLLKQKDKKIVFTNGCFD
FT                   IVHFGHIKYLEKAKRLGDVLIVGLNSDASVKKLKGESRPVNSEFQRACMLAAFYFVDFV
FT                   VIFDEDTPLELISFLKPDILVKGADYKDKIVVGADIVSKVELIDFEEGFSTSKIIEKIK
FT                   DKK"
FT   gene            521763..522323
FT                   /gene="gmhA-1"
FT                   /locus_tag="JJD26997_0579"
FT   CDS_pept        521763..522323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA-1"
FT                   /locus_tag="JJD26997_0579"
FT                   /product="phosphoheptose isomerase"
FT                   /note="identified by match to protein family HMM TIGR00441"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43187"
FT                   /db_xref="GOA:A7H2L8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L8"
FT                   /protein_id="ABS43187.1"
FT                   /translation="MINLVEKEWQEHQKIAQASEILKGQIAKVGELLCECLKKGGKILI
FT                   CGNGGSAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEA
FT                   LGNENDVLIGISTSGKSPNVLEAFKKAKELNMLCLGLSGKGGGMMNKLCDHNLVVPSDD
FT                   TARIQEMHILIIHTLCQIVDESF"
FT   gene            522323..523087
FT                   /locus_tag="JJD26997_0581"
FT   CDS_pept        522323..523087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0581"
FT                   /product="putative lipooligosaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF01755"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44603"
FT                   /db_xref="GOA:A7H2L9"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2L9"
FT                   /protein_id="ABS44603.1"
FT                   /translation="MKVFIINLERSLDRKEHMQKQIQKLFEKNPSLKNKLEFVFFKAID
FT                   AKNKEHLEFKDHFPWWGSWVLGRELSDGEKACFASHYKLWQECVKLDEPIIILEDDVEF
FT                   SDEFLNNGAEYIDELLKSEYEYIRLCYLFDKRLYFLSEGGYYLSFEKLAGAQGYVLQVS
FT                   AAMKFLKCAKNWIYAVDDYMDMFYRHNVLNIVKKPLLLKHDCRIESSISQAGRLFLKAK
FT                   FYRKIIREIFRLYRNILKLSYTFYIKKKLDIS"
FT   gene            complement(523073..524023)
FT                   /gene="waaF"
FT                   /locus_tag="JJD26997_0580"
FT   CDS_pept        complement(523073..524023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaF"
FT                   /locus_tag="JJD26997_0580"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02195"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44171"
FT                   /db_xref="GOA:A7H2M0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M0"
FT                   /protein_id="ABS44171.1"
FT                   /translation="MKIFIHLPTWLGDAVMASPALYAIKEHFKDAQFILYGSLVSTALF
FT                   KEFPSSKIIIENKQSRYKQALSLRKKLGKIDLSFAFRSAFSSKIILHILKTKQRYFFDK
FT                   NKHKEEHQVLKYLYFIENSLHIKAYLKDLKLPFKLKFQSPLVLKNGKKILGLNPGASFG
FT                   SAKRWDASYFAKVALNFSQSHEILIFGAGKAEQELCDEIYQILKEQNIKVKNLCNKTTI
FT                   KTLCQNIAFCDFFITNDSGPMHISAVYKVKTVAIFGPTKFTQTSPWQNENARWVHLNLA
FT                   CMPCMQKTCPLKHHKCMKDLKPEVILKAIQNLTNI"
FT   gene            524081..524899
FT                   /locus_tag="JJD26997_0582"
FT   CDS_pept        524081..524899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0582"
FT                   /product="lipooligosaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43863"
FT                   /db_xref="GOA:A7H2M1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M1"
FT                   /protein_id="ABS43863.1"
FT                   /translation="MPQLSIIIPLFNSCDFILRALQSCINQTLKDIEILIIDDKSKDNS
FT                   LNMVLEFAKKDPRIKIFQNEENLGTFASRDLGVLHSSSDFIMFLDSDDFLTLDACEIAF
FT                   KEMKKGFDLLCFDAFVHRVKTKQFYRFKQDGVFNQKEFLEFLSKQRHFCWSVWAKCFRK
FT                   DIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHYEFNPNGRYENKNKE
FT                   ILNQNYQDKKKSNELIRKLSLDFENDTFHQKLFEVLKKEEMDLKNRIKKK"
FT   gene            524939..526084
FT                   /locus_tag="JJD26997_0583"
FT   CDS_pept        524939..526084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0583"
FT                   /product="glycosyl transferase family 8"
FT                   /note="identified by match to protein family HMM PF01501"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43629"
FT                   /db_xref="GOA:A7H2M2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M2"
FT                   /protein_id="ABS43629.1"
FT                   /translation="MFHIVLNANENYIKYAAVLMTSIIQKTDLNKSMSEFCNFDTDEGY
FT                   VFHILSDHISESMKVRISNLEKQLNDIYPCKIVLHILNDDEFKGMLKWRGNYLAYYRIK
FT                   MASVLPQNLKICLYLDCDMLCFGDLRELLSVDINNYQAAVCLDGNNHKKNKKVFFSLKG
FT                   REKYKFSNIEKYFNSGFILVNLDRWRRDNIENKSIDFLKKFKTLYPDQDALNFALNDTL
FT                   LLPNRWNFSLGYFVAFLKNSQEILFLNQTKYPHLNYTKTEFENEVKNIKIAHFILDPFK
FT                   PWDAFQYSIVNDDLQLIEYPFYKHYWSVAKNTPEFYLDFLVQKESINEHKAENLINELG
FT                   KAVVKEMRRYTSRASYRRLRKSIIFLYIINVILIIYVVLNH"
FT   gene            526111..526974
FT                   /locus_tag="JJD26997_0585"
FT   CDS_pept        526111..526974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0585"
FT                   /product="beta-1,3-galactosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44592"
FT                   /db_xref="GOA:A7H2M3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M3"
FT                   /protein_id="ABS44592.1"
FT                   /translation="MPKISIILPTFNVEKYIARAIESCINQSFKDIEIIVVDDCGSDKS
FT                   IDIAKEYAKKDERIKIIHNEENLGTFAARNNGVKAAGGGYIMFLDPDDYLELDACEKLI
FT                   LLINTYKICQFSFTQISNGIKLKSVFKDTLKNLKEFKGIYWNIWTLFVKKDFYLKSLEE
FT                   LFLIDKKLLVAEDMLAVFFLINNLKDDEYLQVDLHLYNYVDHSFSITKRQKNKEKIQEC
FT                   LDDYFYILKYIKENKILKENLKSYVLIYLQIDILKFLFNNKKINYFKYKLLKKICKIKL
FT                   FFYHFF"
FT   gene            complement(526971..528032)
FT                   /locus_tag="JJD26997_0584"
FT   CDS_pept        complement(526971..528032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0584"
FT                   /product="putative glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44613"
FT                   /db_xref="GOA:A7H2M4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M4"
FT                   /protein_id="ABS44613.1"
FT                   /translation="MKKINIFLKDITESGGGERVCVNLANAFSKKYEVEIFSFYRSFEQ
FT                   PAYELYKNIKISYLSNQNFYHANKIKKIFLKTFYRYFLSLLIILKFKNAKNEILLANDG
FT                   YFLPFFKNKKLKYFRIWHIKAPKKKKKIFDYFDTLIILSAKELNKWQEWHKNIQVIPNF
FT                   LPFTSSKTSNLSQKVVLSVGRFTKEKGFLRLIDIWELVQKDENFKEWKLHIVGDGLLKE
FT                   EILHKIQAKKLEHSIILLPFNKNIEEEYLKASIYVMASHFEGFGMVLAESANYTIPSIA
FT                   FDINTGPSDIIDNEKSGFLIEDGNLQEFVKKLKILMQDGSLRKKFGKNAKEKVQKEFSK
FT                   EVIMKKWNKIASF"
FT   gene            complement(528019..528792)
FT                   /locus_tag="JJD26997_0586"
FT   CDS_pept        complement(528019..528792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0586"
FT                   /product="LgtF"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43621"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M5"
FT                   /protein_id="ABS43621.1"
FT                   /translation="MNLKQISVIIIVKNAEQTLLECLNSLKDFDEIILLNNESSDDTLK
FT                   IVNEFKKDFANLHIYHSAFIGFGALKNLTLSYVKNDWILSIDADEMLENECINELKNLE
FT                   FKKEDIIALSRKNLYKGEWIKACGWWPDYVLRIFNKNFTHFNDNLVHESLVLPSNAKKI
FT                   YLKNGLKHYACNGMESMIYKMNLYTSFSAKEKLKQDEKASIFGAILRFWLTFIKDYFFR
FT                   GGIKYGYKGFIIALLNANGAFFRYMKLYELNHEKN"
FT   gene            complement(528789..529676)
FT                   /gene="waaM"
FT                   /locus_tag="JJD26997_0587"
FT   CDS_pept        complement(528789..529676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaM"
FT                   /locus_tag="JJD26997_0587"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44115"
FT                   /db_xref="GOA:A7H2M6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M6"
FT                   /protein_id="ABS44115.1"
FT                   /translation="MKNSDRIYLSLYYILKFFVTFMPDCILHFLALIVARITFYLNKKH
FT                   RKIIDTNLQICFPQYTQKERDKLSLKIYENFAQFGIDCLQNQNTTKEKILNKVNFINEN
FT                   FLIDALALKRPIIFITAHYGNWEILSLAYAAKYGAISIVGKKLKSEVMYEILSRSRTQF
FT                   DIELIDKKGGIRQMLNALKKERALGILTDQDCTENESVRLKFFNKEVNYQMGASLIAQR
FT                   SNALIIPIYAYKEDGKFCIEFFKAKDSQNASLEELTLYQAQSCEEMIKKRPWEYFFFHR
FT                   RFASYNEEIYKDTK"
FT   gene            complement(529666..530694)
FT                   /gene="waaC"
FT                   /locus_tag="JJD26997_0588"
FT   CDS_pept        complement(529666..530694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaC"
FT                   /locus_tag="JJD26997_0588"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="identified by match to protein family HMM PF01075;
FT                   match to protein family HMM TIGR02193"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43359"
FT                   /db_xref="GOA:A7H2M7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M7"
FT                   /protein_id="ABS43359.1"
FT                   /translation="MKIAIVRLSALGDIIQSAVVLQFIKNFKKDIEIHWFVDEKFEGIL
FT                   KNHPLIDKLYALPLKDKKILKSLKILLKARKNNYNAVIDLQGLIKSAIASRILSRNNFG
FT                   FDKNSLKESFAHNFYNQKLELDYNENVFVRYLSLTSFVLNTDFNAKNLAFKQDIFSVNE
FT                   NLKQLLSNKLKLDKNEQNILIHVGSSVENKIYPKTKLAILCKLLINEFQQAKIWLAWGN
FT                   VKEYEFAKEVLNLSGIDETHIELAPKFSLEELMAFIKMMNLIIGNDSGPTHLAFALNKA
FT                   SITIFGATPSYRNAFQTHINKIIDAGKKIQNAKHIDKSDFCITRIEEEDIFKLAKGLLN
FT                   EK"
FT   gene            530757..531551
FT                   /gene="wlaX"
FT                   /locus_tag="JJD26997_0589"
FT   CDS_pept        530757..531551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wlaX"
FT                   /locus_tag="JJD26997_0589"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43819"
FT                   /db_xref="GOA:A7H2M8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M8"
FT                   /protein_id="ABS43819.1"
FT                   /translation="MAKNEGYICVFDCESVPDVELIRKTLGFEGSDLEISLRALQWQKE
FT                   QSGSEFLPLPYHKIISICAVLSDNFGKFIKVNKIDGQNEKEMIENFFNFIENYEPKLVS
FT                   FNGKNFDMPVLVLRALKYNLKAATYLDTQSDKWNNYKTRFSELKHCDLLESLGSNGRGI
FT                   KLDTLCSMVGLPGKYDMHGDEVMKLFYGNELEKIHEYCESDVLNTYMLFLKYELIKGNV
FT                   SEEDYVDFLSCMRDFLRAKKANRSYTEVFAKACESEILKVQP"
FT   gene            531610..532596
FT                   /gene="galE"
FT                   /locus_tag="JJD26997_0590"
FT   CDS_pept        531610..532596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="JJD26997_0590"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44773"
FT                   /db_xref="GOA:A7H2M9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2M9"
FT                   /protein_id="ABS44773.1"
FT                   /translation="MKILISGGAGYIGSHTLRQFLKTDHEICVLDNLSKGSKIAIEDLQ
FT                   KIRAFKFFEQDLSDFQGVKALFEREKFDAIVHFAASIEVFESMQNPLKYYMNNTVNTTN
FT                   LIETCLQTGVNKFIFSSTAATYGEPQTPVVSEISPLAPINPYGRSKLMSEEVLRDASMA
FT                   NPEFKHCILRYFNVAGACMDYTLGQRYPKATLLIKVAAECATGKRDKLFIFGDDYDTKD
FT                   GTCIRDFIHVDDISSAHLAALDYLQENESNVFNVGYGHGFSVKEVIEAVKKVSGVDFKV
FT                   ELAPRRAGDPSVLISDASKIRNLTSWQPKYDDLELICKSAFDWEKQC"
FT   gene            532590..534284
FT                   /gene="wlaB"
FT                   /locus_tag="JJD26997_0591"
FT   CDS_pept        532590..534284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wlaB"
FT                   /locus_tag="JJD26997_0591"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43200"
FT                   /db_xref="GOA:A7H2N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N0"
FT                   /protein_id="ABS43200.1"
FT                   /translation="MLKKLFFILSKEDKNFLFFLLVFSIFVSFIETFAISLVMPFITLA
FT                   SDFSYFDRNKYLISLKEYLNIPVFEIIVYFGVGLIVFYVFRALLNAYYFHLLARFSKGR
FT                   YHVIAYKVFSKFLNINYEKFTQKNQSEILKSITGEVYNLSTMISSFLLLMSEIFVVLLL
FT                   YALMLLINYKITLFLSIFMVLNAFILVKILSPIIKKAGLRREEAMKNFFEILNTNLNNF
FT                   KFIKLKTKEDGVLSLFKEQSEAFSKANITNESVAAVPRIYLEGIGFCVLVFIAVFLVLK
FT                   NESDISGILSTISIFVLALYRLMPSANRIITSYHDLLYYHSSLDIIYQNLRQEEENLGE
FT                   KKLSFNQELKICNLSFGYEGKKHLFKNLNLSIKKGEKIAFIGESGCGKSTLVDLIIGLL
FT                   KPKEGQILIDKQELNANNTKNYRQKIGYIPQNIYLFNDSIAKNITFGDAVDEEKLNRVI
FT                   KQANLEHFIKNLPQGVQTKVGDGGSNLSGGQKQRIAIARALYLEPEILVLDEATSALDT
FT                   QSEAKIMDEIYKISKDKTMIIIAHRLSTITQCDKVYRLEHGKLKEEK"
FT   gene            534281..535360
FT                   /gene="pglH"
FT                   /locus_tag="JJD26997_0592"
FT   CDS_pept        534281..535360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglH"
FT                   /locus_tag="JJD26997_0592"
FT                   /product="general glycosylation pathway protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44152"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N1"
FT                   /protein_id="ABS44152.1"
FT                   /translation="MMKISFIIATLNSGGAERVLVTLANALCKEHEVSIIKFHAGESFY
FT                   KLENEVQVTSLEQFRFDTLYHKIASRFKKFFALRKALKESKADVFISFLDTTNIACIAA
FT                   KIGLKTPLIISEHSNEAYLKPKIWRFLRRVSYPFCDALSVLGSSDKVYYERFVKRVKLL
FT                   LNPCHFSDEIPFDSSFEKENLVLFIGRLDHNKNPAMFLKAIAHLDKNLQENYKFVIAGD
FT                   GELRQELEYKVKSLGIKVDFLGRVENVKALYEKAKVLCLCSFVEGLPTVLIESLYFEVC
FT                   RISSSYYNGVKDLIKDNHDGLLVGCDDEIALAKKLELVLNDENFRKELVNNAKQRCKDF
FT                   EISHIKEEWLKLIVEVKNA"
FT   gene            535353..536282
FT                   /gene="pglI"
FT                   /locus_tag="JJD26997_0593"
FT   CDS_pept        535353..536282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglI"
FT                   /locus_tag="JJD26997_0593"
FT                   /product="general glycosylation pathway protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43659"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N2"
FT                   /protein_id="ABS43659.1"
FT                   /translation="MPKLSVIVPTFNRQVLLEKAIKSIQNQDFKDLEIIVSDDNSSDDT
FT                   KSVVQNLQKDDDRIKYFLNQNYKQGPNGNKNNGLDQANGEFVTFLDDDDELLSGALSTL
FT                   MQKANEGYAHVFGNCLIEKEGNLSKEFSGKGLEKDSEISKKDFLMAKFSGEFFSIFKKS
FT                   LLENKRFNEEFYGNEATLWVNLYKEKSFYIHKAFRIYRIFRQNSVTLGASKNAHRVYLG
FT                   YLELAKILENELRMSKDKDYKKTCAGYYKMAAYYAKLAKNYKALYKCLFKSLSIKINTP
FT                   ALILLILSIIPNNMIEKLSKIRVALCKN"
FT   gene            536270..537367
FT                   /gene="pglJ"
FT                   /locus_tag="JJD26997_0594"
FT   CDS_pept        536270..537367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglJ"
FT                   /locus_tag="JJD26997_0594"
FT                   /product="general glycosylation pathway protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44627"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N3"
FT                   /protein_id="ABS44627.1"
FT                   /translation="MQKLGIFIYSLGSGGAERVVATLLPILSLKFEVYLILMNNKISYE
FT                   IPECQIHFLECSKPSENPILKFLKLPFLVLKYKKLCRNLGIDTEFVFLNRPNYIALMAR
FT                   MFGNKTRLVINECTMPSVMYAKNNFNSLANKFLISLLYPRADLILPNSKGNLEDLVQNF
FT                   SINPKKCEILYNAIDLENIEQKALEDIALKDKFILSVGRLDKGKNHALLIRAYARLKTN
FT                   LKLVILGEGVLKDELLALIKELNLEEKVLLLGFDNNPYKYMAKCEFFAFASVFEGFSNV
FT                   LIESLACSCAVVCTDHKSGARELFGDDEFGLLVEVDNENSMFQGLKTMLEDDKLRKAYK
FT                   NKAKTRAKAFDKVKIARDALKYLLG"
FT   gene            537371..539512
FT                   /gene="pglB"
FT                   /locus_tag="JJD26997_0595"
FT   CDS_pept        537371..539512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglB"
FT                   /locus_tag="JJD26997_0595"
FT                   /product="general glycosylation pathway protein"
FT                   /note="identified by match to protein family HMM PF02516"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43894"
FT                   /db_xref="GOA:A7H2N4"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="InterPro:IPR041563"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N4"
FT                   /protein_id="ABS43894.1"
FT                   /translation="MLKKEYLKNPYLVLFAMIILAYVFSVFCRFYWVWWASEFNEYFFN
FT                   NQLMIISNDGYAFAEGTRDMIAGFHQPNDLSYYGSSLSTLTYWLYKITPFSFESIILYM
FT                   STFLSSLLVIPIILLANEYKCPLMGFVAALLASIANSYYNRTMSGYYDTDMLVIVLPMF
FT                   ILFFMVRMILKKDFFSLIALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIF
FT                   YIAVILSSLTLSNIAWFYQSAIIVILFALFALEQKRLNFMIIGILGSATLIFLILSGGV
FT                   DPILYQLKFYIFRSDESANLTQGFMYFNVNQTIQEVENVDLSEFMRRISGSEIVFLFSL
FT                   FGFVWLLRKHKSMIIALPILVLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAILAKK
FT                   YSQLTSNICIVFTTVLTLTPVFIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWW
FT                   DYGYPVRYYSDVKTLVDGGKHLGKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQ
FT                   NDILKTDILQAMMKDYNQSNVDLFLVSLSKPDFKIDTLKTRDIYLYMPARMSLIFSTVA
FT                   SFSFINLDTGVLDKPFTFSTAYPLDVKNGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIV
FT                   EINSIKQGEYKITPIDDKAQFYIFYLKDSAIPYAQFILMNKTMFNSAYVQMFFLGNYDK
FT                   NLFDLVINSRDAKVFKLKI"
FT   gene            539523..540653
FT                   /gene="pglA"
FT                   /locus_tag="JJD26997_0596"
FT   CDS_pept        539523..540653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglA"
FT                   /locus_tag="JJD26997_0596"
FT                   /product="general glycosylation pathway protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43166"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N5"
FT                   /protein_id="ABS43166.1"
FT                   /translation="MRIGFLSHAGVSIYHFRMPIIKALKDRKDEVFVIVPQDKYTQKLR
FT                   DLGLKVIVYELSRASLNPFVVLKNFFYLAKVLKNLNLDFIQSAAHKSNTFGILAAKWVK
FT                   IPYCFALVEGLGSFYIDQGFKPNFVRFVINNLYKLSFKFAHQFIFVNESNAEFMRNLGL
FT                   KENKICVIKSVGINLKKFFPIYVESEKKELFWKNLNIDKKPIVLMIARALWHKGVKEFY
FT                   ESAAILKDKANFVLVGGRDENPSCASLEFLNSGVVHYLGTRSDIVELLQNCDIFVLPSY
FT                   KEGFPVSVLEAKACGKAIVVSDCEGCVEAISNAYDGLWAKTKNAKDLSEKILLLLEDEK
FT                   LRLNLGKNAAQDALQYDENIIAQRYLKLYDRVMKNV"
FT   gene            540646..541248
FT                   /gene="pglC"
FT                   /locus_tag="JJD26997_0597"
FT   CDS_pept        540646..541248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglC"
FT                   /locus_tag="JJD26997_0597"
FT                   /product="general glycosylation pathway protein"
FT                   /note="identified by match to protein family HMM PF02397"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44187"
FT                   /db_xref="GOA:A7H2N6"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N6"
FT                   /protein_id="ABS44187.1"
FT                   /translation="MYEKFLKRIFDFILALVLLVLFSPVILFIALLLKITQGSVIFTQN
FT                   RPGLNEKIFKIHKFKTMSDERDEKGELLGDELRLKAFGKIVRSLSLDELLQLFNVLKGD
FT                   MSFVGPRPLLVEYLPLYNEEQKLRHRVRPGITGWAQVNGRNAISWQKKFELDVYYVKNI
FT                   SFLFDLKIMFLTALKVLKRSGISKEDHVTTEKFNGKN"
FT   gene            541214..541825
FT                   /gene="pglD"
FT                   /locus_tag="JJD26997_0598"
FT   CDS_pept        541214..541825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglD"
FT                   /locus_tag="JJD26997_0598"
FT                   /product="general glycosylation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43348"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N7"
FT                   /protein_id="ABS43348.1"
FT                   /translation="MLQRRNLMVRTDKIYIYAASGHGFVCEDVAKNMGYKECIFLDDFK
FT                   GMKFESTLPKYDIFIAIGNNEIRKKIYQKISENGFKIVNLIHKSALISPSASVEENAGI
FT                   LIMPYVVINARAKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGIN
FT                   SCVLPNLSLADDSILGGGATLVQSQDEKGVFVGVPAKRKI"
FT   gene            541922..543082
FT                   /gene="pglE"
FT                   /locus_tag="JJD26997_0599"
FT   CDS_pept        541922..543082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglE"
FT                   /locus_tag="JJD26997_0599"
FT                   /product="general glycosylation pathway protein"
FT                   /note="identified by match to protein family HMM PF01041"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44323"
FT                   /db_xref="GOA:A7H2N8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N8"
FT                   /protein_id="ABS44323.1"
FT                   /translation="MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEQSVKDYS
FT                   KSENALALNSATAALHLALRVAGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDET
FT                   YNIDVDLLKLAIKECEKKPKALILTHLYGNAAKMDEIVEICKENEIVLIEDAAEALGSF
FT                   YKNKALGTFGEFGAYSYNGNKIITTSGGGMLIGKNKEKIEKARFYSTQAREKCLHYEHL
FT                   DYGYNYRLSNVLGAIGVAQMEVLEQRVLKKREIYEWYKEFLGEYFSFLDELKNSRSNRW
FT                   LSTVLIDFDKNELNAYQKDINISQKNIALYPKILKLIEDLKNEQIETRPLWKAMHTQEV
FT                   FKGAKAYLNGNSELFFQKGICLPSGTAMSKDDVYEISKLILKSIKA"
FT   gene            543084..544854
FT                   /pseudo
FT                   /gene="pglF"
FT                   /locus_tag="JJD26997_0600"
FT                   /note="general glycosylation pathway protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            544854..545747
FT                   /gene="pglG"
FT                   /locus_tag="JJD26997_0602"
FT   CDS_pept        544854..545747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pglG"
FT                   /locus_tag="JJD26997_0602"
FT                   /product="general glycosylation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44674"
FT                   /db_xref="GOA:A7H2N9"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2N9"
FT                   /protein_id="ABS44674.1"
FT                   /translation="MYIKDIQRFEDNRYRARAYMSYILTRNLPNKLPDIHLETIKTALD
FT                   KIAHEVVVFDALYILDISGMQIENAISLNKAHEIGQGEDRSTRSYFYRAVKLRRCVLSD
FT                   PYPSVLNNELCVTASMPIYDDKNNLLFVVCIDIKLEDILKIIQAGKFEFVFTQFSRLVY
FT                   FCFALVLFVITCFLFQKGFFSLFDNQAIGIEHMFESTIAITLALAIFDLAKTLIEQEVL
FT                   GRTKKEEGGIQKTMVRFLGSIIIALAIEALMLVFKLAIGDLSQMIYAIYLIGGVSLLLL
FT                   GLSVYLFTVKYKNNNI"
FT   gene            545860..546252
FT                   /gene="cheY"
FT                   /locus_tag="JJD26997_0603"
FT   CDS_pept        545860..546252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="JJD26997_0603"
FT                   /product="chemotaxis protein CheY"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44273"
FT                   /db_xref="GOA:A7H2P0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P0"
FT                   /protein_id="ABS44273.1"
FT                   /translation="MKLLVVDDSSTMRRIIKNTLTRLGHDDVLEAEHGVEAWDLLTKNE
FT                   DVKVLITDWNMPEMNGLELVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIV
FT                   KPFTPQVLKEKLEDVLGTGSGEGAAE"
FT   gene            546275..547123
FT                   /locus_tag="JJD26997_0604"
FT   CDS_pept        546275..547123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0604"
FT                   /product="putative ribosomal protein L11 methyltransferase"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM PF06325"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43619"
FT                   /db_xref="GOA:A7H2P1"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2P1"
FT                   /protein_id="ABS43619.1"
FT                   /translation="MQKKYYELFFIVEEQYKNLFLGFAFDLGIEAIEEKDNGIYIRSHE
FT                   SLEELSWALEIFAQKLTTTFNLNHKIISNLSLVEKENKDWIQEYKKGIKPILVDNVYIH
FT                   TTWQEEKKNCINIKINPALAFGSGHHESTHSCVKFLQKFSKSKLRALDLGCGSGILGII
FT                   MAKFGCNVEICDTDELAIDSSLENARLNGVDFHKAWCGSIDKANGLYNLIVANIIADVI
FT                   LILEKDIKNHLEDNAILILSGILDKYSTRIKEKFQDLELIDEMQINEWCSFVYKNNKKD
FT                   K"
FT   gene            547123..549060
FT                   /gene="ftsH"
FT                   /locus_tag="JJD26997_0605"
FT   CDS_pept        547123..549060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="JJD26997_0605"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44546"
FT                   /db_xref="GOA:A7H2P2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P2"
FT                   /protein_id="ABS44546.1"
FT                   /translation="MNNNTPNNKGNPQGNNFFNKNPIFIFAIFAIIMIIIFKGFFDGNG
FT                   SFGGALNGNEVNKNVPYSELKKLIESGQINQVSIGQTTIKAISSSHNTVYAAKKVNDPE
FT                   LVSLLDSKNIAYGAYSEANWFTDILFSWVLPVFIFFGIWMFLASRMQKNMGSSILGIGS
FT                   SKKLVNSEKPKVKFSDVAGVEEAKEEVKEIVDFLKYPERYIKLGAKIPKGLLLVGPPGT
FT                   GKTLLAKAVAGEADVPFFSVSGSSFIEMFVGVGASRVRDLFENAKKEAPAIVFIDEIDA
FT                   IGKSRAASGMMGGNDEREQTLNQLLAEMDGFGTESSPVIVLAATNRPEVLDAALLRPGR
FT                   FDRQVLVDKPDFKGRCDILKVHMKDVKISPKVKVEDIARLTAGLAGADLANIINEAALL
FT                   AGRDSKKHVEQNDLVEAVERAIAGLEKKSRRINEKEKKIVTYHECGHALIAETTKGAKR
FT                   VSKVSVIPRGLAALGYTLNTPEENKFLMQKHELIAEVDVLLGGRAAEEVFIGEISTGAS
FT                   NDLERATDIIKAMISMYGMSEIAGLMVLEKQRNTFLSGGQTIKDYSEKMAESLDDYVKK
FT                   TLDERYKDVKDTLNTYKGAIETMVAALYEEETIEGTKVREIIKEFEDQNSLPTHLQELE
FT                   EVKTEVKVEE"
FT   gene            549057..549674
FT                   /locus_tag="JJD26997_0606"
FT   CDS_pept        549057..549674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0606"
FT                   /product="phosphatidylserine decarboxylase-related protein"
FT                   /note="identified by match to protein family HMM PF02666"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43800"
FT                   /db_xref="GOA:A7H2P3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P3"
FT                   /protein_id="ABS43800.1"
FT                   /translation="MKDFIAKDGYLSLIILSLIFIFVWIFYSFSILLLALIVICIFLFR
FT                   TPKREPVCSDEKAIFAPIDGRVTKIENIHHKDLGECVEITIKNALYDAGNFNTPFAMSI
FT                   IDIRLRHGLFLCSELKSVKMMNERAFILAKVKENKTIALRIYAGSFDRKLKLDNISHDL
FT                   KAGDRMGFLINGSISLLLPKDTRIHIGLNDEIKAGSLLGYFA"
FT   gene            549684..550412
FT                   /gene="pssA"
FT                   /locus_tag="JJD26997_0608"
FT   CDS_pept        549684..550412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="JJD26997_0608"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00473"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43928"
FT                   /db_xref="GOA:A7H2P4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P4"
FT                   /protein_id="ABS43928.1"
FT                   /translation="MSNRPQLIYILPNLFTAASAFLGVISIIASIHGNYYTALIYIILS
FT                   LICDGLDGRVARLTNSTSKFGVEFDSLADLVAFGVAPAVLFYMAIGYDFGKLGSLITAF
FT                   FVVFGAIRLARFNVTTGTYEPSVFIGLPIPTAAVVSAIWTYAFISYDFLKPYGVVFLVL
FT                   QAILGLLMVSNIRYPSFKKLDFNRSSVLKVLIILIIIFSFLYLYPLESLVILASLYVLY
FT                   GIIRVLYTIIVSKFKIRNQE"
FT   gene            complement(550403..551200)
FT                   /locus_tag="JJD26997_0607"
FT   CDS_pept        complement(550403..551200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04305"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44741"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P5"
FT                   /protein_id="ABS44741.1"
FT                   /translation="MQKDFFQELQNILYEKNTTIKFHSFQNFYENFKSHKFIFNHEHQS
FT                   IFKKNTSQQITLLHPTRIRRPKFVNSTHALAKIIHSVAHIEFNAINLALDTSYRFKNLP
FT                   LQFYYDWLEVADEEIKHFKLLNSALEELGYKYGDFPVHDNLESALEATKDSLSFRMGVV
FT                   HRGLEAKGLDANPFVVQKLQSSNHSIKNLLMEYLEIILNDEIKHVKKGDTWWKFANQNK
FT                   YDFIELCKTFKQFSLAGKKLNIQARIKAGFTQEECEVIEKFYS"
FT   gene            551290..551649
FT                   /gene="msrB"
FT                   /locus_tag="JJD26997_0609"
FT   CDS_pept        551290..551649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="JJD26997_0609"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.-"
FT                   /note="identified by match to protein family HMM PF01641;
FT                   match to protein family HMM TIGR00357"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43224"
FT                   /db_xref="GOA:A7H2P6"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P6"
FT                   /protein_id="ABS43224.1"
FT                   /translation="MKELNEEEKKVILNKGTEAPFSGKYNDFYEKGIYQCKQCGASLYK
FT                   SEDKFKSGCGWPSFDDEIKGAIKRIPDKDGIRTEIICANCNGHLGHVFEGEGFSAKNVR
FT                   HCVNSISLEFVKTKD"
FT   gene            551652..551807
FT                   /pseudo
FT                   /locus_tag="JJD26997_0610"
FT                   /note="integral membrane protein, MarC family; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            551840..552256
FT                   /pseudo
FT                   /locus_tag="JJD26997_0611"
FT                   /note="integral membrane protein, MarC family; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            552345..553634
FT                   /locus_tag="JJD26997_0612"
FT   CDS_pept        552345..553634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0612"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF08447; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43345"
FT                   /db_xref="GOA:A7H2P7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P7"
FT                   /protein_id="ABS43345.1"
FT                   /translation="MFGARKNNTEIIEQLEKKCNGLGDILRSIGNTMAVIEFTTDGVIL
FT                   EANQNFLTTMKYSLSEVKGKHHSMFCLPEVVNSSAYSDFWKDLRDGKARSGLFRRIAKG
FT                   GIDVYLEANYLPISDNNGHVYKIIKFANDITQRHYEMLDLRNTIAAANRSMAIIEFKPD
FT                   GTIITANENFLRTMDFNIDEIKGKHHSMFCDSNYRHSKDYVQFWEDLREGKFQSGKYIR
FT                   YGRNNKKVYLEASYNPVKNDDGKIYKVIKFATDISEQVKKDQEKLRLISELAEKNDNLT
FT                   QDGDRVIENTVSNVQNIADMMSQSSNLVSSLNQQSDEIKSIIQTISDIADQTNLLALNA
FT                   AIEAARAGEHGRGFAVVADEVRNLAERTGHSVNEITTTINSIRNVTSQVVESIKSGLED
FT                   VNQSVELAKEARECMEKIRESSTEVAKAMS"
FT   gene            complement(553657..554304)
FT                   /gene="aat"
FT                   /locus_tag="JJD26997_0613"
FT   CDS_pept        complement(553657..554304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="JJD26997_0613"
FT                   /product="leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /EC_number="2.3.2.-"
FT                   /note="identified by match to protein family HMM PF03588;
FT                   match to protein family HMM TIGR00667"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44825"
FT                   /db_xref="GOA:A7H2P8"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2P8"
FT                   /protein_id="ABS44825.1"
FT                   /translation="MESSNLYSKLLNAPKNTPVFLSQNLEADFIVKAYTFGLFPWTSKP
FT                   VTWWCPDPRCVLNPNQIHIQKNMKKFINLYQIKLDYDFLKLITLCRDARSQSWIDDEFI
FT                   TTYYKLFTQGYAHSLELYENNELIGGIYGLILGKVFFGESMVNIKKNASKVAMIKLCDL
FT                   LKPYDFIIDCQVYNQHLEFMGAHNISRKEFLNILKEKCNQESGFKNFKDLIT"
FT   gene            complement(554279..556408)
FT                   /gene="clpA"
FT                   /locus_tag="JJD26997_0614"
FT   CDS_pept        complement(554279..556408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="JJD26997_0614"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpA"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR02639"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44061"
FT                   /db_xref="GOA:A7H2P9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2P9"
FT                   /protein_id="ABS44061.1"
FT                   /translation="MKYQENLQKYLDNAKNLSLINHHEFVTCEHVLFALLKLSTDFKDI
FT                   FEEFSDGDLELLETELKNHISQNNKVIKQEIEPTISVVLDEILLLSKNKNNEIKIIDFL
FT                   EKLIQDSRSYSSYLLKKHNINLNKIQELQNHENIQNLSNHTSDLTLLAQNGKIDPLIGR
FT                   KFELERMMQILSRRKKNNPILVGEAGVGKTAIVEGLALAIAEKKVPKNLQNAKIFSLDM
FT                   ASILAGTKYRGDFEKRIKEILNELEKIPNAILFIDEIHTIVGAGSTGESHTDFSNLLKP
FT                   ALSNGTLKCIGATTFMEYKNTFDKNKPLSRRFAKINVDEPSQEESLQILKGLKNKYEEF
FT                   HHIKLNDEILQYAVIWGKKFFNDKFLPDCAIDLVDELGASFALNPKAKKNANLKDLKNV
FT                   LAKMTHHHKMFEFDQNKALMNLKTNLKAKIFGQDEVIDSLVSSLKQSFAGFKNSNTPRG
FT                   VFLFTGSSGVGKTELCKALAEFLGLNLERFDMSEYAEKHAISKLIGSPAGYIGFEEGGL
FT                   LSNAIRKNPFSLVLFDEIEKAHPDLSNTFLQIFDNAELTDNSGLKVDFKNTIIIMTSNL
FT                   GLKESNELGFLSKNEEKSNRAIKDFFAPEFINRIDKILHFNDLNDAILVKIIEKELDEI
FT                   SKNLNNIKLSVDDKAKIYLAKKAYNKEFGVRLLKRIISEEIGEKISDEILFGKLKKGGI
FT                   AKIKLGKNGKLEFIF"
FT   gene            complement(556405..556695)
FT                   /locus_tag="JJD26997_0615"
FT   CDS_pept        complement(556405..556695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02617"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44601"
FT                   /db_xref="GOA:A7H2Q0"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2Q0"
FT                   /protein_id="ABS44601.1"
FT                   /translation="MLKTQTLEQTKLSEPKMYKVILLNDDVTTMDFVIEILMNIFHQNL
FT                   EKASQTMLEIHHNGSGICGIYTQEIALSKQKKVIDAAKLANFPLQAKVEEE"
FT   gene            complement(556695..557297)
FT                   /locus_tag="JJD26997_0616"
FT   CDS_pept        complement(556695..557297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0616"
FT                   /product="thioredoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43732"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Q1"
FT                   /protein_id="ABS43732.1"
FT                   /translation="MKKILALFLISLAFFLNACSKEKEIQNDFMFEEYHKGDKIVLNSV
FT                   NDGSKTLIRTDKGFVVEGEEGKVLMFDFFGTFCTPCKEEALDLSKLWKNNSSKFIIMGL
FT                   THFEDVSDETVKKFADDYGAYYFLSNGSSNDRIIAQILKDIDYQNMEQLPFKVVLKNGI
FT                   YQKISDYWNNNAPTNFYLGKIPTELMQEDLNKIYKGK"
FT   gene            complement(557309..557761)
FT                   /gene="smpB"
FT                   /locus_tag="JJD26997_0617"
FT   CDS_pept        complement(557309..557761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="JJD26997_0617"
FT                   /product="SsrA-binding protein"
FT                   /note="identified by match to protein family HMM PF01668;
FT                   match to protein family HMM TIGR00086"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44487"
FT                   /db_xref="GOA:A7H2Q2"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2Q2"
FT                   /protein_id="ABS44487.1"
FT                   /translation="MKIIARNKKALFDYSIIERFEAGIVLKGSEVVALRAGRANLKDSF
FT                   VRIIKSEIFLLNSHISLLHTTHSFYKHEERGARKLLMHRKQIDKLLGKVSIEGYTIVAL
FT                   DLYFNTKNKVKATLALAKGKNLHDKRETLKKKQADLEARAAMKNYK"
FT   gene            complement(557758..558525)
FT                   /gene="ispE"
FT                   /locus_tag="JJD26997_0618"
FT   CDS_pept        complement(557758..558525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="JJD26997_0618"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43498"
FT                   /db_xref="GOA:A7H2Q3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2Q3"
FT                   /protein_id="ABS43498.1"
FT                   /translation="MKAYAKANIFLKLTGFDSRKYHLLESRFILLKDVFDELELVDKES
FT                   DSKKEFEIISNFKCENNIIQKAYLLLSRRYNNELKELFSKKSLKLTKNIPVCAGLGGGS
FT                   SDCASFLLLMNETLNLKLNLQELINLSIQLGSDIAFFLSGFNSANVSGCGEIIEEFEDD
FT                   IPTLKWTFPQISCQTKAVYDEFDREIFDFQKNNNQAQIYKKLSTKELLQNFKNKELNDL
FT                   FTPCATLYPKMKSYLQEDFFLSGSGSSVFKVDR"
FT   gene            complement(558522..558749)
FT                   /gene="csrA"
FT                   /locus_tag="JJD26997_0619"
FT   CDS_pept        complement(558522..558749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="JJD26997_0619"
FT                   /product="carbon storage regulator"
FT                   /note="identified by match to protein family HMM PF02599;
FT                   match to protein family HMM TIGR00202"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44757"
FT                   /db_xref="GOA:A7H2Q4"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Q4"
FT                   /protein_id="ABS44757.1"
FT                   /translation="MLILSRKENESIIIGEGIEIKVVQTGKGYAKIGIEAPKSLMILRK
FT                   ELVQQVKDENLHSVVQNDIKLDDLSKKLIK"
FT   gene            complement(558743..559561)
FT                   /gene="truB"
FT                   /locus_tag="JJD26997_0620"
FT   CDS_pept        complement(558743..559561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="JJD26997_0620"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="identified by match to protein family HMM PF01509"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43738"
FT                   /db_xref="GOA:A7H2Q5"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2Q5"
FT                   /protein_id="ABS43738.1"
FT                   /translation="MNKIFAAFKPRGLSSNSFLSTLKKKYKNKKAGYSGTLDPFAKGVL
FT                   IVAFGQYAKLFRFLKKTPKTYKATLWLGVYSLSLDDQNIKKIQNIKEFDLAILKQIIDQ
FT                   MQGIISYTPPQFSAKRINGTRAYELAKKGIEANLKPCQMEVFDCKILSYNHPFLNIEIT
FT                   VSEGAYIRSYCELFARKLGINATLSSLERIKEGKFVYNNEKSLNVLKYINLKPNFIKDL
FT                   NKLENGAKIFVEELEFHDEGDYYIETEKYFSIINIKENTVKYLLNKVEKC"
FT   gene            complement(559558..561633)
FT                   /locus_tag="JJD26997_0621"
FT   CDS_pept        complement(559558..561633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0621"
FT                   /product="ATP-dependent DNA helicase, UvrD/REP family"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44421"
FT                   /db_xref="GOA:A7H2Q6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Q6"
FT                   /protein_id="ABS44421.1"
FT                   /translation="MNLFEDLNDSQKQAVSHIDGAMLILAGAGSGKTKTITTRLAYLIG
FT                   EVGIPSYNTLTLTFTNKAASVMRHRALNFLQGNHNPLLCTFHKFGLLFLKLHFERLERK
FT                   NSFIVIDTDDTKKIIKDLIHDKNKDNVYDIIKYISYCKNEGKRVSNVFKDLNLLKEHNF
FT                   EKYQNEYKFANYYRAYEEYLLKQNFVDFDDLLLLSNLILENDINFAKEQSLLYNYITVD
FT                   EYQDTNTLQYKILKNLCCMHENITVVGDDDQSIYSWRGAKIENILNFQNDFKNVKLVKL
FT                   EQNYRSVGTILQAANNLISHNEQRLGKTLICTKDTGENIKILKNENEKDEGLYIAQEVK
FT                   KLLNSEVEAKEIAVLFRVNALSRAIEEAFMKEKISYKLLSGMRFYERLEIKDLISYLRL
FT                   ILNPNDDLSFKRIINRPKRSIGEKALKNLEEYAKKRQISLFDALCESDGGVGILTTKKA
FT                   QNEANIFIQNIHTLKSYDNAKKVFDNIEELFKIKDYFSEQDDGDERIRNLDEFYANLRE
FT                   KLKEDPEASLEDLLSEISLLSDQDNLDEECVCLMSIHASKGLEFDYVFIIGFDEGFFPL
FT                   NSEENLEEERRLAYVAITRAKKFLTISVANSRFYHGSRANINPSRFLEESKLINEKSKN
FT                   QNIQKTSFCKGDLVKHKIFGIGRIVEVSKSGKEEKLNINFGGIMRVIMASFVEKAV"
FT   gene            complement(561630..562025)
FT                   /locus_tag="JJD26997_0622"
FT   CDS_pept        complement(561630..562025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44528"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Q7"
FT                   /protein_id="ABS44528.1"
FT                   /translation="MQKHCHEIISHLIEENIEFSIVANTNFIDFDPELPKELDVKQNPY
FT                   ALFALGGYTFESIQLNKDFIQFHAGFGNNDFDSFVKVDLGAITQIQIENSILFVNFSLY
FT                   KREDSKNLQKSKNIFLNNPKNKDIFKK"
FT   gene            complement(562061..563782)
FT                   /gene="pepF"
FT                   /locus_tag="JJD26997_0623"
FT   CDS_pept        complement(562061..563782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="JJD26997_0623"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR02290"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43715"
FT                   /db_xref="GOA:A7H2Q8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Q8"
FT                   /protein_id="ABS43715.1"
FT                   /translation="MLEWDLSALFHDKEALQNFTQDQIQQSLNFKKNYENKLYALNANE
FT                   FLQALKDYEHLNQALGKIMTYAYLLFAKNTQNGSFYAQYEEECKKIEENLLFFELEFCE
FT                   LAPEKSQEFTTFCKDYDFYLSNLLQNKRYNLSKNEERIILYLSNTGANAFSRLFDESMS
FT                   ALKIPFKGKKLSEEEILSKMYDEDRKIRKKAAKKFSKVLQKNSRLLSFIINMIKTERKN
FT                   ISLLRGYENAEISRHISNQISQKSVDSLIASAQKHFDLVSQFYKRKKQILGYDELKDYD
FT                   RYAPIGKEASFDFKTSKNIVLEAFQAFSPQFYDIAKNAFDQGWIDVYPQENKQGGAFSH
FT                   SATSDAHPFVLLNYTDKRRDLFTLAHELGHTIHQKLSYNVSYLNQNTPLTTAETASVFA
FT                   EMLVFDFTKDKLKKEELLSLYANKIEDIFATFYRQINFTCFERRLHAQENELNTEEINK
FT                   IWMEESQKMFQDSVKLTKNYASWWSYIPHFIHSPFYCYAYAYAQLLVLALYGLYKSKKC
FT                   ENFKELYIKMLSLGGSVSPKELVGMFGFDIEDENFWEIGIKEIQKLINEFMELQSC"
FT   gene            complement(563786..564673)
FT                   /gene="pyrB"
FT                   /locus_tag="JJD26997_0624"
FT   CDS_pept        complement(563786..564673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="JJD26997_0624"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00670"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44816"
FT                   /db_xref="GOA:A7H2Q9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2Q9"
FT                   /protein_id="ABS44816.1"
FT                   /translation="MRHLITTKDFNKIEIMELFKEASDFLDEKPRTFLEGKSITTIFFE
FT                   NSTRTLSSFESAARRLGARVLRLDVSRSSSSKGETLYDTAANLDAMSPNAIVVRHANSG
FT                   VPLILAKHMHCPVVNGGDGKHAHPTQALLDLFTIYNHFQSDVEGKKICIVGDIKNSRVA
FT                   ASNIELLSRFNLDITLVAPPHFMPNTHLKKYYKLDENIIANSDIIMSLRTQTERHNKTV
FT                   YASLKDYANDFCIQKSLVKDKKLILLHPGPVNRNIDISDEMMSDERTLVLKQVKNGVAI
FT                   RMAVLKKLILENEG"
FT   gene            complement(564683..565906)
FT                   /locus_tag="JJD26997_0625"
FT   CDS_pept        complement(564683..565906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0625"
FT                   /product="sodium/dicarboxylate symporter"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43254"
FT                   /db_xref="GOA:A7H2R0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2R0"
FT                   /protein_id="ABS43254.1"
FT                   /translation="MFSKIIQSYAKGNLIIQICAGIALGILIGINSKEISEIANLLGIL
FT                   FTSALKAIAPMLVFILILTSICTKDFSQSGVKIKNIIILYIVGTFLASACAILANFFFP
FT                   VKLVLDGIQATTNPSPAHMGEIFKDLLFKIVDNPINALSSGNYLGILTWAIAGGAALKH
FT                   CSNEAKQVFIDINEGVLKIVKFVVKLAPFGIFGLVANSVAQTGAQGLLSYTKLLILLVA
FT                   TMLFVTFVINALIVFFYTRKNPFPLIFICLRHSAFFAFFTRSSAANIPVNMALCAKLGI
FT                   DKEFYGISIPLGATINMAGAAVTIAILSLTAANTVGIEISLLQAFLLSIIATFAASGAS
FT                   GVAGGSLLLIPLACSLFNIDYDIAMKVVAIGFIIGVIQDSVETALNSSTDVLFTAICSK
FT                   NELNYNIK"
FT   gene            566046..567242
FT                   /gene="metK"
FT                   /locus_tag="JJD26997_0626"
FT   CDS_pept        566046..567242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="JJD26997_0626"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="identified by match to protein family HMM PF00438;
FT                   match to protein family HMM PF02772; match to protein
FT                   family HMM PF02773; match to protein family HMM TIGR01034"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44090"
FT                   /db_xref="GOA:A7H2R1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R1"
FT                   /protein_id="ABS44090.1"
FT                   /translation="MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVA
FT                   GNKVVIGGEVKSNHKLSKTDYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNE
FT                   QSPDINQGVDQEDGEIGAGDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPH
FT                   ELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMNIEDLRSLVMKLILDSNL
FT                   PKELFDPNETRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTK
FT                   VDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSD
FT                   FVMQNFSLTPNWIRDKFHLDKPSKEIFLYADVAARGQVGQKDYPWEKLDALEQFKALM"
FT   gene            567435..569291
FT                   /pseudo
FT                   /locus_tag="JJD26997_0628"
FT                   /note="putative sugar transferase; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(569271..570536)
FT                   /gene="lnt"
FT                   /locus_tag="JJD26997_0627"
FT   CDS_pept        complement(569271..570536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="JJD26997_0627"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM TIGR00546"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43570"
FT                   /db_xref="GOA:A7H2R2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R2"
FT                   /protein_id="ABS43570.1"
FT                   /translation="MNTNFIIFKIIKVFFIAILLSNSIYLSFFENIFTQTISPFLAIWG
FT                   LVLLLKSKNSKQYFWIGFFVGILWFWWIGLSSIYFNLNYLVPIIPIIVGFIYGLLFRLC
FT                   YLLKFDFLRLCGIFCISFIHPLGFDWLNWGIFTVYGFFDPSYRGIICIFLIAYFIYEGC
FT                   ISKYYKIAIVLILFFGGFQYNEKQAQTLDLNYKLINTNISQDQKFLQENLKSNSDILIQ
FT                   DILQAINEKKELVILPETAFAFDLKNTKYELMLKELSYKITIITGAFHVEKEHTYNSTY
FT                   IFKKGNVYILNKHFLVPFGEEIPFFKDLIKKYFLKNIEEFARGPVQSQYKLNNQIITNA
FT                   ICYEATKEQNYQNSQIIIALSNNAWFNNSSEYKLQQLLMKFYASKYGVSVYHSVNGKEN
FT                   AVILPKEKLSLKWSEYLNTLFH"
FT   gene            570560..570832
FT                   /gene="yajC"
FT                   /locus_tag="JJD26997_0629"
FT   CDS_pept        570560..570832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="JJD26997_0629"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699;
FT                   match to protein family HMM TIGR00739"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44671"
FT                   /db_xref="GOA:A7H2R3"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R3"
FT                   /protein_id="ABS44671.1"
FT                   /translation="MAENSILTSLLPLVVLFAIFYFLVIRPQQKQAKAHKQMLESLQKG
FT                   DKIITNGGLICEVVKPEEDFIKVKLNEDNATAKISREFIAKKIDA"
FT   gene            570825..572405
FT                   /gene="secD"
FT                   /locus_tag="JJD26997_0630"
FT   CDS_pept        570825..572405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="JJD26997_0630"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR01129"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43695"
FT                   /db_xref="GOA:A7H2R4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R4"
FT                   /protein_id="ABS43695.1"
FT                   /translation="MRNSKINYRLIIFIAVFIFGVTFSLPSFLQSECGAKINLGLDLQG
FT                   GLYMLLGVDNEEAVKSKIKSIASSLSYSFNKENILNDGLNTHDDILEFTLLDNADIAKV
FT                   ENLLKEIKGINIQSENMHYKISFTSEEVKNIENFALLQAVETIRNRLDQFGLAEPTVAK
FT                   QGDDKILVELAGIKTKEDELRAKERITKAAHLQLMEVDDSKMGQASTMSDAEVASYGLI
FT                   LVPDSRNSNLKYTLKSVPILDGSMLTDARVGISDKSNYPVINFTLNAEGSKKFADYTGA
FT                   NVGKRLAIVLDNKVYSAPSINERIGGGSGQISGAFTQEEARDVAVALRSGALLAPVKLL
FT                   EQRSIGPSLGADSIKMSMIALIGASVFIVIFMMMYYGVAGIFANIAMLVNVLVVVAVMA
FT                   MFGATLTLPGMAGLVLTVGMAVDANVIINERIRELLRDGVNIRASIEQGYKNAMSAIID
FT                   SNITSLVTSVALYAYGTGAVKGFAVTLGIGIVVSMITAILGTHGMFDYFMQRIEKSNNT
FT                   RFWFGYRRR"
FT   gene            572405..573376
FT                   /gene="secF"
FT                   /locus_tag="JJD26997_0631"
FT   CDS_pept        572405..573376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="JJD26997_0631"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR00966"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44004"
FT                   /db_xref="GOA:A7H2R5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R5"
FT                   /protein_id="ABS44004.1"
FT                   /translation="MQFFSEKKIYNFMRMRFAAISLSFILFFGSIYLLWDRGLQYGIDF
FT                   SGGTLVQLKYENAAPITQIREILEKQGTFQNLSVTEFGSNEEVTIRFLGSNDNVSNDIG
FT                   EHISTLLKDTGKFEVRRADVVGPKVGDELRNKGLMAIAVSLIAILIYIALRFEWRFALA
FT                   AIISEIHDVVITLGAISLFKIDVNLDTLAAVLTVLGYSLNDTIIIFDRIREGIKTSKKT
FT                   ELAPIINESVSATLSRTVLTSGLTLATVVILYFFGGEMIQGFSLALIVGIIAGTLSSIF
FT                   VASPILLWFKFSVLEFRNKEIEKAKRKQDQERNRAMYEKGTV"
FT   gene            573386..575815
FT                   /gene="leuS"
FT                   /locus_tag="JJD26997_0632"
FT   CDS_pept        573386..575815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="JJD26997_0632"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF09334; match to protein
FT                   family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43284"
FT                   /db_xref="GOA:A7H2R6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2R6"
FT                   /protein_id="ABS43284.1"
FT                   /translation="MAYEASLIEKKWQKIWDENEYFEPKDDLNLPKKYILSMFPYPSGR
FT                   IHMGHVRNYTIGDALARYYRKIGFNVLHPIGFDSFGMPAENAAIKHKIHPKSWTYENIA
FT                   YMKKELFSLGFSFSKKRMLATSDPLYTKFEQEIFIKMFEKGLIYTKEANVNWCEQDQTV
FT                   LANEQVEDGKCWRCGHEVVQKKMPGYYVKITAYAEKLLKDLEGLRDKWPNQVLTMQENW
FT                   IGKSEGLAFSLNLDEKSKQKAKESSLEVFTTRADTIYGVSYVALAPEHKIVQNLLLQNL
FT                   LNQDVLNKIKAIQNQSPRERQSSEKEGYFLGIYAIHPLSGEKIPLWVANFVLSDYGSGA
FT                   VMAVPAHDERDFEFAKKYNLAIKQVIQTQENLPYTQKLGKLIHSQEFDNLDCNEARLKI
FT                   ISQFEAKNIGKRVVNFKIRDWGVSRQRYWGAPIPMIKCQSCGIAPQKLENLPITLPEDV
FT                   QITGEGNPLDKHPTWKNCICPKCGKEAQKESDTLDTFFESSWYFARFASDEKTWQEKAL
FT                   DEKSVKYWMSVDQYIGGIEHAILHLLYARFFQKALRDLGYLTQNEPFDRLLTQGMVLKD
FT                   GAKMSKSKGNVVDPDEIIEKYGADTARLFMLFAAPPAKELEWNDDAVEGAYRFICKLYD
FT                   RAQNIKKGELVELKQENLNKEEKYARLKVYEALKKSEEVYHQSFAFNTLIAACMEALNA
FT                   LALCKNEALEQEAFYIILNILEPIIPHVCFELSEELFKCKNFKKLELKEEVFVKDTLNL
FT                   AVSINGKKRAEFKISSSASKEEILAFAKENTAKWLEGKSIVKEIYVEGKLVNLVIK"
FT   gene            575980..576324
FT                   /locus_tag="JJD26997_0633"
FT   CDS_pept        575980..576324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0633"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43752"
FT                   /db_xref="GOA:A7H2R7"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R7"
FT                   /protein_id="ABS43752.1"
FT                   /translation="MVISKLGRKLALKHEADDVINVKMNNLEFIPLAYDKNGYVISYKA
FT                   KLNLDFNVVFKDGSSQAFSTSGSYDFEISPNSIISDSARYEAIRAASSEAFDEFISVIA
FT                   IKGQKRDSKY"
FT   gene            576308..577690
FT                   /pseudo
FT                   /locus_tag="JJD26997_0634"
FT                   /note="hypothetical protein; this gene contains a premature
FT                   stop which may be the result of sequencing error;
FT                   identified by glimmer; putative"
FT   gene            577683..578855
FT                   /gene="folC"
FT                   /locus_tag="JJD26997_0635"
FT   CDS_pept        577683..578855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="JJD26997_0635"
FT                   /product="folC bifunctional protein"
FT                   /note="identified by match to protein family HMM PF08245;
FT                   match to protein family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43963"
FT                   /db_xref="GOA:A7H2R8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R8"
FT                   /protein_id="ABS43963.1"
FT                   /translation="MSNIMKVENFLAQKSINYDKIDRFLMFRMYEKYKKYFKNIPIIQL
FT                   IGTNGKGSTGRYLTQLLENLNYKIGHYTSPHIFSFNERFYLNGKIASDEELEQAHIRLE
FT                   EIFKQDLQKLSYFEYTTFLAMILFQKCDFIVLEAGVGGEYDATSVFERKMNIFTRIGFD
FT                   HVQILGNSLEDIARTKLKVMAPIALISDEQEQNVLKLVKKIAFLKKADLQVSSLNPFLK
FT                   ENFEIYCKKFVLPCFLKHNLKLALKACEILTSQEKTLKALKKLQELNLQGRCQEISPNF
FT                   FIDVGHNPMAAEAMLDKFQGEKINLIYNAYLDKDIFQILNTLKPVIDTIQIYKYKSAER
FT                   KLADDEIYSIASKLGIQCKEFVKLEENKKNLVFGSFMLVENFLKEWCGKK"
FT   gene            579033..579743
FT                   /pseudo
FT                   /locus_tag="JJD26997_0636"
FT                   /note="peptidase, M23/M37 family; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01551"
FT   gene            579680..580075
FT                   /locus_tag="JJD26997_0637"
FT   CDS_pept        579680..580075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0637"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04519"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43261"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2R9"
FT                   /protein_id="ABS43261.1"
FT                   /translation="MAIFNKGGISPASSSRSETTVISSGARIEGKFYFASMLHVDGELS
FT                   GIIHSESIVVIGKNGNLKGELQADKIVVNGYFEGQLEANSLEILAGGVVNGDISTQKIS
FT                   IENGGCFNGTSKIKEDTIKLIENNNEE"
FT   gene            580075..583011
FT                   /gene="mfd"
FT                   /locus_tag="JJD26997_0638"
FT   CDS_pept        580075..583011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="JJD26997_0638"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44080"
FT                   /db_xref="GOA:A7H2S0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S0"
FT                   /protein_id="ABS44080.1"
FT                   /translation="MQASFYEYLQNPKICELLLCKDEKQADLLAQVSRFKGLKTFVLPD
FT                   FRAQFGDDLRAFSKELFDLCKILNAYYKEEEKKILISPLNTVLKKLPSKKHLQNYYIDK
FT                   KQNFDLKFFEDEISRLGYEFVDIVQDKGEISIRADIIDIFCINEENPIRILLFGEEIES
FT                   IRYFDLQSQKSIPNELEHFEICPFLKYFDKENYEIFKDKLEDFQSDTLIHDINSLGFWC
FT                   IDDFFDYLEFDFLACEKFDINEYEKDISFVNAKILPQAKKFKELQSSYNKDFFEFHKNK
FT                   KITLLAKNEALFKTLELEDTQNIHFIKSDLRLNLISPEELIISLNQKEKQKTRKKASLI
FT                   IDELKNGDYIVHEDYGVGKFLGLEMIVISGAKKEFVAIEYQNSDKLLLPVENLYLIDKY
FT                   LGVSGSIPSLDKLGKTSFIKLKEKLKTKLLAIASEIVIMAAKRSLVQAKKITVDLNRQT
FT                   DFIASAGFIYTSDQDKACHEILQDFQNGKVMDRLLSGDVGFGKTEVAMNAIYPVVKSGF
FT                   CAFLFAPTTLLSHQHYKILKKRFDPFGIKVFKLDRFTSSAEKKQVLQNLKENKACVVVG
FT                   THALLSVECENLALVIIDEEHKFGVKQKEKLKEITQNSHILSMSATPIPRSLNQALSSI
FT                   KSYSVLQTPPEDRMDVRTFVKENDDVLLKEAIARELRRGGQIFYIHNHIASIEQCKKHL
FT                   LELFSTLRILILHSKIDAKVQEEEMLKFENKEYDLLLSTSIVESGIDLPNANTIIVEKS
FT                   DRFGMADLHQLRGRVGRSDKQGYCYFLIEDKNAITKDALKRLVSLESNSFLGAGSVLAY
FT                   HDLEIRGGGNLLGVDQSGHIEQIGYSLYLKMLEDELNALSKNEVDQKENKLDLKLNVNA
FT                   FLNSDLISEDRLRLELYRRLSKCEQVHEVYEIEGEIEDRFGKLDVYTKQFLSLIIIKIL
FT                   ALNKFKSISNYEQNIQFTALNDEKELIKAKSKDDDDILEAILTHLRKA"
FT   gene            583013..583774
FT                   /locus_tag="JJD26997_0639"
FT   CDS_pept        583013..583774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05673"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43471"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S1"
FT                   /protein_id="ABS43471.1"
FT                   /translation="MDWNKTYAAIYRARKDYLKPIFEIDPITLKDLVGMEKQKKALYEN
FT                   TLNFIQNKGANHALLWGSKGTGKSSLIKAIFNEFKDQGLRLVELNKEDLFTLADIIDEI
FT                   RLENFKFILFCDDFSFEKGDDSYKFLKPLLEGSIEKAPNNVIIYASSNRRHLLSESIAD
FT                   NLDTQIAHTELHLSDAAEERLSLSDRFGLWLSFYQGNLEEYLKMIDFYFKDYSCDKELL
FT                   HAKAKEFATLRASRSGRTAKQFYLAFKENFK"
FT   gene            583771..584457
FT                   /locus_tag="JJD26997_0640"
FT   CDS_pept        583771..584457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0640"
FT                   /product="putative endonuclease III"
FT                   /note="identified by match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44335"
FT                   /db_xref="GOA:A7H2S2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S2"
FT                   /protein_id="ABS44335.1"
FT                   /translation="MTGAQIFTKLLNLDLNYHDFDWLESQGLSEFELLISVILTQNTNW
FT                   KNVLKVLENLKKENIASLEQINTLSNLELATLIKPSGFYNTKAKRLKGLVESIINTYEN
FT                   LENFKTNVSREWLLNIKGLGFESVDGILNYLCKREILVVDNYSLRLAFYLGYEFENYEE
FT                   LREFFQSGIESEQENLCKILEKKCELYELYQIFHALIVAFAKQSFKGQKLSPKGEEWIK
FT                   ILKEDL"
FT   gene            584454..585266
FT                   /gene="thiD"
FT                   /locus_tag="JJD26997_0641"
FT   CDS_pept        584454..585266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="JJD26997_0641"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF08543; match to protein
FT                   family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44172"
FT                   /db_xref="GOA:A7H2S3"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S3"
FT                   /protein_id="ABS44172.1"
FT                   /translation="MKAKGSELIPVLTIAGSDCSGGAGIQADLKTFSAHNLFGMSVVLS
FT                   VVAENTARVISVHDIPTQSVDEQMLAVFEDIVPKATKIGMIGSCELMSCVAKNLSEFKP
FT                   QNVVIDPVMFAKNGYALMPQENCDFFKQTIVKFADILTPNIPEAEFLCGFKIANEEQMI
FT                   KAAKHLCSLGAKAVLLKGGHSEENANDVLYDGKEIYILKGERIETKNTHGTGCTLSSAI
FT                   ASNLAKGKDLFHAVSEAKEYVRNAIYYSLNLGKGCGPTNHFFKFLDEK"
FT   gene            585256..585888
FT                   /pseudo
FT                   /gene="thiE"
FT                   /locus_tag="JJD26997_0642"
FT                   /note="thiamine-phosphate pyrophosphorylase; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF02581; match to protein family HMM TIGR00693"
FT   gene            585866..586495
FT                   /gene="hemD"
FT                   /locus_tag="JJD26997_0644"
FT   CDS_pept        585866..586495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="JJD26997_0644"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43409"
FT                   /db_xref="GOA:A7H2S4"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S4"
FT                   /protein_id="ABS43409.1"
FT                   /translation="MKIYLLNEAPFEGVENLILNEIVFYDFSVDLSLYDALICTSKNAL
FT                   KALQHAKITLNFKLNLYAVGQSTAQYAKNLDFKKIKFPSKAYGKDLFLEFKEELKTQKC
FT                   LYLRAKNIVSTLNLDLKNAGVDLDEIIVYENVFKKGDKELIHPAIFIFISPLSVENFLK
FT                   FYSLKEEDKVVVIGQSTAKKLLNFKNLYICENQSLLECVKLAKTLV"
FT   gene            complement(586492..586944)
FT                   /locus_tag="JJD26997_0643"
FT   CDS_pept        complement(586492..586944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0643"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44371"
FT                   /db_xref="GOA:A7H2S5"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S5"
FT                   /protein_id="ABS44371.1"
FT                   /translation="MKKAYVLIWTIFLILLISLWMSLTLNISSYTPKIIQDSYYYLQAQ
FT                   ILSHNATQFSKYFLYQARQENKECLDNIYFNYTKALIKIKYFYPIAQCVNFKFSNFNPD
FT                   ANLNKDGVIIAHISIALNRDKNVNDEILLTKSIIIYPKENFWNLKN"
FT   gene            complement(586941..587603)
FT                   /locus_tag="JJD26997_0645"
FT   CDS_pept        complement(586941..587603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0645"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43721"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S6"
FT                   /protein_id="ABS43721.1"
FT                   /translation="MSKAFTLFELIISLILFTFITSLLSKPLMDFYHLNFTTLHTNNLI
FT                   TQAHLNLLKIEKLIQNCINITFSQNTLKCLLKDELISLKDNKLYLINSALILENNHTLY
FT                   SPHSDFKTQLQNRKDLYNDNEHISYAYKINKIEKISILENGISANFTGSFIPLQAQLVI
FT                   KLQNEELIYEIKPKFNEQLSQQGLISKNISSFNLQNNKLKICLKRQTKYCLKKRILL"
FT   gene            complement(587600..587860)
FT                   /gene="ctsT"
FT                   /locus_tag="JJD26997_0646"
FT   CDS_pept        complement(587600..587860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsT"
FT                   /locus_tag="JJD26997_0646"
FT                   /product="transformation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44440"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S7"
FT                   /protein_id="ABS44440.1"
FT                   /translation="MIISLIFIGIFYYYTQLYKNYENLNIFERLYKLQEELYEKPIFKT
FT                   IIFQTSALKPIVLQEQFVNDGIFQFQKLYFQDQNYSVYFKE"
FT   gene            complement(587899..588630)
FT                   /gene="proC"
FT                   /locus_tag="JJD26997_0647"
FT   CDS_pept        complement(587899..588630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="JJD26997_0647"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF03807;
FT                   match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43911"
FT                   /db_xref="GOA:A7H2S8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2S8"
FT                   /protein_id="ABS43911.1"
FT                   /translation="MLYILANGAMATALAYGLKDDYEICIVGRSIEKLQALTKEGFKTL
FT                   LYKDFNIEGKDVLLAFKPYALENIAQMLKGQARILISVLANVDFEKLQTIKAQNYVRIM
FT                   PNTAAKYKASTTPYILKNSHFENEILDILKTFGSAYKLDNEMQMDAAMAISGCAPAFLA
FT                   LIAESIANAGVHEGLSKELSLNLTRSLFKSSSALLEHEHPAIIKENICSPGGVTIKGIK
FT                   ILEQKGIRGSFFEAINASSTK"
FT   gene            complement(588630..589019)
FT                   /locus_tag="JJD26997_0648"
FT   CDS_pept        complement(588630..589019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02623"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44679"
FT                   /db_xref="GOA:A7H2S9"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2S9"
FT                   /protein_id="ABS44679.1"
FT                   /translation="MTLAVKCPILGFEETKNMEFSTIDEVFVRLKSLDGKDFSFVLINP
FT                   YLIRPDYEFDIPTYYQELLSLTPESNMKIFNIVAIAKSIEESTVNFLAPVVINLDNNTM
FT                   AQVILDTVNYPDFFQADQIANYIKK"
FT   gene            589180..589827
FT                   /locus_tag="JJD26997_0649"
FT   CDS_pept        589180..589827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0649"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43279"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T0"
FT                   /protein_id="ABS43279.1"
FT                   /translation="MKKGIFLLVFLSIFFNACSTKNDEGLYNLSASEWYKQIIKDLQDK
FT                   DLEKADDHYNGMASEHVADPLLETTLIILAQAHMDEEEYKLAEFYLDEYNKKFGNSRNT
FT                   DYIRYLKIKAKFDAFAVPNRNQALMLESQKEIDTFLKDYPYTEYEPLVQTMLTKFNLAV
FT                   FYLNSTIENLYQRIGHDESAQIYKQRLQESEFYQQSIIKPELPWYRSIFERF"
FT   gene            589844..592219
FT                   /gene="lon"
FT                   /locus_tag="JJD26997_0650"
FT   CDS_pept        589844..592219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="JJD26997_0650"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02190; match to protein
FT                   family HMM PF05362; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44069"
FT                   /db_xref="GOA:A7H2T1"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T1"
FT                   /protein_id="ABS44069.1"
FT                   /translation="MQIEEIQNYPANLPVLVEDELFLYPFMITPIFINDSSNMKALDLA
FT                   IKNDSMLFVAPAKLENGRNFDEIYNCGVIGTIMRKVPLPDGRVKILFQGYAKGKIIEQI
FT                   SNKPLEAKIELIKEDFLEGTKKEALLEVLKEKVKNLANISHYFSPDLLRTIEEGFDASR
FT                   ICDLILNTVRIKKQVAYEFFVLTDLEQKLVKLIDLIAQEIEANKIQKEIKNKVHSRIDK
FT                   VNKEYFLKEQLRQIQKELGSDTQKEDEVREYQKRLELKKKFMHEDAYKEIKKQIEKFER
FT                   IHQDNSEASMIQTYIETALDVPFEKISKKKLDIKEVSKQLNHDHYALNKPKERIEEYFA
FT                   VRELLEKRKIAEKDSAKVILCLYGPPGVGKTSLANSVSKALKRELIRIALGGLEDVNEL
FT                   RGHRRTYIGAMPGRITQGLIEAKQINPVIVLDEIDKLNRSFRGDPSAVLLEILDPEQNS
FT                   KFRDYYLNFNIDLSKVIFIATANDISNIPAPLRDRMEFIELSSYAPSEKFHIMKKYLIP
FT                   DELKKHGLKSNELSIDDETIELIISDYTRESGVRNLRRKVAELCRKSAKKLLLENINKV
FT                   IINTKNLNEFLDKKVFEIEKNNGENQVGQVNGLAWTSVGGDVLKVEAVKIKGKGELTLT
FT                   GSLGDVMKESARIAFSMIKVLIDEGKIKIPKKMIIDPKVNVYDSYNIHIHVPDGATPKD
FT                   GPSAGITISTAIASIFSDKKVKADIAMTGEIDLKGKVLPIGGLKEKLIAAYKADIKTAL
FT                   IPRKNYERDLKDIPSEVRDNMEIIAVDTFSDVLKYTLV"
FT   gene            complement(592281..592541)
FT                   /gene="rpsR"
FT                   /locus_tag="JJD26997_0651"
FT   CDS_pept        complement(592281..592541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="JJD26997_0651"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43895"
FT                   /db_xref="GOA:A7H2T2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2T2"
FT                   /protein_id="ABS43895.1"
FT                   /translation="MAEKRKYSRKYCKYTEAKVEFIDYKDTAMLKHALSERFKIMPRRL
FT                   TGTSKKYQEMVEVAIKRARHVALIPYIVDRKEVINNPFEGL"
FT   gene            complement(592552..593103)
FT                   /gene="ssb"
FT                   /locus_tag="JJD26997_0652"
FT   CDS_pept        complement(592552..593103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="JJD26997_0652"
FT                   /product="single-strand binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43458"
FT                   /db_xref="GOA:A7H2T3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T3"
FT                   /protein_id="ABS43458.1"
FT                   /translation="MFNKVVLVGNLTRDIEMRYAQSGSAIGASAIAVTRRFTTNGEKRE
FT                   ETCFIDISFYGRTAEVANQYLTKGSKVLIEGRLRFEQWSDQNGQNRSKHSIQVENMEML
FT                   GNSNTPQQGGNFGNNSFSNNNYSGNYENQSYDPYMSENKNFNKAKANPAPQRNQNLQHE
FT                   EKLKEIDIDAYDSDDTNLPF"
FT   gene            complement(593112..593489)
FT                   /gene="rpsF"
FT                   /locus_tag="JJD26997_0653"
FT   CDS_pept        complement(593112..593489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="JJD26997_0653"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43697"
FT                   /db_xref="GOA:A7H2T4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2T4"
FT                   /protein_id="ABS43697.1"
FT                   /translation="MKHYEVLFILKPTLTEEEVNAKLEFVKEVLTKNGAEIETVVPMGT
FT                   RKLAYKIKKYERGTYFVIYFKAPTNLIAELERVLRITEEVIRFLIVKYENKKEIAAWEK
FT                   LSHGIKQSKKEIKPLDAPEIQ"
FT   gene            complement(593576..594436)
FT                   /locus_tag="JJD26997_0654"
FT   CDS_pept        complement(593576..594436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0654"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04393"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44452"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T5"
FT                   /protein_id="ABS44452.1"
FT                   /translation="MNKKFSYPIPNFTDKRKSIIFWRYLRFQARKILYFPQVRLLEKTL
FT                   NEEKNKHLKDFFSQRPYACYNATRRFCDKSFKANERVKTLIYDVDKGLTCFKFLPKEQM
FT                   IFSFDEDFELFLGYNHNVYEEGFWAFSLKFKKYTISQCNFCFTLENNLLLSCIQGYKYK
FT                   DFNILEINKILTKKCHGLRPVALLIECSKMLCKILKLQATLGVHEKNQIRSQKGKGYFV
FT                   DYQKIWLENGGELIKIDKHKYYKLHHSQKSLEEIPSQKRSMYKKRFAMLEEIKVNLDKT
FT                   LDIQD"
FT   gene            complement(594429..595535)
FT                   /locus_tag="JJD26997_0655"
FT   CDS_pept        complement(594429..595535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0655"
FT                   /product="putative membrane-associated zinc
FT                   metalloprotease"
FT                   /note="identified by match to protein family HMM PF02163;
FT                   match to protein family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43906"
FT                   /db_xref="GOA:A7H2T6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T6"
FT                   /protein_id="ABS43906.1"
FT                   /translation="MISLLFLIVILILGVKFYSIEFLATILVLSFLIFFHELGHFLAAR
FT                   SLGVKVEVFSIGFGKSLIEREFKGTNYRLSALPLGGYVKLKGQDDMRPGFENLDKDSYS
FT                   ILSPLKKIYILFAGPFFNLILAFFLYIIIGNLGLNKLAPQIANIAPNSAAQEIGLQKND
FT                   TILEINGIKIQSFDEISKHLSLEPLKILIDREGKKLEFILTPKIGQGYNDFGQIVEKPQ
FT                   LGVSPNGISTLVKHQGLESFKYAIQESFQASTLIIKGIAKLISGEVEAKNLGGIITMTE
FT                   ITSKAAQNSFTLLLFITALISINLGILNLLPIPMLDGGHILFNLYEMIFRCKVSQRAFE
FT                   YLSYAGMAMLLSLMLFATYNDISRIIGE"
FT   gene            complement(595532..596068)
FT                   /gene="pgsA"
FT                   /locus_tag="JJD26997_0656"
FT   CDS_pept        complement(595532..596068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="JJD26997_0656"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00560"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44699"
FT                   /db_xref="GOA:A7H2T7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T7"
FT                   /protein_id="ABS44699.1"
FT                   /translation="MNLPNILAIFRMVLAPLLFFLLIHHFENIHQSWTNYFTALTFSLA
FT                   ALSDFFDGYIARTWKQTTKLGGILDPLADKMLVLAAFLGLLLTGKANEWVIYIILVREF
FT                   FVTGFRVVMISENLNVNASFAGKLKTAFQMTAIGFLIMEWIGGEILLYIALILTLYSGF
FT                   EYIYAYIKAQKKGEK"
FT   gene            complement(596110..596715)
FT                   /locus_tag="JJD26997_0657"
FT   CDS_pept        complement(596110..596715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0657"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43211"
FT                   /db_xref="GOA:A7H2T8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T8"
FT                   /protein_id="ABS43211.1"
FT                   /translation="MKKELEIFSTRYSCRNFKNEKLKKEDLNSILEIARLSPSSLGLEP
FT                   WKFIVVQDEKRKEELSKICNQQKHVKDCAALIIIISRLDFLDYFEEKLRKRDMSETEIQ
FT                   KRLDTYMPFLKSLNQEQKISYAREQAHIALASILYSANALNIASCTIGGFDKEKLDSYL
FT                   SLDIQKERSSLVVALGYCNDEKNPQKNRFNFDEVVKFI"
FT   gene            complement(596715..597334)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0658"
FT                   /note="nitroreducatase family protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00881"
FT   gene            complement(597388..597822)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0660"
FT                   /note="acetyltransferase, GNAT family; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(597834..598922)
FT                   /locus_tag="JJD26997_0661"
FT   CDS_pept        complement(597834..598922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0661"
FT                   /product="competence/damage-inducible domain protein"
FT                   /note="identified by match to protein family HMM PF02464;
FT                   match to protein family HMM TIGR00199"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44325"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2T9"
FT                   /protein_id="ABS44325.1"
FT                   /translation="MKHLLYLIGDELTINEKFKNYIYRTYEAKFKEINEIRIQNKTDKD
FT                   LPFLLENLLNQYDFITLFTSPLHYATVAKILATLNDDNLILKDDTLVPDKAEFSKNSFV
FT                   CNFSNSKINVVKINPSEKLPDLLGYIKLNFAYFCIFGMDDESAILLLQTLTKSYEISIK
FT                   STKLLDNLVLIKATCANFGKLDGFLNSVKNLFGQKVFLGKDPIHFISFKLLEKKLKISF
FT                   AESCTGGLCASTLTKISGVSEIFEGSIVSYSNRIKHEWLGISESVLKNNGEYSERCVYF
FT                   MLKGIFKTANPDFALAISGVVGEKDEGKIKSGTIYIGAMFRDGTFIQETLYLDGDREFM
FT                   QEQAVLATFCLLLKLKPEIFEI"
FT   gene            599018..601771
FT                   /gene="ileS"
FT                   /locus_tag="JJD26997_0662"
FT   CDS_pept        599018..601771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="JJD26997_0662"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF08264; match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44360"
FT                   /db_xref="GOA:A7H2U0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U0"
FT                   /protein_id="ABS44360.1"
FT                   /translation="MDYKETLLLPSTSFAMRANLAELEPQRFKKWLEQNYAYEKMKENR
FT                   KNAKKSFTLHDGPPYANGHIHIGHALNKILKETIIKTHYFKGESVRFTPGWDCHGLPIE
FT                   QQVEVKLGEKKKSLSKKEIREFCRQHASEFVDIQREEFKNLGIIADWDKPYLTMKFEFE
FT                   AAIYRTLCEIAKKGLLCERSKPVFWSWAAKSALAEAEVEYQDKEDYSIFVAFDLDAKAC
FT                   EKLGVSKVSAVIWTTTPWTLVANQAIALNPNENYVITKEGLIFASALLKSMVEKGLTSG
FT                   EIQKELNAKEFEKLEAINPLNGRKSVLIMGEHVLMDGGSGLVHTAPGHGEDDYYACLKY
FT                   GIEVLMPVDDGGCYDETLRTKGLLPSYLLEEFIGLHIFKANEKILELLGAKLLHSSKFI
FT                   HSYPFCWRTHKPVIYRATKQWFILMDEPKLQGKTLRECAKEQLLKTTFYPQSGVKRIDS
FT                   MVENRPDWCISRQRDWGTPIAFFRDKNTKEVIFDDELFNFVATIFEKHGADVWWEFEIK
FT                   DLIPTNSKYKAENLEKVYDILDVWFDSGSTFNVVLNSGLYDAGEKRASMYLEGSDQHRG
FT                   WFQSSLLVGTAINESAPYESILTHGFTTDEKGQKMSKSKGNVIAPEYVAKTYGVEILRL
FT                   WILLSDYSSDLKISDNILKQVGEQYRKIRNTIRFLLANTNDLKDLEVQEFSFIDKWILS
FT                   RATKVFKASKEAFFAYEFTKGFSLLLNFLSADLSGIYLDISKDRLYCDSENAQRRKSAQ
FT                   VAMALIAKELLNLLAPNLSYSVDEALEHANILIKGDAKDVFDLSLTQDFDYDFGIDDTF
FT                   LMSAREKFFEQIDMLKKDKIIKSTLELNLNISFDKFPNEELSDWFMVSQISNENEEILA
FT                   EFEVENEKFKITKASLCKCPRCWKFQSKNEETPCLRCEEVLKGIQC"
FT   gene            601872..603233
FT                   /gene="gatA"
FT                   /locus_tag="JJD26997_0663"
FT   CDS_pept        601872..603233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="JJD26997_0663"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43389"
FT                   /db_xref="GOA:A7H2U1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2U1"
FT                   /protein_id="ABS43389.1"
FT                   /translation="MITLKEALKYSKEELENLKKELNEKAKKEKKLGAYIEQFLDKDLS
FT                   VSGEGVPVAIKDNISVKGWELTSASKILQGYIAPYDASAIVNLKANGFAPFGRCNMDEF
FT                   AMGSSTASSCYGKTLNPLNFERVPGGSSGGSAAAVAGGLALASLGSDTGGSVRQPAAFC
FT                   GCVGFKPSYGRVSRYGLASYSSSLDQIGVLTQNVEDAAILYDAIAGYDKMDSTSANIEF
FT                   IKTAPNLNANEKLKIAVIENYVNDADTEVKNALLKTIDMLKANGHEIVYKNLLDSKFDI
FT                   AAYYIIATAEASANLSRYDGVRYGKRSENIQNLKEMYVNTRSEGFGEEVKRRILLGTFV
FT                   LSSGYYDAYYIKAQKARAFIKAKYEEILQDCDLIFMPVTPTMAFKFDTQKSPMQTYLED
FT                   VYTISVNLAGLGGISVPVAKDKEGLNISAQLICKAYDEQTLLDGALSLEQMIKN"
FT   gene            603243..604700
FT                   /gene="guaB"
FT                   /locus_tag="JJD26997_0664"
FT   CDS_pept        603243..604700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="JJD26997_0664"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44633"
FT                   /db_xref="GOA:A7H2U2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U2"
FT                   /protein_id="ABS44633.1"
FT                   /translation="MKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLIS
FT                   AAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSESGVIIDPIFVSPKAS
FT                   VAEALEIMAEYRISGVPVVDEDKKLIGILTNRDLRFESDFSNLVENVMTKMPLITAPKG
FT                   CTLDDAEKIFSTNKVEKLPIVDEQGRLEGLITIKDLKKRKEYPDANKDNFGRLRVGAAI
FT                   GVGQMDRVDALVEAGVDVIVLDSAHGHSKGIIDTVKAIKTKYPNLDLIAGNIATAAAAK
FT                   ALCEAGVDAVKVGIGPGSICTTRIVSGMGVPQISAIDECVEEANKFGVPVIADGGIKYS
FT                   GDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKGSSDRYF
FT                   QQGTAQDKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEI
FT                   TTAGLKESHVHDVTITHEAPNYKVNHQ"
FT   gene            604697..604870
FT                   /locus_tag="JJD26997_0665"
FT   CDS_pept        604697..604870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0665"
FT                   /product="putative exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43635"
FT                   /db_xref="GOA:A7H2U3"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U3"
FT                   /protein_id="ABS43635.1"
FT                   /translation="MSFEENLKHANESLEKLNNQELALDESVKIYKEGLESIKKARLEL
FT                   EKAKLEVEQIDE"
FT   gene            604863..605639
FT                   /locus_tag="JJD26997_0666"
FT   CDS_pept        604863..605639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0666"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44837"
FT                   /db_xref="GOA:A7H2U4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U4"
FT                   /protein_id="ABS44837.1"
FT                   /translation="MSKIAALQFPTLALSESRLDYYLKASKDNGANLVVLGEYVINSFF
FT                   TELLHMPKNMIKEQSEAKKESLIKLAKKYELEIIAPYVNVEAKSCKKLCLKVTPNGVKS
FT                   YEQKILMPYEHWNEEKFFSNKAQSELKIFTFNYEKLKCALLFGFETHFDIFWQQIMTKK
FT                   IDLVIVPSACTFESKQRWEELLKTRAFLNSTSILRVNRIGKTKDEWNFYGDTLFINAFG
FT                   EIESKLGSEEEMLIIEPKKSDEARKLWGFDKILKNF"
FT   gene            605651..606497
FT                   /pseudo
FT                   /locus_tag="JJD26997_0667"
FT                   /note="putative integral membrane protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts"
FT   gene            606502..607505
FT                   /pseudo
FT                   /locus_tag="JJD26997_0669"
FT                   /note="putative integral membrane protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            607881..608720
FT                   /locus_tag="JJD26997_0671"
FT   CDS_pept        607881..608720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0671"
FT                   /product="carbon-nitrogen hydrolase"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43588"
FT                   /db_xref="GOA:A7H2U5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U5"
FT                   /protein_id="ABS43588.1"
FT                   /translation="MRRKLKAALIQFAPLSYEREQNLNKSLIFTQTALEQGAKLVVLPE
FT                   LFDSGYCVEDKDFSYALSLEKELPSSLKELAKKYEAYIIACSIEKEDDTLYDTAFIVGK
FT                   EGLVGKYRKIYLFRDEKKRFARGQDYPVFELVFKDFSLKLGLQICYEIGFGEGARFLAL
FT                   QGAELICYPSAFGKARAYVWDLASRARALESGAFVLAANRCGSEISKLSGENLEFAGRS
FT                   KIINPKGEILSELSEKEGISYAVLDITQVKAQREYLTYLKDLDLDLSQKMYAKFNLS"
FT   gene            608737..609618
FT                   /locus_tag="JJD26997_0672"
FT   CDS_pept        608737..609618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0672"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44427"
FT                   /db_xref="GOA:A7H2U6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U6"
FT                   /protein_id="ABS44427.1"
FT                   /translation="MAKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIPR
FT                   LLKLFKKYNIPATWFSPGHSIETFPREMEMIVEAGHEIGVHGYSHENPIAMSAKQEEDV
FT                   LLKCIELIEKISGKRPTGYVAPWWEFSNITNELLLKHGIKYDHSLMHNDFSPYYVRVGD
FT                   KWTKIDYSKEAKDWMKPLVRGEETDLVEIPANWYLDDLPPMMFIKKSPNSFGFVSPRDI
FT                   EQMWIDQFDWVYRENDYAVFTMTIHPDVSGRPQVLLMHERIIEHINKHSGVKWVDFNTV
FT                   ADDFLKRYPRKK"
FT   gene            609746..610075
FT                   /locus_tag="JJD26997_0673"
FT   CDS_pept        609746..610075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0673"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44315"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U7"
FT                   /protein_id="ABS44315.1"
FT                   /translation="MCVLCGEMVSSFHWSDISFKEQNELISVGEQQKERLQARLKKVKI
FT                   LNQILSFYRLNLKEWQGSKYILSNLRGGSIIVNDLGDLWAKVYELEKISPDTLDIKLLH
FT                   FLHHG"
FT   gene            610068..611135
FT                   /locus_tag="JJD26997_0674"
FT   CDS_pept        610068..611135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0674"
FT                   /product="conserved ATP/GTP binding protein"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM PF07683"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43326"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U8"
FT                   /protein_id="ABS43326.1"
FT                   /translation="MAKIAIHIITGFLGSGKTTFLQEFLEQKGGKNIALIVNELGEVAL
FT                   DNELIQTQFVKETLVLNAGCMCCNKREDLSQKCKEVLDGYEKSGKKLERILIETTGLAN
FT                   PAPIVFTLLSDAFLANHFYLANIITCVDALDGLKHLEQNAEARSQIISADYVVITKTDL
FT                   HKDTQKLREKIFCIHQGVGIVAKEDFNFNKLFSLKRMEEFSGQKFPQNSTPTNLHQAHQ
FT                   NSVNSLCLCFDKPLDWSVFGIWLSMLLYAYGDKILRVKGLLDVDEDYLVNINGVGHIIY
FT                   PPTHTKISSRRDLDIRQDLRIKQSPALSDGKDESGLTDQNKTYLARQSRLVFIAKNLDL
FT                   KNVEYSLRAFLKLKI"
FT   gene            612015..612137
FT                   /locus_tag="JJD26997_0675"
FT   CDS_pept        612015..612137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0675"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44096"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2U9"
FT                   /protein_id="ABS44096.1"
FT                   /translation="MGFLCFKLRKNHFYSFEKSVIWEFFQNYLEIITCFLKYCL"
FT   gene            complement(612402..613862)
FT                   /locus_tag="JJD26997_0676"
FT   CDS_pept        complement(612402..613862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0676"
FT                   /product="nucleoside transporter, NCS1 family"
FT                   /note="identified by match to protein family HMM PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43731"
FT                   /db_xref="GOA:A7H2V0"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V0"
FT                   /protein_id="ABS43731.1"
FT                   /translation="MNEKNHLLEEAILPVWNNQRTIGFLTFIWMWISMAVIIATFSLGE
FT                   TGIKSLALWEVIGLIFLANVAIAIVMVLVADIGTEHGLSFSVYLRAPFGIKGTHLPSIA
FT                   RGIGASIWFGIQTYLGALALNGISEYLFSFNNWFIWYIIFAAVQIISTGMGIRTIELIT
FT                   SIAAPCIIAVTVWMYFTLDVMAQTKGINIWSFAGTDNINLLVFFFANMSFWSALAIDIP
FT                   NLTRFLKTPSGEKNFFKRNKNVFIAQLIALPMTQAWIGAIGAISFIATGIWNPIEVIQN
FT                   NGTGFTMVVLLVMVILSQWSTNAPANLIPAALAFINAGAPKLHYFTAVVISGIAGTIIM
FT                   PWLILDNLFIFLGYYGAVLSGIGGIIVADYYVLRKRRLNVPHLYSYEGQFVFAKGFNWA
FT                   GLIAWAVGGVVAIALPSISYLVGFAVGFVVYLFVMKTWILPKYPQVELENLSDDFLGTS
FT                   ADMNWVYENENFKRVASKDLVVVAREDR"
FT   gene            complement(614221..614883)
FT                   /locus_tag="JJD26997_0677"
FT   CDS_pept        complement(614221..614883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0677"
FT                   /product="putative cyclase superfamily"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44743"
FT                   /db_xref="GOA:A7H2V1"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V1"
FT                   /protein_id="ABS44743.1"
FT                   /translation="MSEIIKALELLRSGKWVDLTHEVHNKIPKYGAFPDLVTKTPYTLE
FT                   KDGFFVHEVSFITQYGTHIDAPVHFSKGKRSLEELELKEFILPLYVINKEKEVEENNDF
FT                   VLSAKDILEFEEEHGKIEPKSFVAFASGWSIEALDLLLNQRGVLGVGHETMDTDASKDV
FT                   QQKGFLYAEKFVLDANKFQVELLKNLTQLPAKGGVIFIGVPKFKGFPGFPVRCFAIV"
FT   gene            complement(615047..615535)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0678"
FT                   /note="hypothetical protein; this region contains one or
FT                   more premature stops and/or frameshifts;identified by
FT                   glimmer; putative"
FT   gene            complement(615970..616347)
FT                   /locus_tag="JJD26997_0679"
FT   CDS_pept        complement(615970..616347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0679"
FT                   /product="putative chemotaxis signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43227"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V2"
FT                   /protein_id="ABS43227.1"
FT                   /translation="MKILYFAYAKLLKNKDGTNFDPRDRLRFKQTIQTKTTNMIKPYVD
FT                   LVSNTLVISFSQPVFNRDNEIVGILSGDLPLEIFTKNIPEFKFSPSARVLIFEDLFYVT
FT                   PDRFMLDKKGKPFINALKEGM"
FT   gene            617024..618319
FT                   /gene="murC"
FT                   /locus_tag="JJD26997_0680"
FT   CDS_pept        617024..618319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="JJD26997_0680"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43199"
FT                   /db_xref="GOA:A7H2V3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2V3"
FT                   /protein_id="ABS43199.1"
FT                   /translation="MQNIHFIGIGGIGISALARFLKEKGFKISGSDLKESKITKELEKE
FT                   GVKVSIPHHKDNILNKDLVIYSAAIKEENPEFKYAKELGIKCLSRKEALPLILEDKRVF
FT                   AVAGAHGKSTTSSILASLLDDASVIIGAILKEFGSNMIYKESQNLIFEADESDSSFLNS
FT                   NPYLAIVTNAEAEHLDHYGNEVSKLHHAYAEFLDTAKIRVINAEDEFLKNYKNESIKLY
FT                   PSKDIKNCTMCIENFKPFTSFELKDLGEFKIFGMGYHLALDASLAILAALNFLDIETIG
FT                   ARLKNYQGIKKRFDILHADENLVLIDDYGHHPTEIKATLSAAQEYAKLGGYKKITAIFE
FT                   PHRYTRLAVNLKEFAKAFEGVDELVILPVYAAGEEPIEIDLKAVFPKALFVENIQREGK
FT                   FLVASKGQVFEEGLIIGFGAGDISNKLRQKNE"
FT   gene            618312..618662
FT                   /locus_tag="JJD26997_0681"
FT   CDS_pept        618312..618662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43388"
FT                   /db_xref="GOA:A7H2V4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V4"
FT                   /protein_id="ABS43388.1"
FT                   /translation="MSRFFLYFLIILILALIAFALREKLGKKTKPFFGILLVIFIALAV
FT                   FFEFENTQKSHLRTDIIVAFNQNKNILCKDINVSKAYFNYEFGTGSFISKDNNQSFNSL
FT                   IIDIKDCRLNDE"
FT   gene            618655..620862
FT                   /gene="mutS"
FT                   /locus_tag="JJD26997_0683"
FT   CDS_pept        618655..620862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="JJD26997_0683"
FT                   /product="DNA mismatch repair protein"
FT                   /note="identified by match to protein family HMM PF01713"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44351"
FT                   /db_xref="GOA:A7H2V5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V5"
FT                   /protein_id="ABS44351.1"
FT                   /translation="MNDTKEELISKLDLNSYLEEFKALFARGKEIFLQGDCNLHFKRIH
FT                   ELCEVEFPTMPELSNLDKALVHLSKQGILHLDEIFEFVKILRYFEKLKKIKLGTNLDSW
FT                   LQKIEFVSGALELCLNFDEKGELKESLDEKLVNLNTALRLKNESIIAEFKKFCYTKALM
FT                   PYLIDTQIHLINNLEALLVRGGFNHAIKAKIIGRSSGGGFYIVPLSVENLQNDIEKIKN
FT                   QKEEIYYEYAKNFSAFLAKNLPFLKFINTAFDLFDHYSARVLLAKKRDFEFVLCDQSAD
FT                   LVLKNFAHPALKNPKSVSLEFKKQVLIITGVNAGGKSMLLKSMLSAAFLAKHLLPMHIK
FT                   ASESKIGTFKEFDAIIEDPQNVKNDISTFAGRMLHFSRLFSKKNLLLGIDEIELGTDFE
FT                   EAACLYSVLISKLIANNLKIIITTHHKRLAMLLAKNEQVELIAALYNEELSRPKYEFLK
FT                   GTIGKSYAFETALRYQIPPNLVSEAKKLYGEDKENLEELIGKNINLELELKAKLENVEK
FT                   KEQKVDEILLSLKEQKEKNEQEFRMNLRNLEFKFHKAIEEAKKTIQLKDIKDKQRSLNK
FT                   ANELKKEIILPSMEQNEELRVGDFVKYEKIKGKIISISKNDAMVESDGIKLRVPLKLLK
FT                   KSGAMPKKVAKTSISVSKPSNLSVTLDLHGLRSDEAISRLDKFISDALLAGFDEVLIYH
FT                   GIGTGKLAFAVREFLKTHKSVKGFNDAPINQGGFGAKVVRL"
FT   gene            complement(620857..621843)
FT                   /locus_tag="JJD26997_0682"
FT   CDS_pept        complement(620857..621843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43767"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V6"
FT                   /protein_id="ABS43767.1"
FT                   /translation="MVEIRFAKLEEVSKIMEFIKNHWNKNHVFAYSKEALDFQYLDKYN
FT                   QRYNIVLGLENNIIQSILGFTLLSQYDNKLKTNKDLWFGIWKSIKPAFGLALIKFLLET
FT                   LKPKSIGNAGLSEHGIKYYKLFLYDKIEPLKHFYIKNDKKNIFHIADFKNSPSIHSLKS
FT                   INLTYKILNLEEFIKSNIKFNFIPYKSKQYFINKYHNHPFYEYQFLGIFEKSTLKCIFI
FT                   TREIVINNTKCIRIIDFLGNFTNNAYALFQDFLSQYDYEYIDLLCYINDFSKITNMGFI
FT                   EKNKEIITNYFEPFIKENQEIYFAYKCNHKNYAFFKGDSDQDRINKL"
FT   gene            complement(621836..622766)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0684"
FT                   /note="polysaccharide deacetylase family protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01522"
FT   gene            622868..623401
FT                   /locus_tag="JJD26997_0686"
FT   CDS_pept        622868..623401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0686"
FT                   /product="NAD-dependent deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF02146"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43322"
FT                   /db_xref="GOA:A7H2V7"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V7"
FT                   /protein_id="ABS43322.1"
FT                   /translation="MKQAMLLSGAGLSAPSGFKTFKDNDGLLEEYDVMEVCSATGFRKN
FT                   PKKVLDFYDTRRAQLQNVKPNHAHEKITDKQCLKCKSKDLRHNIVMFEEQAPAYATLYS
FT                   LLNQTSLFISIGTSGAVLPVGRYASMCEKSILNIYEKDANLEWYFDKIYIEDIISAIDK
FT                   IVLDIENFMKDGNV"
FT   gene            623394..623993
FT                   /locus_tag="JJD26997_0687"
FT   CDS_pept        623394..623993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0687"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44284"
FT                   /db_xref="GOA:A7H2V8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2V8"
FT                   /protein_id="ABS44284.1"
FT                   /translation="MFDSFLSGVFLGFGVSVPFGPVNILILTYALKAFKNSIAVGLGAF
FT                   CIDMLYLFLLQFGLLNFLDNVIFMRSLAIFGFCFLTYMAYLMLRKKKESLNLEHKEFKE
FT                   SLLKSYIKGAFLNGSNPFVIGFWLSAASVVLSSDHAYLMTLGLVMAILFWVSALAFVVA
FT                   RYSHVFSAKVVFIINIISAIIIEYFALNLLYKTFLG"
FT   gene            623997..625094
FT                   /gene="dapE"
FT                   /locus_tag="JJD26997_0688"
FT   CDS_pept        623997..625094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="JJD26997_0688"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01246"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44439"
FT                   /db_xref="GOA:A7H2V9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2V9"
FT                   /protein_id="ABS44439.1"
FT                   /translation="MNAKEFLIELLKFKSVTPNDDGALNFIAMELSDFEAFFIEKEGIK
FT                   NLLLTKKFKDEGEHLAFGGHVDVVPAGEGWSSDAFVPMEKESFIYARGAQDMKSGVAAF
FT                   VDALKNADFKGARLSLILTSDEEGEAIYGTKAVLEWMQKRDMLPDYAVVAEPTCVKKIG
FT                   DSIKIGRRGSINGKLLIRGKQGHVAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPS
FT                   KIVVTDIRGGIEVCNVTPNDLKLMFNVRNSPDTSLEDVKSYVEKICHGLNYELELKQSS
FT                   EAFLTNIDNKIVQKMNESVQKITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIH
FT                   AIDERVSIEEFEKLCLVFKDLIENF"
FT   gene            625104..627167
FT                   /locus_tag="JJD26997_0689"
FT   CDS_pept        625104..627167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0689"
FT                   /product="dna methylase-type I restriction-modification
FT                   system"
FT                   /note="identified by match to protein family HMM PF02384"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43766"
FT                   /db_xref="GOA:A7H2W0"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W0"
FT                   /protein_id="ABS43766.1"
FT                   /translation="MIEEILKDSDYKLDLFSKKAIAELETKIIVKTNKNNQIIYYANCL
FT                   VRDKEIKLTPEEIVRQLYIDKLLNEYNYPKDMIKIEFGVHFGREVKRADIVIMDKIQIT
FT                   TPYIIIEVKKPKLKDGKEQLKSYCNATGATMAVWCNGKEISYYHRKDPNYFESIPNIPA
FT                   SNQTLPDLLKVKFTFDDLIKEDILKNQKRSLKNLVTEMEDEVLANAGVDVFEECFKLIF
FT                   IKLFDELEGARDRTKSLEFRNYGESDSELKQKIEKLFDKAKKKWEGVFNNDEKIKLSPS
FT                   HLSVCVSSLQNVKLFNSNLEVIDDAFEYLVNKSSKGEKGQYFTPRYVIDMCVKMLNPKK
FT                   DESMIDTASGSCGFPIHTCFYVWRSIYKERSIEASHLFTAQEKIPECQDYVKEKVFGID
FT                   FDEKSVRVSKMLNLIAGDGHTNVLYLNSIDFDRWDEWVKDDEDWQDVYFEGFKRLKNLR
FT                   ATKNQNRDFNFDILMANPPFAGDIKESRILARYELGKKENGKPQSKVGRDILFIERNLD
FT                   MLRPGGRMAIVLPQGRFNNSSDKYIREFIAQKARILAVVGLHGNVFKPHTGTKTSVLFL
FT                   QKWDDKLCPKCEDYNIFFATMSEPSKDNSGEKIYYPLLDSHDHLVVKHDLFHPHLEGDE
FT                   PIKQKNENQEDFDKRMQEYRLNMEKYKDLQKDGIAEAFIEFAKSENLSFWKE"
FT   gene            627172..627897
FT                   /locus_tag="JJD26997_0690"
FT   CDS_pept        627172..627897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0690"
FT                   /product="RlfA"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43765"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W1"
FT                   /protein_id="ABS43765.1"
FT                   /translation="MDNMKEFKIFCDESNHLSYKDNPTLCSKVMVLGALKVPSSEIIKI
FT                   NKTIKYLKHKYKYNKEIKWTKLNLSQKGFYDELLEFFFSSVYMWFKAILIPNKTILQHD
FT                   IYNQGDHDLFYYKMYYQALHNLIDIDTKIKIYLDYKDTKSGDKIKGLEKVLFNKFKQSV
FT                   NIKIFTIQSHESNIIQLVDLLIGAISYKARDDIKHTSKIKNHIVDKIETLANIELDAGT
FT                   PPWENKFNIFRIQLSKGEQ"
FT   gene            627897..628448
FT                   /locus_tag="JJD26997_0691"
FT   CDS_pept        627897..628448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44709"
FT                   /db_xref="GOA:A7H2W2"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W2"
FT                   /protein_id="ABS44709.1"
FT                   /translation="MYHLLDFSTCKCENEKFDLAYKIFKQDFIEAPLYLAGCIYIDPQS
FT                   HKKHKGKEKIFWHITTRENKQNKTREFDSQRACRINWIKQIIINHTHSEIKAFYYKEKR
FT                   TIRFYLWLHNYDFIVILQKLGRSSSFLVTSFYIDKGYNKNIYEKRYRNYIIDTLFIIYL
FT                   IFCPILTFNPYAFTIFKLSN"
FT   gene            complement(628515..628805)
FT                   /locus_tag="JJD26997_0692"
FT   CDS_pept        complement(628515..628805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0692"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43393"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W3"
FT                   /protein_id="ABS43393.1"
FT                   /translation="MGLRAYAVTHYEKEYGDCLGFNYDFDGFIEFVEKLNIEFYIDEDK
FT                   TLIELNTKELLALNSNNLDLEQEELKLLLILQRNAKGANYAKESYFRVEWL"
FT   gene            complement(628927..629526)
FT                   /locus_tag="JJD26997_0693"
FT   CDS_pept        complement(628927..629526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0693"
FT                   /product="thermonuclease family protein"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44423"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W4"
FT                   /protein_id="ABS44423.1"
FT                   /translation="MNRHYFNLLKRILKAKKLSLSLVIAIIVLAVFSFNQVSSFNQSFT
FT                   TFLAQKNLEKELTGKVSKVIGGDTIELLAKISKTNPYNHIAKLKIRLYGIDAPELKQAY
FT                   GKEAKEYLSALVLKQEVGLIIENKDKYDRIVGTLFLKGQDINKEMVKNGYAHAYESFSK
FT                   KYLAEQADAKMFKLGLWQDERVMSPSEFRKQQRKNS"
FT   gene            complement(629553..629792)
FT                   /locus_tag="JJD26997_0694"
FT   CDS_pept        complement(629553..629792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43218"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W5"
FT                   /protein_id="ABS43218.1"
FT                   /translation="MTNPKENLIKTTCKEQKLTYKELSKLIGYSEDTINKNASTNQISK
FT                   PVQRVIELYLENLALKESLKEHHTLKNSLKELIS"
FT   gene            complement(630023..630166)
FT                   /locus_tag="JJD26997_0695"
FT   CDS_pept        complement(630023..630166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0695"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44173"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W6"
FT                   /protein_id="ABS44173.1"
FT                   /translation="MNKQEKAKERKAKRYALLKEAKELKRKQKIKIGLKIRKMKEKPLK
FT                   NL"
FT   gene            complement(630163..630759)
FT                   /locus_tag="JJD26997_0696"
FT   CDS_pept        complement(630163..630759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0696"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43830"
FT                   /db_xref="InterPro:IPR019096"
FT                   /db_xref="InterPro:IPR023385"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W7"
FT                   /protein_id="ABS43830.1"
FT                   /translation="MKLKDFDFRIWLNGSYIYLNEIGFEKINQNYFLRCCGDNEKIYEK
FT                   YKFYINADIPKETYEKRTQLEDSELELYTGFKDKNGVKIFENDIVLFMPNDSEKFLYTI
FT                   NYDKERGFFFSDDCNLDDEYCEGYTEVIGNIHENKELVDFMEKEKEAFKEFHQKFKNKY
FT                   DENGTPVKEFYEEDTRLSIYFKQELEKLLNDGLYK"
FT   gene            complement(630886..631200)
FT                   /locus_tag="JJD26997_0697"
FT   CDS_pept        complement(630886..631200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0697"
FT                   /product="transketoloase, C half"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44746"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W8"
FT                   /protein_id="ABS44746.1"
FT                   /translation="MIVGDAGLGLFDTFQVDFKEQYLNAGINEACSVGMAAGLALSGKK
FT                   VIYYNIAPFSLMRPYEQVRNDICYQELPVIVVGIGSGLTYAPAGVTHYAVEDIAIALTI
FT                   "
FT   gene            complement(631303..631440)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0698"
FT                   /note="transketolase N- section; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            complement(631462..631722)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0699"
FT                   /note="transketolase N- section; this region contains one
FT                   or more premature stops and/or frameshifts"
FT   gene            complement(631824..631979)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0700"
FT                   /note="transketolase; this gene contains a frame shift
FT                   which may be the result of sequencing error"
FT   gene            complement(632048..632685)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0701"
FT                   /note="GDP-L-fucose synthase 1; this gene contains a frame
FT                   shift which may be the result of sequencing error"
FT   gene            complement(632833..633291)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0703"
FT                   /note="GDP-L-fucose synthase 1; this gene contains a
FT                   premature stop which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01370"
FT   gene            complement(633293..633835)
FT                   /locus_tag="JJD26997_0704"
FT   CDS_pept        complement(633293..633835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0704"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="identified by match to protein family HMM PF00908"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44056"
FT                   /db_xref="GOA:A7H2W9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2W9"
FT                   /protein_id="ABS44056.1"
FT                   /translation="MAMDFAIKESKILSGVYIITPNFFEDFRGEIWSVFEDKAFVNLLP
FT                   KGLNFVLDKFTLSKPNVLRGIHGDHKSWKLVTCVSGEIQQVVVDCRKESPTYLKYESFN
FT                   ISSKQKKLILIPPFFGNAHYVLGDKEALYYYKWAYEGEYVDAEDQFTYAWNDERIGIKW
FT                   QGENPILSERDLKVLRG"
FT   gene            complement(633887..634939)
FT                   /locus_tag="JJD26997_0705"
FT   CDS_pept        complement(633887..634939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0705"
FT                   /product="GDP-fucose synthetase"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43342"
FT                   /db_xref="GOA:A7H2X0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X0"
FT                   /protein_id="ABS43342.1"
FT                   /translation="MLKDSLIYVAGHRGTAGSAILEGLLKQGFSNIITKTHAELDLTNQ
FT                   KAVAEFFASQKIEFVFLAAAKLAHLGQFEPASVLYENLMIQNNILNASFKNGVKKLLFF
FT                   GSAWMYPKNATNPIKEDALLSDKLDSVATPYALAKITGVKLCEAYNDEFKTGFLSLALA
FT                   NLYGQTKDFNFKTAKVLPAMLRKFHLAKLLSQNDEKGVLEDILLRDSLKLSTMSEAKEY
FT                   LAKFGVSEESVEIWGSGKVRREFIHSEDLADAAVYIMQNINFKQIKSENSHLNVGSGEV
FT                   LSIKELAFLIRDIVGFEGEVVFNTSKPDSTMDRLLDNSKINALGWKAKINLEKGVQMMY
FT                   QWYHTRGGGG"
FT   gene            complement(634932..636044)
FT                   /locus_tag="JJD26997_0706"
FT   CDS_pept        complement(634932..636044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0706"
FT                   /product="GDP-fucose synthetase"
FT                   /note="identified by match to protein family HMM PF01370"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43459"
FT                   /db_xref="GOA:A7H2X1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X1"
FT                   /protein_id="ABS43459.1"
FT                   /translation="MDKNAKIYLAGHRGLVGSAILRHLQKEGFSNILYKTHAELDLTNQ
FT                   EAVEEFFTKEKPQFVILAAAKAGGIAANSTYRADFIYENLMIEANVIHAAYKNGVKKLI
FT                   FIASTTIYPKNASLPTSENEMLKGDLEYTNKPYAIAKIAGLMLCESYNLQYGTNFIALS
FT                   PTNLYGSNDKFDLEKAHVMPALLRKMHLAKLLNEGHFEELLKDLNVKNLNEAKIYLAKF
FT                   GVSEESVEIWGDGTPTREFIHSEDLAKAVLFILKNVDFKDLYQKDEKEIQNTHINVAPG
FT                   ENISIKDLANLVKEVVGFKGTLFFNTARPNGAMQKHTSGKKLENLGFKAEISLKEGVRK
FT                   MYQWYHTRGGGGVSLPFYPTLSKAWEVSCA"
FT   gene            complement(636037..636636)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0707"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(636629..636952)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0708"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(636962..637495)
FT                   /locus_tag="JJD26997_0709"
FT   CDS_pept        complement(636962..637495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0709"
FT                   /product="putative nucleotidyl-sugar epimerase"
FT                   /note="identified by match to protein family HMM PF00908"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44246"
FT                   /db_xref="GOA:A7H2X2"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X2"
FT                   /protein_id="ABS44246.1"
FT                   /translation="MAIEFDIKESEILKGVFIIKPNKFKDLRGEIWTAFTQEQLAHLAP
FT                   VPFKHDKFITSKKDVIRGIHGDTKTYKLATCLYGEILQVVVDCREDSPTYLKYESFVIN
FT                   PQNQLLILVPKGFGNAHLVRSNEAVYYYKCAYEGEYVDAEEQFTYAWNDERIGVKWGVE
FT                   KPTLSERDIRAGLK"
FT   gene            complement(637495..638706)
FT                   /locus_tag="JJD26997_0710"
FT   CDS_pept        complement(637495..638706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0710"
FT                   /product="WbdK"
FT                   /note="identified by match to protein family HMM PF01041"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44742"
FT                   /db_xref="GOA:A7H2X3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X3"
FT                   /protein_id="ABS44742.1"
FT                   /translation="MKNYTLASSTWDEKELKAIQEVIDSDIFTMGEKVAKFEKDFAKFV
FT                   GSKYAIMTSSGSTANLIATAALFYTKNSKLKRGDEVIVPAISWSTTYYPLYQYGLKLKF
FT                   VDVDLYTLNYDLEALKEAISDHTKMIACVNLLGNPNDFDAINEMIKEKDIILFEDNCEA
FT                   MGATYRDKQAGTFGILGTFSTFYSHHMATMEGGFVVTDDEELYHILLCLRAHGWTRNLP
FT                   KENLISNKSDDDFIECFRFILPGYNVRPVEMSGAIGIEQLKKLPDFLKHRRENAELFIS
FT                   LFENSEDFIIQKALGDSSWFGFSLIIKPNSKLKRSEVLKKLNDRGIEYRPICTGDFTQN
FT                   PVIKYFDYSIFKELKNAKYIHENGFFVGNHQVSIEEQIKLFAKVVGGGITLSHLLLQPK
FT                   REAA"
FT   gene            complement(638785..640278)
FT                   /locus_tag="JJD26997_0711"
FT   CDS_pept        complement(638785..640278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0711"
FT                   /product="glycosyl transferase family 8"
FT                   /note="identified by match to protein family HMM PF01501"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44362"
FT                   /db_xref="GOA:A7H2X4"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X4"
FT                   /protein_id="ABS44362.1"
FT                   /translation="MLHICIGVSAEYVKYSAVLINSIVKATQKPFDLKPYENNLSFTKD
FT                   LKEGFCFHIFTEYKSEDTEKIALLAHKLSEIYPTKCLIHVMNNQDFQDFSYPFWCQNAA
FT                   MFYKIKVVDILKDVDKCLFIGADLFALGDVRDLFALDLKDNLIAAALDTYNFDGYLRKA
FT                   KAKNSDEELVFNDAKNYINNDMMLINLKEWRKQNLQAKYIDYLNKYDLAGDLDVFPLVC
FT                   APKIHILSSKYNFILGYYTRESFGLENTLKDESDKPVWNFTKVELEQIQKDLRLVHFCH
FT                   YVYKPWMSAYNCHYVYFNMGLDNDLKPIKVPYYKEWWDMALKTPFFEEDFANLKDKLEK
FT                   EALDHYAVALAKRLKDKENWLFGWLDGRFGEEDKKRNCEISALYSHIDEKLSFFYTHND
FT                   ALRRVKNRLAYKMGELIQNSNFSILSLKFLFKAVKLHLQNKTEIKIAKNCSKLYPFLKF
FT                   LPLEHCFNYEEALKIKQNLTYRLGEAFIKSLTHTRGGGD"
FT   gene            complement(640280..641854)
FT                   /locus_tag="JJD26997_0712"
FT   CDS_pept        complement(640280..641854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0712"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44594"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X5"
FT                   /protein_id="ABS44594.1"
FT                   /translation="MRKQIDRALDLWDFELARVLLASSEYKEEYENFLYETGQFSYLQN
FT                   SIYTNKITKIEYNLENFEGEGIEAMACVNYMLNNAIAKNDLCVQRAYDLFHKIKSEKFL
FT                   LAKAYFISKIISYFATKSESDRIEFFVPLAMYSSPQNLLMQVLQKDFNDQKGAKKFFDD
FT                   FIFQASLLVRKNLTDRFLGSKVAICFHGIFRGDFEGQINDTLEKLAKPLNADVFIFTWD
FT                   KFQEWGGLCGGISWSDRLLEKKLAESAPAEIGLNENFRKFFPNTSKVLSYEYRTPLSHK
FT                   AMQKFIAKNPCIRAYALENQDHKYLVWGEKIYYGMQKSLDLMQEYENKHNIRYDFIIFA
FT                   RPDFEIIKTLSLEDLRSLDLNEICEEYGFYGSGSGFPYGRAEAMRHYVSLMSNLHHLQG
FT                   SYLTNVVDNHDTQSKWAMYFNLKTRNWKHITALYNRYAPSDMICLKKLRIPNIKKAFKE
FT                   DLAVLQKEFNEKKLKEFESFFDRFTSHYECVSKKAKRYVANESATRGYKKAKPRKIFSK
FT                   IWKFIRG"
FT   gene            complement(641851..643593)
FT                   /locus_tag="JJD26997_0713"
FT   CDS_pept        complement(641851..643593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0713"
FT                   /product="putative sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43666"
FT                   /db_xref="GOA:A7H2X6"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X6"
FT                   /protein_id="ABS43666.1"
FT                   /translation="MNRENLPIVVSCPGSSTGDRMLAMINAIYVARFFDLPFKFVWPVP
FT                   EKNHHFMKIGEGFRGDGKDAIIGLSINASEKVFSKEFREKYEISGLDGESCFWGGFPCK
FT                   SIQEYKDEFYNNPPYRYIQMGIGPLEWQIRDLDIKHYYKTMPLIFKEITFSQRVNEMIA
FT                   KAEEAATKLGDFVAFHIRGGDAVEGYAQDRCLHEMTIHHGVYFELVLAYMENHPSEKIL
FT                   LVGDNLSQLRLFAKSLDREVVLSNDLIGENYSNLELWFFDVILMSKAKKIYLGHSAVAR
FT                   TACWISGKPIFHYNFGMTLEQQYFFLEKYKKHCEILNPFIKAHACFYRFVLSRNLHYPL
FT                   EVRIAHLKEALSYDKENDKFHINIIHQYLKFNCIVEAEQYLSSVLKEREEKFFKILTSE
FT                   YWAGPSFKNLFEEFFAKTSFAFKNLTFMALKIAQYLKDEEKIKLFYIMSKQEYGENLIS
FT                   YSSHIVPLQGAIKLVKSHLAYKLGACMIRNSKSLLGCIKMPYLLVAIKWAHAEERKNFI
FT                   NITPLQDYIDYEEALKVKKFLSYKLGEALIKAYKNMWKGGLIKFVFKEAWEIRRNFMEK
FT                   KANR"
FT   gene            complement(643594..644169)
FT                   /locus_tag="JJD26997_0714"
FT   CDS_pept        complement(643594..644169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0714"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44772"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X7"
FT                   /protein_id="ABS44772.1"
FT                   /translation="MLNVNFSQTTIDQFHTNLNKLGFGSKYYRDIFYELSVNEGLKCIS
FT                   TDIALSEILLDLGARVHHFEKNKKLKNILEKHFKERENIQFHYKMLSNQNAILELPKYN
FT                   YGKGFLPIENNLRESIECVDINTLDEFEEELYLFYMELDFHNYKILEILETKKIKFIFL
FT                   KVDAVFEKSEIFEKLEQKYYKIQFIKGL"
FT   gene            complement(644163..645623)
FT                   /locus_tag="JJD26997_0715"
FT   CDS_pept        complement(644163..645623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0715"
FT                   /product="galactosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43942"
FT                   /db_xref="GOA:A7H2X8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X8"
FT                   /protein_id="ABS43942.1"
FT                   /translation="MINKKVGIVIPVYNVELYLRECLESVINQTYKNFTALLINDGSSD
FT                   NSLEIAKEYARKDERFIIISKENNGLSSARNVGIEFFEGKYHFKESESEEDLFKFCLNN
FT                   ELNPYKIHFLYQNKNKLNEEKIDYLIFLDSDDFWKLDCLEQCVKRMEGVDVLWFGVKPF
FT                   YDGIKEGDWKSNLEWFDYDKELIISKRDWLRRIFEKKQHFFYFSWSGMINFHFLQKIGL
FT                   KFINEILQEDDSFGILLFLQANFIYVYPKEMIVYRLRSKSIMNYSNENKKVAQYFRKQT
FT                   EVFELEEDKRAYHLASSFVRATLALDAFLQECDDEEANFIISHYLMPTYASSSFRILSF
FT                   EKDPLEIMERCVRLKKYMKDLSYFNFSLKEETIYDVGREALKDLKKFPNILKLPFKICK
FT                   MMKRYRVKQNIFKKNCERFDLWELYYNVKNDYINKMHLSYKFGVLFFKAYKYRYFGSFL
FT                   FIPFALPFVIYSWSVARKNSRGGGGAIC"
FT   gene            complement(645620..646966)
FT                   /locus_tag="JJD26997_0716"
FT   CDS_pept        complement(645620..646966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0716"
FT                   /product="putative sugar transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44595"
FT                   /db_xref="GOA:A7H2X9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2X9"
FT                   /protein_id="ABS44595.1"
FT                   /translation="MSVKVSVIIPSLNSIAYYDECIKSVMKQSLKELEIICVDANSTDG
FT                   TLELIKKYQKEDERIKLIISDKKSYGYQMNLGIAAANGEYVGIVESDDYIKENMYKELY
FT                   ALAKNKNLDILRSDIYNFYDKEKREFKYSVISYDEKFYHKDLYFESAGAVCKNTALTKQ
FT                   EILKNSWNMNPPGLFSLDFLRKSRLKFHESAGASYQDLGFWFITIVSACKIYFHKKAYY
FT                   YYRQDNMGSSCNSKKKVYCLCDEYSFMENFLKQKEEFKQYAFVLAYLRFGSYCWNMNRI
FT                   DESFYFEFLQRFQEDFRKIVGREELDRALFLPWQLEILDTILRSPQEALDRYYTKLYGA
FT                   IDRIKNQLSYKLGEAILKANSPLKFLKLPFTLISLAKTHQFEQKVLQFLIRLEPKFKPL
FT                   DLEKYADYEEALKIKKHLSYRLGQALLKNPLTFIFKIPSIYQNFKKGVS"
FT   gene            complement(646968..648065)
FT                   /gene="glf"
FT                   /locus_tag="JJD26997_0717"
FT   CDS_pept        complement(646968..648065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="JJD26997_0717"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="identified by match to protein family HMM PF03275;
FT                   match to protein family HMM TIGR00031"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43638"
FT                   /db_xref="GOA:A7H2Y0"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y0"
FT                   /protein_id="ABS43638.1"
FT                   /translation="MYDYLIIGAGLFGSIFAYEASKRGKKCLVLERREHIGGNCYTKEM
FT                   AGINVHYYGAHIFRTNEKRIWDYMQQFCEFNHFINSPIANYKGEIYNLPFNMNTFSKLW
FT                   GISTPSEAREIIEKQKASIKGEPRNLEEQAISLVGVDVYEKFIKGYTQKQWGKACKDLP
FT                   KSIIRRIPVRFVYDNNYFNDPYQGIPKGGYTKIFEKLLGQCEILLNIDFIERREEFAQK
FT                   AKTIIFTGTIDSYFDYKLGALEYRSLKFEHEILDMQNYQGVAVVNYTDFETPYTRIIEH
FT                   KHFEFGTQEKTVISREFPLSWSKDIEPYYPINDAKNTALYESYLALAKAEKNVHFCGRL
FT                   GEYRYYDMQDVVKSALKFCESELKD"
FT   gene            complement(648093..649448)
FT                   /locus_tag="JJD26997_0718"
FT   CDS_pept        complement(648093..649448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0718"
FT                   /product="putative sugar transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44780"
FT                   /db_xref="GOA:A7H2Y1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y1"
FT                   /protein_id="ABS44780.1"
FT                   /translation="MKNVSIIVPFFNVEKYFRECLESLIGQDYENIQLILIDDESMDKS
FT                   LNIAKEFAQKDSRICILSQKNAGQATARNLGLDFLEGKLKFDFKGDEVGLCAFVGEGFK
FT                   AWQNAKFKFKKTDYLLFVDSDDVVEKSFVSECLKAIKDADVLWFDYDFLCEIPFKKTPK
FT                   SQMELFDLSEGIISAKKWLEVAKTKPLFWLTWQGMIDFKFLQKIKLRFVGGAIYEDNCF
FT                   GVLLFSMTEKIAIYKKKLYHYRLRANSTMNPEEKGLSKHSYLYELYLAVGEDFEALKTQ
FT                   QWAKSWLLSVLYMSEFKGFEGEFREHFMPIFLDKAMACLFLEQDPLNLKQKFEVLKGEF
FT                   EHYILSGAECVRQGLAYRLGFIFLQNYKSFAGLKRLFKELKKGVLECERAWEKFEENKA
FT                   KFHFLHFDEDKNNIEILKIKRHYSYKVGKIMSFLKNFFNFQKKKNKIWIRFC"
FT   gene            complement(649445..650440)
FT                   /locus_tag="JJD26997_0719"
FT   CDS_pept        complement(649445..650440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0719"
FT                   /product="putative sugar transferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43851"
FT                   /db_xref="GOA:A7H2Y2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y2"
FT                   /protein_id="ABS43851.1"
FT                   /translation="MLISILIPSYNSASYIKECLESVLAQSCEKLEILCIDAYSNDGTL
FT                   DILREFARKDQRIKLILSERKSFGHQLNLGLENANGEYFSIVESDDLAHPLMCERLLNL
FT                   ALTTKCDIVKANLTSFTQDKQELLKIISNENFYGRILDEKDRKDVLKEGFIINVSALYS
FT                   LDLIKKFDLKLNETSGAAYQDTGFWFELFSVAKTWYFHNESLYFYRQDNPNASTKSREK
FT                   IYAICDEFDFIEHFLKKQNLGHLRELFLYRKFKSYWWNLKRIDKSYREEFLMRFANDFK
FT                   EENLKVGIFSAGEFEELRKIIYNPHIFAKALSSPLFALKKFFARFKKSLL"
FT   gene            650518..651102
FT                   /locus_tag="JJD26997_0720"
FT   CDS_pept        650518..651102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0720"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /note="identified by match to protein family HMM PF01205"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44137"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y3"
FT                   /protein_id="ABS44137.1"
FT                   /translation="MQTISSLYTAHYEVKKLLFIAHLSPFNDFKNLLNTLKKEHSKAVH
FT                   FVWAYRFLNENHQIVEDKSDDGEPKNTSALPCLNVLRGKELVNVSVIVVRYFGGIKLGT
FT                   GGLVRAYGEAVNLAVKEAILEPFELKESLKFSLSFKNVFKMEHFLKKSNITFQREFKET
FT                   HIIFKLKLSQKEKVEFENFLKIFNPQELKIL"
FT   gene            651204..653231
FT                   /locus_tag="JJD26997_0721"
FT   CDS_pept        651204..653231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44788"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y4"
FT                   /protein_id="ABS44788.1"
FT                   /translation="MSREIEKFLEILKDPQKHFGINVHDLSTCKAYEYEKYDCEIALLH
FT                   KYHFENDPDNEKLLSTFKDVFSKDYLELRHPFHNDVVTRAVLNVTRPWSPSIYFIDENN
FT                   RYPWIIYNWDSIGLMFITPKNVFFSQKILLSKESTENFLNHALSISKTITKLKIKDLKF
FT                   KNKKFGIDLGLLRPYHAFYDFNWFNKLHLQNCKVINNPMFFKINTMANLVDGNDLVSIR
FT                   PSLLDLCFLNFETGKNYVEDYIDEALEAHTRGGGYNLTLWLGIPGERRIWLEQWEGIPQ
FT                   ILKNLNLYFSNIKVYIDGMTSYDGERTEFKANVENFWKIVENIEITLKATHTKCSTFDP
FT                   NDKNSANKALITTKNGQIDIESLSGYDYKAKIARCNLCDIAICELGTTELTPFNFLKKS
FT                   GVAFYFHEEQKGHMQHLAKTIPHLKTLFPYHHKLFNTEVIITICNYHIPYQHLYNLAAE
FT                   CLEELSLENKIKGFSRENPLKMHRLSVPSVELINKAYELEQKTGVVLKNNKEEKKILQK
FT                   IKAQEKLLRTQNLLLKIEQKQAKSNNPSPQAQIPLQKPKGAVERVHRHLAYKLGIAIIV
FT                   CSKSLLGYARMPFVLYHIKAQHKFEQEKFQKALLKNPALKLLPLESYADYENALKEQRC
FT                   YTYKLGLAMMEAHRNLFKGGLVWFYFESKRLKREFEKEKQ"
FT   gene            653228..653938
FT                   /locus_tag="JJD26997_0722"
FT   CDS_pept        653228..653938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0722"
FT                   /product="putative acylneuraminate cytidylyltransferase"
FT                   /note="identified by match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43815"
FT                   /db_xref="GOA:A7H2Y5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y5"
FT                   /protein_id="ABS43815.1"
FT                   /translation="MKFTAIIPVKGNSSRLPYKNILPLGDENLLTRKIRQVKESKIANR
FT                   IIVSSDSKIMLEMARNLGVETDLRPKDLVDESRPFSDLLAYFADIVKEGHFVYTCATSP
FT                   FFDENLMRQSKEKYLFALENNYDSLIAIYKFRHFLLDEKGPFNFKPGKKHLNSQDLKPF
FT                   DFFTNGIIYTPVENIAKFNYFYGPNPFRFEVGQKEALDIDTKEDYLSALAFLDEERLLK
FT                   KAYEAFNRGGGGQL"
FT   gene            654002..654445
FT                   /locus_tag="JJD26997_0723"
FT   CDS_pept        654002..654445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0723"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44326"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y6"
FT                   /protein_id="ABS44326.1"
FT                   /translation="MKTFTLKLTLNTNFLKLNLNKRSFISLKNFCEEEFDNLSDSLLIL
FT                   NANCFFELKDLSNLLENKNPKALSFMINNTNYQSLELINQNNKIAKINKKPNKIPYLSY
FT                   AGALFLNKEQITKIKNFKNVLINDLKFDLEIVKLWKHSLQIHL"
FT   gene            654415..655470
FT                   /locus_tag="JJD26997_0724"
FT   CDS_pept        654415..655470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0724"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43999"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y7"
FT                   /protein_id="ABS43999.1"
FT                   /translation="METLSANSSLIGGSYAGCSKLHLVKKETEQMGNEKLINEINWINA
FT                   LPQNLKANFPNILEYQCGESNTWYLMPFYDLENLREKILSGKFSSEQTLYFMDKILHFS
FT                   FKNLNCKRNKEVPEDYLFKKYFNRVLQRMEALENITPYNTILKAKHIIINQKIYPNLKE
FT                   LINKLIAFEEESGFFTPKELVMAHGDLHFQNILIDELNDNFILLDPRGDAWLDIYYDLG
FT                   KIWHSCNGLYDFIHTELSEMTILKQDNDSIEFNFTLSDDKELIKTYENIKNAIIKLLET
FT                   KFAKELNDQNWLLKTLFAEAMHFASLMHFHLKYDGIENRSVCLYLQSIILCDYLLTNLQ
FT                   GIKTHIRGGGK"
FT   gene            655471..656604
FT                   /locus_tag="JJD26997_0725"
FT   CDS_pept        655471..656604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0725"
FT                   /product="putative glutamine
FT                   amidophosphoribosyltransferase"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43265"
FT                   /db_xref="GOA:A7H2Y8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y8"
FT                   /protein_id="ABS43265.1"
FT                   /translation="MFAIFFQKFGVAKMLLKPLPQFLECIILDKNLLHSKLKLYLERYL
FT                   TKNYAIVAEESFAEYFKILKFNNIILKQTEFNKYQKILQNQKTHIFVLNKGAKFKIKKD
FT                   SNITHITIPKMSAFDNTNNKLYKGKILADNLAENIVLSIKNKEKMKNPQENSLIPLKQK
FT                   YCSLRLLYKNDVNDIILGQNVGEFRIKLGKILASYIDKRLIKNLDYIVGVPSSGIFYAV
FT                   GLSQALNIPFLPALKKQEVSERSFEIVNTDIRKNYLYSNIQINSHLIKDKKILLVDEAI
FT                   FTGATLKIVCDILRDNKVKEKIHLAIPSPKCYKQCDYLMLPKRTLLLEKIKENLMAQYL
FT                   NADSLTFLPQKAYKNALIQINKNLCLECFENKGEVNV"
FT   gene            656684..657235
FT                   /locus_tag="JJD26997_0726"
FT   CDS_pept        656684..657235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0726"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44289"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Y9"
FT                   /protein_id="ABS44289.1"
FT                   /translation="MFYLKKIDHIKEIIIASNCDLKKEATNLGVKFYLRSKEESDDDVS
FT                   LFVKNIATQVKNKHIIYTYCNTPLFDEKCLLNSIEKYLSLDFNTYDSLITCTKLQSFIF
FT                   DENGAFNFKNIHTNSKNIATLYQLLNACFIMSKELNLRYAYHFGKIPFKELIHKKDSFE
FT                   IKDKESFIFFKNMLDKKERK"
FT   gene            657232..658224
FT                   /locus_tag="JJD26997_0727"
FT   CDS_pept        657232..658224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0727"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00682"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43421"
FT                   /db_xref="GOA:A7H2Z0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z0"
FT                   /protein_id="ABS43421.1"
FT                   /translation="MNIQILDCTLRDGSHINNGKFGKEKIRQIITGLIEANIDIIEVGL
FT                   LQNHQCGVDFSIFNSIDFVDQCLSTIEKKNSKFSLMLRTDRVDFNKLAKSPKVDFIRIA
FT                   LYQEHLNDIKRYGEKAKELGYEIIFNPIAITKYSPNEIQFLIKTLEELKPYGISLVDTF
FT                   GSFTLNEFEKVLKIFDENLSPNITLGIHLHQNLNLAPSLAAKATKLIINRDLIIDSSLS
FT                   GMGRVPGNLQSELFANYLNQNFNHQYNIEKLLSLTALIEEFEILNRWGYNPIYMYSASL
FT                   NIDRTYPEFFEKMGFCIENNLNLQKICKEKGIGSKFNEEEAQKIINSYN"
FT   gene            complement(658266..658508)
FT                   /locus_tag="JJD26997_0728"
FT   CDS_pept        complement(658266..658508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0728"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44505"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z1"
FT                   /protein_id="ABS44505.1"
FT                   /translation="MVEFDNGKDYFDYVDFYKTYSKSDDTYFHISFLEDRGLSEKEILI
FT                   RNKYRKMRDENCKRAKEEFIKNNEIEPEHLPTHGD"
FT   gene            complement(658592..659648)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0729"
FT                   /note="ABC transporter, ATP-binding protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(659636..660157)
FT                   /pseudo
FT                   /locus_tag="JJD26997_0731"
FT                   /note="ABC transporter, ATP-binding protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(660249..660611)
FT                   /locus_tag="JJD26997_0732"
FT   CDS_pept        complement(660249..660611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0732"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44475"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z2"
FT                   /protein_id="ABS44475.1"
FT                   /translation="MLFIHDSNIIAEFKSKYVAFCSVGDVDLEIIERCELLSKETLGQG
FT                   IKCFDVFIVAHRTSGKTCDFIKECLKQNTQAKIREFKSLTKGEFYDENGGFLHKKMEQH
FT                   IEQTSKELYEAIKACL"
FT   gene            660597..660929
FT                   /locus_tag="JJD26997_0733"
FT   CDS_pept        660597..660929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0733"
FT                   /product="putative dna methylase-type I
FT                   restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44329"
FT                   /db_xref="GOA:A7H2Z3"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z3"
FT                   /protein_id="ABS44329.1"
FT                   /translation="MNKEQENYIFASFTIRIRLKDVETFNPYFVALYIQHIAKEWYLYR
FT                   NIAQASVRQNTDLPTIRNLYIPKIDPTAQEKIAKYIQKSFNLRKKSKQLLDNAKNKVEE
FT                   QIQGKT"
FT   gene            660926..661117
FT                   /gene="thiS"
FT                   /locus_tag="JJD26997_0734"
FT   CDS_pept        660926..661117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="JJD26997_0734"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43251"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z4"
FT                   /protein_id="ABS43251.1"
FT                   /translation="MIINGEKLEFKELKFMDFIKEKGLKIELIALELNGEIIPKSEFEN
FT                   LILKENDKAEIVSFVGGG"
FT   gene            661114..661917
FT                   /gene="thiF"
FT                   /locus_tag="JJD26997_0735"
FT   CDS_pept        661114..661917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="JJD26997_0735"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM TIGR02354"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44020"
FT                   /db_xref="GOA:A7H2Z5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR032726"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z5"
FT                   /protein_id="ABS44020.1"
FT                   /translation="MMRVKFNGKELDTDFKTSLEFFENISKNENDVWIINGFATKENIA
FT                   LNEDDELFCIERNTLPPKDALDAMMRARHTPKLHDKLKNGRVAVCGLGGLGSHIVINLA
FT                   RSGVGYLKLIDFDVIEPSNLNRQAYRVSDLGKFKTEALKEQISEINPYISVEICTLKID
FT                   EDNLKSLFKDIDIVCEAFDSAIAKAMMAQNFHRFYKDSILICASGLAGYGDNNSIQTRK
FT                   IAKNFYVCGDLVNGAKVGNGLMAPRVNICAGHQSNLVLELLANKE"
FT   gene            661920..662696
FT                   /gene="thiG"
FT                   /locus_tag="JJD26997_0736"
FT   CDS_pept        661920..662696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="JJD26997_0736"
FT                   /product="thiG protein"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43917"
FT                   /db_xref="GOA:A7H2Z6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2Z6"
FT                   /protein_id="ABS43917.1"
FT                   /translation="MQENLKNDKLKIGKYEFDSRFILGSGKYSLELIKSSIEEAKAQII
FT                   TLALRRANTGEIANILDYIPKNITLLPNTSGARNADEALRIARLSRELGCGELIKIEVI
FT                   SDSRYLLPDNYETIKACELLAKEGFTPLPYMHADLYAARAMRDVGAAAIMPLAAPIGSN
FT                   KGLCAKEFIQILLNEIDLPIIVDAGIGTPAQACEAMQMGVSAVMVNTAIAEAKDIALMA
FT                   RAFSLAVNAGRAAFLAGLASVSEAKASSPLTGFLRD"
FT   gene            662699..663844
FT                   /gene="thiH"
FT                   /locus_tag="JJD26997_0737"
FT   CDS_pept        662699..663844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="JJD26997_0737"
FT                   /product="thiH protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968; match to protein
FT                   family HMM TIGR02351"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44589"
FT                   /db_xref="GOA:A7H2Z7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z7"
FT                   /protein_id="ABS44589.1"
FT                   /translation="MQDYMQHLPHMQEIKSEILNKVLIQVQSYDESQFSAKDVKNALNQ
FT                   THLSIEHLKALLSSAAEDFIEELAFKSAKVKQKYFGNSISLFTPLYLSNYCNSKCVYCG
FT                   FQKGNKIARAKLSEVEIHEEMQAIAKSGLEEILMLTGEGREFASVEYIANACKIAREYF
FT                   KVVGVEIYPMNEEEYKILHEKGCDYVTVFQETYNPLKYSKIHLSGEKRIFPYRFNAQER
FT                   ALKAGMRGVAFGALLGIDDFRKDALATALHTHFLQQTYPHAEISISVPRLRPIINNAKI
FT                   HPKDVSEKRLLQVLCAYRLFLPFAGITISSRERIGFRDEVIKLGATKMSAGVSVGIGEH
FT                   KGEKKGDGQFEISDDRSVDEILAMLKKSNLQAVMSDSIYVG"
FT   gene            663834..664445
FT                   /locus_tag="JJD26997_0738"
FT   CDS_pept        663834..664445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0738"
FT                   /product="putative thiamine-phosphate pyrophosphorylase"
FT                   /note="identified by match to protein family HMM PF02581"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43645"
FT                   /db_xref="GOA:A7H2Z8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A7H2Z8"
FT                   /protein_id="ABS43645.1"
FT                   /translation="MWDKKIIAISDRKCVEIDFLKQIEKLAKAKVDAIVLREKDLSEFE
FT                   YYDLAKEVLSICAKQKVTCFLHFFDRECLKLGHRYFHAPLSLLRKEPKLIKYFHILGTS
FT                   VHSKEELLEAMSYKVNYAFVGHIFESSCKVGLEPKGLDFLKSLLEFSQIPLYAIGGINA
FT                   QNIENFKDINIAGVCMREILMKEKDLKTYIQVCKERLFHE"
FT   gene            664542..665138
FT                   /pseudo
FT                   /locus_tag="JJD26997_0739"
FT                   /note="putative transmembrane transport protein,
FT                   degenerate; this region contains one or more premature
FT                   stops and/or frameshifts"
FT   gene            665270..665416
FT                   /pseudo
FT                   /locus_tag="JJD26997_0742"
FT                   /note="putative transmembrane transport protein; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts"
FT   gene            complement(665571..666599)
FT                   /gene="murG"
FT                   /locus_tag="JJD26997_0743"
FT   CDS_pept        complement(665571..666599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="JJD26997_0743"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF03033;
FT                   match to protein family HMM PF04101; match to protein
FT                   family HMM TIGR01133"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43706"
FT                   /db_xref="GOA:A7H2Z9"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H2Z9"
FT                   /protein_id="ABS43706.1"
FT                   /translation="MTIALTGGGTGGHLAIVRCLLESAIKKNIECVYIGSQNGQDKAWF
FT                   ENEARFKEKFFLSSKGVVNQNKFGKISSLLHTLKLSKDCREIFKKYHIQAVFSVGGYSA
FT                   APASFAALFSHLPLFIHEQNSKSGSLNMLLKPFATKFFSAFEKEFSPYPVANKFFDNAR
FT                   IRKELKNIIFLGGSQGAQFINELALNLAPKLQEQNIKIIHQCGKNDFEKCKKHYQSLNI
FT                   QADVFDFSSNLGEKMKNADLAISRAGASTLFELCANTLPAIFIPYPYATKNHQYFNAKF
FT                   LQDQALCQIFTQDSINLDDFFKAMLKLNLEDISTRLQNIAQKNGGDILLEKALSNNLAF
FT                   IR"
FT   gene            complement(666596..667759)
FT                   /locus_tag="JJD26997_0744"
FT   CDS_pept        complement(666596..667759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0744"
FT                   /product="cell division protein, FtsW/RodA/SpoVE family"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44661"
FT                   /db_xref="GOA:A7H300"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:A7H300"
FT                   /protein_id="ABS44661.1"
FT                   /translation="MVADKRLFYLSCILIAIGIVFSYSLTAFTVLFLDYSEFHFFIRQL
FT                   FFGISGILIMFFISRLDPDKALSKKIILAILIISFIFIIILPFLPSALATASGGAKRWI
FT                   RLGPLSISPVEFFKIGLIYFLAWSYTRRIDDSKKAIRHEALILLPYCILASIVIGYIYI
FT                   TQNDLGQSVISFFLILALAFFAGASKRLFAFGTLIIMMIGIMVIFSNQRRIQRIASWWG
FT                   NIQDAFLPMLPDWLANALRVSSNSEPYQISHSLNAIAHGGMFGEGLGLGTFKLGFLSEV
FT                   HTDFVLSGITEEIGLLGLGIICYIYLWMILRIFRIAGRCEAKQDFIFCSGIALLLLFSF
FT                   FMNAFGIISLTPLKGVAVPLLSYGGSSMWAICIGIGYVLMISKKVKL"
FT   gene            667899..669344
FT                   /gene="accC-1"
FT                   /locus_tag="JJD26997_0745"
FT   CDS_pept        667899..669344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC-1"
FT                   /locus_tag="JJD26997_0745"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02785; match to protein
FT                   family HMM PF02786; match to protein family HMM PF08443"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43436"
FT                   /db_xref="GOA:A7H301"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A7H301"
FT                   /protein_id="ABS43436.1"
FT                   /translation="MNQIHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVK
FT                   IADEAYRIGTDAIRGYLDVVRIVEIAKACGADAIHPGYGFLSENYEFAKACEDAGIIFI
FT                   GPKSEVIYKMGNKNIARKLMAENGIPIVPGTEKLNSYTLKEIKIFAEKIGYPVILKASG
FT                   GGGGRGIRVVHKEQDLENAFESCKREALTYFNNDEVFMEKYVVNPRHIEFQILGDNYGN
FT                   IIHLCERDCSIQRRHQKMIEIAPCPGISDNLRKTMGVTAVAAAKAVGYTNAGTIEFLLD
FT                   DYNRFYFMEMNTRIQVEHPITEEITGIDLIVRQIRIAAGEILDLEQSDIKPRGFAIEAR
FT                   ITAENVWKNFIPSPGKIGEYYPALGPSVRVDSHIYKDYTVPPYYDSMLAKLIIKATSYD
FT                   LAVNKLERALKEFVIDDIRTTIPFLIAITKTREFRRGYLDTSFIETHMQELLEKTEDRH
FT                   QENKEEVIAAIAATLKKIRESRE"
FT   gene            669348..669560
FT                   /locus_tag="JJD26997_0746"
FT   CDS_pept        669348..669560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0746"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44430"
FT                   /db_xref="UniProtKB/TrEMBL:A7H302"
FT                   /protein_id="ABS44430.1"
FT                   /translation="MDFLDSLKSIKKEMQANTNTPKLAKKSSKSGASVKTLEKLAKEMQ
FT                   EIFLKQEKLQDEFSEFIKNADIKKI"
FT   gene            669560..670279
FT                   /locus_tag="JJD26997_0747"
FT   CDS_pept        669560..670279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0747"
FT                   /product="arginine-tRNA-protein transferase-related
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04376;
FT                   match to protein family HMM PF04377"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43401"
FT                   /db_xref="GOA:A7H303"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H303"
FT                   /protein_id="ABS43401.1"
FT                   /translation="MLEIGFCTLEDQCPYLKDKRSRIEYKYIENCPKEINNELIKRGWR
FT                   RFGRYFSRPICKDCDECLSLRILVNEYHFSRSERRVINKNINTKVILRMPNLSNEHLFL
FT                   YDKYHRFMEEKKDWKRYDLSFKQYCNLYVDGFMNFGYELAFYIEDKLVCVDLIDILEDG
FT                   ISSIYCFYDPDFSYFSLGKFSLLNEIQIAKKMNLDYIYLGYFVKKCQSLSYKADYTPSE
FT                   ILKGTKELFENEILWEK"
FT   gene            670280..671086
FT                   /locus_tag="JJD26997_0748"
FT   CDS_pept        670280..671086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0748"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44395"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A7H304"
FT                   /protein_id="ABS44395.1"
FT                   /translation="MQIVQTLETINVNTDDISVFQYFKDLITKNFTKVIGRKNKIFSFF
FT                   EENEIPQRRYFLKVLDQKYRKSTNEGIENLQDAHFKTFRLNFEQNNMLKPMLFIKIDFA
FT                   AGRILMKLSSNEKLFVTYIRNYFQDHNIEYNEMTNILILEYKNENTLELFEAFADESEH
FT                   LKYCVNFEVDREEYKKFRQNIHNKENMKWKFNALAKLFSNYFNTLECTPQNDLSEIRQK
FT                   YLILVKLYHPDFHQGKSAIEKAYAREQFEKIQIAYDNLKALYKNNT"
FT   gene            complement(671109..674126)
FT                   /locus_tag="JJD26997_0749"
FT   CDS_pept        complement(671109..674126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0749"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43137"
FT                   /db_xref="GOA:A7H305"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7H305"
FT                   /protein_id="ABS43137.1"
FT                   /translation="MFKLAINRPITVLMFFLALMIFGLISAFSMSVNLFPNVSIPLIKI
FT                   TSKVNGDLNFVESKVTKEIENALSEIDGVKTITSAAYDNFSVSVVEFKLGKNLEVAAND
FT                   VRDKIGTLSLPSKPEIEKISSDSGSAISLFLYSKDKLQLMREINDKIKPFLQRVEGVGK
FT                   IEAKGFLEPQIRIELKPNELRKYNLNALDVANIIKSQNFKQALGELNNKQDNYIIKGYF
FT                   EATNLEELSNLRIKTGVFLSDIANISSLYEDEKQSALYEGKEGVLLELGKITNYNTLEM
FT                   IKNIKNALPILEKQIPKDISINVLYDKSLNIHKHLSQVIFDMVLGIFLTLVIVFLFLRN
FT                   LSATLIACIAIPTSIISTFFIIDLLGYDLNRLTFIALTLSIGIFIDDAIVVIENIAKKL
FT                   KTYPPLQAAFLGINEIGFSVLSISIVLLCVFIPISYMNSIPGLFFNALGISVASGIVIS
FT                   FLVSVFLIPSVGARFLNSKESKFYEKTEAFFEKIEQKYENLLYKILQNKAKFILATLVF
FT                   VGLSFALATRIGLDFLPMEDDSEIQVLLESKKNLSLEAMKEKSLNLLEKIKNDSNVKYA
FT                   FLLVGYDDAKDATKAKIYVKLKNLDERNLRQSAIVSLYRQKFQDESLKIKILELPKIEG
FT                   AGIDDPVQFLILGDDLNTLKEAASRAKEILDTNARIVDISDNANTTKDEVALHINKEKA
FT                   KLLDVNPEYIAGVLGYSFSQLSVGSMDRGNSKDDIILSFAPEFKKDIEALKRISIKNNQ
FT                   DVNLELSSVVDFIYSKDLKTINRYNKNRSVKITAGVNDLSLGAVQKLLLDNMDKILNNN
FT                   PSLSYAFSGFINLLGETVQGFAMAVALAFVLIYLVLAALYESFILPLIIMITMPLAFGG
FT                   ASIGLFITGHNFSLFVLIAIILLFGMVGKNAILLVDVANKKCHEGLDSDKALLIAGKSR
FT                   LRAILMTTFAMIFAMLPLALSRGAGYEANSPMAIAIIFGLISSTLLTLLVVPALFKFCF
FT                   KLDSKLRKIYEREKLN"
FT   gene            complement(674129..674869)
FT                   /locus_tag="JJD26997_0750"
FT   CDS_pept        complement(674129..674869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44092"
FT                   /db_xref="GOA:A7H306"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A7H306"
FT                   /protein_id="ABS44092.1"
FT                   /translation="MKKILFLLLAFNCAFGEEIYASFNVEASKQSKLALESIGLVQKIP
FT                   VEIGQKVNKGELLLALDQESEKIALQNAQNSYQLALVEYENTKSKMQKIKAVENVIDKQ
FT                   SYEDMKAKFDAANLNLNKAKINIAYYKNIMTKKELRAPYDAIIANKFIQVGEGVGGVAQ
FT                   PLIEIFSYPQSKLILSFDEKYKDKVKLGDDFFYKIDQNGTEFKGKISLIYPSIEVKTRK
FT                   IYAEVQTTNLTPGLFGEGRIITKD"
FT   gene            complement(674866..676125)
FT                   /locus_tag="JJD26997_0751"
FT   CDS_pept        complement(674866..676125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0751"
FT                   /product="putative outer membrane component of efflux
FT                   system"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43812"
FT                   /db_xref="GOA:A7H307"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A7H307"
FT                   /protein_id="ABS43812.1"
FT                   /translation="MRFINIILFLPLVLFGSNLKELINLSQKNEQYLIKQIQIEQAKLT
FT                   SKEAFRNYLPSLSLNSAYVANNKDRFIIDPQESLFAKVSLHFLLFDGGAREANLRALES
FT                   REKLSLLDKEQNKNYLALNAITLYFNTLSLEKILLANQQKIAFLKSTFERLQKFYDAGL
FT                   SPKDELESIKAKYHLSLLELSQNELKLANIQKEIKILSNTDFKVQGNAFLENPQQEKSQ
FT                   NYEVMIAKEQISLAKESVNLAKAEYFPKFYIQDNFNFYKNNYNPKVPAPFVNLADQFLE
FT                   KYSQGNQFILGMEWKIFDFNARAKEVEKERLNVQIANANARLSERKNKEELNYLDKSLK
FT                   VLQEQILALNLSLNAANLAFESVDKKYQAGLVSYVEYLQALEAKFKAQSDLELAKNEFE
FT                   ITKANYYFNAGIDLNSKVKE"
FT   gene            complement(676173..678215)
FT                   /locus_tag="JJD26997_0752"
FT   CDS_pept        complement(676173..678215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0752"
FT                   /product="outer membrane ferric hydroxamate receptor FhuA"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABS44124"
FT                   /db_xref="GOA:A7H308"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A7H308"
FT                   /protein_id="ABS44124.1"
FT                   /translation="MNKIFNSFLLISISISLTLAKESSYELNAISVVGSIEKGNQSIDY
FT                   LSPKSVSIINSKQIQEEGAEQLDEITRYESGFISQIYGADLDTTDWLKLRGFDASLVLD
FT                   GTAIYKGGYFGWSPDLYGLESIEIIKGSNSLSYGSSQSGGVINLVSKRPQKTPVAEIGG
FT                   KIGNLSQNGLFLDIGDKAFNTNSNFRIVGNYFRQNGQLNGTWQEHYYFAPSLAIDMNNN
FT                   TFLTLLSSFQYDQGVPTTGFFPVYGTIINTPQGTIKPNVNLGSPFSDYLKRKQYSLGYE
FT                   FIHYFDDELSFMQNYRYNMENKNQFATSFSALNQNNPNTATRNSIILDGIARSHTLDNR
FT                   FILKNIYKKLENTLIGGVDYQYIYVNGKYGYGSASNINIFNPDHTPQIKSKVPTYLVKQ
FT                   SQLGLYIQNKSKLYDRWILDLGMRFDKAKSNAKSFGSESNYNINHATFQTGLMYIFKDL
FT                   GLMPFISYSEAFRPIAGNDGKGKDYKPYESRQHEIGFKYLPYFIDGELNFSYFDIQEKN
FT                   ALVNANPSASIPVSIQAGKQSAKGIELSSNIALNENINYALSYTHYFQTHTSLNALKII
FT                   RTPMIPKDVFGTKISHTLGIDQKQNFKSGFGIRYVGSSTDEAGNAGIKVPSYILYDLAF
FT                   GYNYNKWNAQLNINNIFNKKYVSGCYYSCYYGEGIKGILSISYKY"
FT   gene            678395..679159
FT                   /locus_tag="JJD26997_0753"
FT   CDS_pept        678395..679159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0753"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:JJD26997_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABS43565"
FT                   /db_xref="GOA:A7H309"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H309"
FT                   /protein_id="ABS43565.1"
FT                   /translation="MAFIKSCNVNFKNQNQYIIYPTNLCFENDKIYALMGHNGSGKSTL
FT                   LKILARQLKPSFGKICFNDQDITDFSSKELARKIAYLPQHLPNLGYLSVRELVKMGRYS
FT                   YEKLFFKNQDRELIDEVMRLTNTLSLSNREIQTLSGGERTRSFLAMLLAQKSEFLFLDE
FT                   PLAALDIVYQFELMELISRLNKEFKVGIVLILHDINLAALYCDKIIALKEGRVIFNASK
FT                   QEFMKETILKDIFNINANIIEHPKRKSPIALF"
FT   gene            679161..679985
FT                   /locus_tag="JJD26997_0754"
FT   CDS_pept        679161..679985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="JJD26997_0754"
FT                   /product="FecB protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref