(data stored in ACNUC7421 zone)

EMBL: CP000769

ID   CP000769; SV 1; circular; genomic DNA; STD; PRO; 5277990 BP.
XX
AC   CP000769; AAWM01000000-AAWM01000016;
XX
PR   Project:PRJNA17729;
XX
DT   18-JUL-2007 (Rel. 92, Created)
DT   14-MAR-2015 (Rel. 124, Last updated, Version 5)
XX
DE   Anaeromyxobacter sp. Fw109-5, complete genome.
XX
KW   .
XX
OS   Anaeromyxobacter sp. Fw109-5
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
OC   Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5277990
RX   PUBMED; 25614562.
RA   Hwang C., Copeland A., Lucas S., Lapidus A., Barry K., Glavina Del Rio T.,
RA   Dalin E., Tice H., Pitluck S., Sims D., Brettin T., Bruce D.C.,
RA   Detter J.C., Han C.S., Schmutz J., Larimer F.W., Land M.L., Hauser L.J.,
RA   Kyrpides N., Lykidis A., Richardson P., Belieav A., Sanford R.A.,
RA   Loeffler F.E., Fields M.W.;
RT   "Complete Genome Sequence of Anaeromyxobacter sp. Fw109-5, an Anaerobic,
RT   Metal-Reducing Bacterium Isolated from a Contaminated Subsurface
RT   Environment";
RL   Genome Announc 3(1):0(2015).
XX
RN   [2]
RP   1-5277990
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Sims D., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A.,
RA   Fields M., Richardson P.;
RT   "Complete sequence of Anaeromyxobacter sp. Fw109-5";
RL   Unpublished.
XX
RN   [3]
RP   1-5277990
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Sims D., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Lykidis A.,
RA   Fields M., Richardson P.;
RT   ;
RL   Submitted (12-JUL-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 83f2d79c71970c039678a4e36887d7e8.
DR   BioSample; SAMN02598401.
DR   EnsemblGenomes-Gn; Anae109_R0001.
DR   EnsemblGenomes-Gn; Anae109_R0002.
DR   EnsemblGenomes-Gn; Anae109_R0003.
DR   EnsemblGenomes-Gn; Anae109_R0004.
DR   EnsemblGenomes-Gn; Anae109_R0005.
DR   EnsemblGenomes-Gn; Anae109_R0006.
DR   EnsemblGenomes-Gn; Anae109_R0007.
DR   EnsemblGenomes-Gn; Anae109_R0008.
DR   EnsemblGenomes-Gn; Anae109_R0009.
DR   EnsemblGenomes-Gn; Anae109_R0010.
DR   EnsemblGenomes-Gn; Anae109_R0011.
DR   EnsemblGenomes-Gn; Anae109_R0012.
DR   EnsemblGenomes-Gn; Anae109_R0013.
DR   EnsemblGenomes-Gn; Anae109_R0014.
DR   EnsemblGenomes-Gn; Anae109_R0015.
DR   EnsemblGenomes-Gn; Anae109_R0016.
DR   EnsemblGenomes-Gn; Anae109_R0017.
DR   EnsemblGenomes-Gn; Anae109_R0018.
DR   EnsemblGenomes-Gn; Anae109_R0019.
DR   EnsemblGenomes-Gn; Anae109_R0020.
DR   EnsemblGenomes-Gn; Anae109_R0021.
DR   EnsemblGenomes-Gn; Anae109_R0022.
DR   EnsemblGenomes-Gn; Anae109_R0023.
DR   EnsemblGenomes-Gn; Anae109_R0024.
DR   EnsemblGenomes-Gn; Anae109_R0025.
DR   EnsemblGenomes-Gn; Anae109_R0026.
DR   EnsemblGenomes-Gn; Anae109_R0027.
DR   EnsemblGenomes-Gn; Anae109_R0028.
DR   EnsemblGenomes-Gn; Anae109_R0029.
DR   EnsemblGenomes-Gn; Anae109_R0030.
DR   EnsemblGenomes-Gn; Anae109_R0031.
DR   EnsemblGenomes-Gn; Anae109_R0032.
DR   EnsemblGenomes-Gn; Anae109_R0033.
DR   EnsemblGenomes-Gn; Anae109_R0034.
DR   EnsemblGenomes-Gn; Anae109_R0035.
DR   EnsemblGenomes-Gn; Anae109_R0036.
DR   EnsemblGenomes-Gn; Anae109_R0037.
DR   EnsemblGenomes-Gn; Anae109_R0038.
DR   EnsemblGenomes-Gn; Anae109_R0039.
DR   EnsemblGenomes-Gn; Anae109_R0040.
DR   EnsemblGenomes-Gn; Anae109_R0041.
DR   EnsemblGenomes-Gn; Anae109_R0042.
DR   EnsemblGenomes-Gn; Anae109_R0043.
DR   EnsemblGenomes-Gn; Anae109_R0044.
DR   EnsemblGenomes-Gn; Anae109_R0045.
DR   EnsemblGenomes-Gn; Anae109_R0046.
DR   EnsemblGenomes-Gn; Anae109_R0047.
DR   EnsemblGenomes-Gn; Anae109_R0048.
DR   EnsemblGenomes-Gn; Anae109_R0049.
DR   EnsemblGenomes-Gn; Anae109_R0050.
DR   EnsemblGenomes-Gn; Anae109_R0053.
DR   EnsemblGenomes-Gn; Anae109_R0054.
DR   EnsemblGenomes-Gn; Anae109_R0055.
DR   EnsemblGenomes-Gn; Anae109_R0056.
DR   EnsemblGenomes-Gn; Anae109_R0057.
DR   EnsemblGenomes-Gn; Anae109_R0058.
DR   EnsemblGenomes-Gn; EBG00001445449.
DR   EnsemblGenomes-Gn; EBG00001445450.
DR   EnsemblGenomes-Gn; EBG00001445451.
DR   EnsemblGenomes-Gn; EBG00001445452.
DR   EnsemblGenomes-Gn; EBG00001445453.
DR   EnsemblGenomes-Gn; EBG00001445454.
DR   EnsemblGenomes-Gn; EBG00001445455.
DR   EnsemblGenomes-Gn; EBG00001445456.
DR   EnsemblGenomes-Gn; EBG00001445457.
DR   EnsemblGenomes-Gn; EBG00001445458.
DR   EnsemblGenomes-Gn; EBG00001445459.
DR   EnsemblGenomes-Gn; EBG00001445460.
DR   EnsemblGenomes-Gn; EBG00001445461.
DR   EnsemblGenomes-Gn; EBG00001445462.
DR   EnsemblGenomes-Gn; EBG00001445463.
DR   EnsemblGenomes-Gn; EBG00001445464.
DR   EnsemblGenomes-Gn; EBG00001445465.
DR   EnsemblGenomes-Gn; EBG00001445466.
DR   EnsemblGenomes-Gn; EBG00001445467.
DR   EnsemblGenomes-Gn; EBG00001445468.
DR   EnsemblGenomes-Gn; EBG00001445469.
DR   EnsemblGenomes-Gn; EBG00001445470.
DR   EnsemblGenomes-Gn; EBG00001445471.
DR   EnsemblGenomes-Gn; EBG00001445472.
DR   EnsemblGenomes-Gn; EBG00001445473.
DR   EnsemblGenomes-Gn; EBG00001445474.
DR   EnsemblGenomes-Gn; EBG00001445475.
DR   EnsemblGenomes-Gn; EBG00001445476.
DR   EnsemblGenomes-Gn; EBG00001445477.
DR   EnsemblGenomes-Gn; EBG00001445478.
DR   EnsemblGenomes-Gn; EBG00001445479.
DR   EnsemblGenomes-Gn; EBG00001445480.
DR   EnsemblGenomes-Gn; EBG00001445481.
DR   EnsemblGenomes-Gn; EBG00001445482.
DR   EnsemblGenomes-Gn; EBG00001445483.
DR   EnsemblGenomes-Gn; EBG00001445484.
DR   EnsemblGenomes-Gn; EBG00001445485.
DR   EnsemblGenomes-Gn; EBG00001445486.
DR   EnsemblGenomes-Gn; EBG00001445487.
DR   EnsemblGenomes-Gn; EBG00001445488.
DR   EnsemblGenomes-Gn; EBG00001445489.
DR   EnsemblGenomes-Gn; EBG00001445490.
DR   EnsemblGenomes-Gn; EBG00001445491.
DR   EnsemblGenomes-Gn; EBG00001445492.
DR   EnsemblGenomes-Gn; EBG00001445493.
DR   EnsemblGenomes-Gn; EBG00001445494.
DR   EnsemblGenomes-Gn; EBG00001445495.
DR   EnsemblGenomes-Gn; EBG00001445496.
DR   EnsemblGenomes-Gn; EBG00001445497.
DR   EnsemblGenomes-Gn; EBG00001445498.
DR   EnsemblGenomes-Gn; EBG00001445499.
DR   EnsemblGenomes-Gn; EBG00001445500.
DR   EnsemblGenomes-Gn; EBG00001445501.
DR   EnsemblGenomes-Gn; EBG00001445502.
DR   EnsemblGenomes-Gn; EBG00001445503.
DR   EnsemblGenomes-Gn; EBG00001445504.
DR   EnsemblGenomes-Gn; EBG00001445505.
DR   EnsemblGenomes-Gn; EBG00001445506.
DR   EnsemblGenomes-Gn; EBG00001445507.
DR   EnsemblGenomes-Gn; EBG00001445508.
DR   EnsemblGenomes-Gn; EBG00001445509.
DR   EnsemblGenomes-Gn; EBG00001445510.
DR   EnsemblGenomes-Gn; EBG00001445511.
DR   EnsemblGenomes-Gn; EBG00001445512.
DR   EnsemblGenomes-Gn; EBG00001445513.
DR   EnsemblGenomes-Tr; Anae109_R0001-1.
DR   EnsemblGenomes-Tr; Anae109_R0002-1.
DR   EnsemblGenomes-Tr; Anae109_R0003-1.
DR   EnsemblGenomes-Tr; Anae109_R0004-1.
DR   EnsemblGenomes-Tr; Anae109_R0005-1.
DR   EnsemblGenomes-Tr; Anae109_R0006-1.
DR   EnsemblGenomes-Tr; Anae109_R0007-1.
DR   EnsemblGenomes-Tr; Anae109_R0008-1.
DR   EnsemblGenomes-Tr; Anae109_R0009-1.
DR   EnsemblGenomes-Tr; Anae109_R0010-1.
DR   EnsemblGenomes-Tr; Anae109_R0011-1.
DR   EnsemblGenomes-Tr; Anae109_R0012-1.
DR   EnsemblGenomes-Tr; Anae109_R0013-1.
DR   EnsemblGenomes-Tr; Anae109_R0014-1.
DR   EnsemblGenomes-Tr; Anae109_R0015-1.
DR   EnsemblGenomes-Tr; Anae109_R0016-1.
DR   EnsemblGenomes-Tr; Anae109_R0017-1.
DR   EnsemblGenomes-Tr; Anae109_R0018-1.
DR   EnsemblGenomes-Tr; Anae109_R0019-1.
DR   EnsemblGenomes-Tr; Anae109_R0020-1.
DR   EnsemblGenomes-Tr; Anae109_R0021-1.
DR   EnsemblGenomes-Tr; Anae109_R0022-1.
DR   EnsemblGenomes-Tr; Anae109_R0023-1.
DR   EnsemblGenomes-Tr; Anae109_R0024-1.
DR   EnsemblGenomes-Tr; Anae109_R0025-1.
DR   EnsemblGenomes-Tr; Anae109_R0026-1.
DR   EnsemblGenomes-Tr; Anae109_R0027-1.
DR   EnsemblGenomes-Tr; Anae109_R0028-1.
DR   EnsemblGenomes-Tr; Anae109_R0029-1.
DR   EnsemblGenomes-Tr; Anae109_R0030-1.
DR   EnsemblGenomes-Tr; Anae109_R0031-1.
DR   EnsemblGenomes-Tr; Anae109_R0032-1.
DR   EnsemblGenomes-Tr; Anae109_R0033-1.
DR   EnsemblGenomes-Tr; Anae109_R0034-1.
DR   EnsemblGenomes-Tr; Anae109_R0035-1.
DR   EnsemblGenomes-Tr; Anae109_R0036-1.
DR   EnsemblGenomes-Tr; Anae109_R0037-1.
DR   EnsemblGenomes-Tr; Anae109_R0038-1.
DR   EnsemblGenomes-Tr; Anae109_R0039-1.
DR   EnsemblGenomes-Tr; Anae109_R0040-1.
DR   EnsemblGenomes-Tr; Anae109_R0041-1.
DR   EnsemblGenomes-Tr; Anae109_R0042-1.
DR   EnsemblGenomes-Tr; Anae109_R0043-1.
DR   EnsemblGenomes-Tr; Anae109_R0044-1.
DR   EnsemblGenomes-Tr; Anae109_R0045-1.
DR   EnsemblGenomes-Tr; Anae109_R0046-1.
DR   EnsemblGenomes-Tr; Anae109_R0047-1.
DR   EnsemblGenomes-Tr; Anae109_R0048-1.
DR   EnsemblGenomes-Tr; Anae109_R0049-1.
DR   EnsemblGenomes-Tr; Anae109_R0050-1.
DR   EnsemblGenomes-Tr; Anae109_R0053-1.
DR   EnsemblGenomes-Tr; Anae109_R0054-1.
DR   EnsemblGenomes-Tr; Anae109_R0055-1.
DR   EnsemblGenomes-Tr; Anae109_R0056-1.
DR   EnsemblGenomes-Tr; Anae109_R0057-1.
DR   EnsemblGenomes-Tr; Anae109_R0058-1.
DR   EnsemblGenomes-Tr; EBT00001823123.
DR   EnsemblGenomes-Tr; EBT00001823124.
DR   EnsemblGenomes-Tr; EBT00001823125.
DR   EnsemblGenomes-Tr; EBT00001823126.
DR   EnsemblGenomes-Tr; EBT00001823127.
DR   EnsemblGenomes-Tr; EBT00001823128.
DR   EnsemblGenomes-Tr; EBT00001823129.
DR   EnsemblGenomes-Tr; EBT00001823130.
DR   EnsemblGenomes-Tr; EBT00001823131.
DR   EnsemblGenomes-Tr; EBT00001823132.
DR   EnsemblGenomes-Tr; EBT00001823133.
DR   EnsemblGenomes-Tr; EBT00001823134.
DR   EnsemblGenomes-Tr; EBT00001823135.
DR   EnsemblGenomes-Tr; EBT00001823136.
DR   EnsemblGenomes-Tr; EBT00001823137.
DR   EnsemblGenomes-Tr; EBT00001823138.
DR   EnsemblGenomes-Tr; EBT00001823139.
DR   EnsemblGenomes-Tr; EBT00001823140.
DR   EnsemblGenomes-Tr; EBT00001823141.
DR   EnsemblGenomes-Tr; EBT00001823142.
DR   EnsemblGenomes-Tr; EBT00001823143.
DR   EnsemblGenomes-Tr; EBT00001823144.
DR   EnsemblGenomes-Tr; EBT00001823145.
DR   EnsemblGenomes-Tr; EBT00001823146.
DR   EnsemblGenomes-Tr; EBT00001823147.
DR   EnsemblGenomes-Tr; EBT00001823148.
DR   EnsemblGenomes-Tr; EBT00001823149.
DR   EnsemblGenomes-Tr; EBT00001823150.
DR   EnsemblGenomes-Tr; EBT00001823151.
DR   EnsemblGenomes-Tr; EBT00001823152.
DR   EnsemblGenomes-Tr; EBT00001823153.
DR   EnsemblGenomes-Tr; EBT00001823154.
DR   EnsemblGenomes-Tr; EBT00001823155.
DR   EnsemblGenomes-Tr; EBT00001823156.
DR   EnsemblGenomes-Tr; EBT00001823157.
DR   EnsemblGenomes-Tr; EBT00001823158.
DR   EnsemblGenomes-Tr; EBT00001823159.
DR   EnsemblGenomes-Tr; EBT00001823160.
DR   EnsemblGenomes-Tr; EBT00001823161.
DR   EnsemblGenomes-Tr; EBT00001823162.
DR   EnsemblGenomes-Tr; EBT00001823163.
DR   EnsemblGenomes-Tr; EBT00001823164.
DR   EnsemblGenomes-Tr; EBT00001823165.
DR   EnsemblGenomes-Tr; EBT00001823166.
DR   EnsemblGenomes-Tr; EBT00001823167.
DR   EnsemblGenomes-Tr; EBT00001823168.
DR   EnsemblGenomes-Tr; EBT00001823169.
DR   EnsemblGenomes-Tr; EBT00001823170.
DR   EnsemblGenomes-Tr; EBT00001823171.
DR   EnsemblGenomes-Tr; EBT00001823172.
DR   EnsemblGenomes-Tr; EBT00001823173.
DR   EnsemblGenomes-Tr; EBT00001823174.
DR   EnsemblGenomes-Tr; EBT00001823175.
DR   EnsemblGenomes-Tr; EBT00001823176.
DR   EnsemblGenomes-Tr; EBT00001823177.
DR   EnsemblGenomes-Tr; EBT00001823178.
DR   EnsemblGenomes-Tr; EBT00001823179.
DR   EnsemblGenomes-Tr; EBT00001823180.
DR   EnsemblGenomes-Tr; EBT00001823181.
DR   EnsemblGenomes-Tr; EBT00001823182.
DR   EnsemblGenomes-Tr; EBT00001823183.
DR   EnsemblGenomes-Tr; EBT00001823184.
DR   EnsemblGenomes-Tr; EBT00001823185.
DR   EnsemblGenomes-Tr; EBT00001823186.
DR   EnsemblGenomes-Tr; EBT00001823187.
DR   EuropePMC; PMC2687297; 19346346.
DR   EuropePMC; PMC2798628; 19897758.
DR   EuropePMC; PMC4319575; 25614562.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP000769.
DR   SILVA-SSU; CP000769.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002939
CC   Source DNA and bacteria available from Matthew Fields
CC   (matthew.fields@erc.montana.edu)
CC   Contacts: Matthew Fields (matthew.fields@erc.montana.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5277990
FT                   /organism="Anaeromyxobacter sp. Fw109-5"
FT                   /strain="Fw109-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:404589"
FT   gene            48..1430
FT                   /locus_tag="Anae109_0001"
FT   CDS_pept        48..1430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24221"
FT                   /db_xref="GOA:A7H675"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A7H675"
FT                   /protein_id="ABS24221.1"
FT                   /translation="MDSRASAKWIGPSDETALWARIDTYLRSRLRPDLYDRWFAPLRLV
FT                   SLEGGRLQIAAPDPFHRDFVEDNYRAFFEEFAPGILGRQLPIAFVVDSAPRVASPPAPA
FT                   AGPALSPVPRAAEPADPRESRPNPRYTFDTFVVGESNRFAFAAAQAVAANPGHTWNPLF
FT                   LHGDSGLGKTHLLHALAHAILDKQGGRVAIVSSERYTNDFVAALSKGTMDDFRRKYREC
FT                   TALLVDDVQFLAGKDKTAEEFFHTFNELHDHHVQIVLSSDRSPKELKGLDARLCSRFEW
FT                   GMRVQVEAPEFETRAAILQKKAEVESIDLPGDVTQLLAAHIRSNVRELEGALMRLAAFA
FT                   SLKSEPITVALARDVLSDVIPPEGYKPTIERIQEAVAAHYGLTVAKLTSSSREQKIALP
FT                   RQAAMYLCRELGKEKFQAIAERFNKKDHTTVIAAVERIRTLMETEEPVRSAVQVLTSKL
FT                   AP"
FT   gene            1847..2977
FT                   /locus_tag="Anae109_0002"
FT   CDS_pept        1847..2977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: ade:Adeh_0002 DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24222"
FT                   /db_xref="GOA:A7H676"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A7H676"
FT                   /protein_id="ABS24222.1"
FT                   /translation="MELKIGVAELAKALGRSQGIVEKKSTMPILSHVLLEAKGGHLVVS
FT                   ATDLDLAVSSEHGEHCEVLKEGALAVSARHLYEIVRALPEQQVTLKRAHNNYLEVRSGP
FT                   SEFRIVGLPAEDFPALPRFEKVTFSDVKPEDLLDMIERTFFAVSNDETRYNLNGVYFEP
FT                   GPEVLRLVATDGHRLSLSERSIGGTFGLKRGVILPKKGLHELRKLLGEAVEAGADAGET
FT                   KLGFVENSAIFRRPGVILSMRLIEGLFPDYRQVIPKQGEKVLRLGRDRFLETLRRVSLL
FT                   SSDKAHAVKLELGQGTLKVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYLMDVLGVVK
FT                   SAEVQLELADDLSPGVMRGGDEKDAGFTAVVMPMRI"
FT   gene            3076..4185
FT                   /locus_tag="Anae109_0003"
FT   CDS_pept        3076..4185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: ade:Adeh_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24223"
FT                   /db_xref="GOA:A7H677"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H677"
FT                   /protein_id="ABS24223.1"
FT                   /translation="MKLLSLAVQDFRNLAQVELLPSPRATVLLGENGQGKTNLLEAIYF
FT                   LTTLKPLRTARLAELVRHGAQTGLVAGDFDGPGGTRRVAVQVAPGGRVALLDGKPQERL
FT                   DAYFDGLAAVCFAPDDLLLVKGGPEGRRRFLDRAAFNRWPAVLGEAREYVRALRARNAA
FT                   LRGGSPEVEASFRGPLVRAGARIVRRRRDLVEELAPRVSTAFREISGPAAPEARFAYRP
FT                   AAGVQAEVGEAELAERLEHALAQRLERDRDRGFTSVGPHMDELVLALDGRGARAYASQG
FT                   QQRALVLALKIAEIENLRAALGRPPLLLLDDVSSELDPTKNRYLLAYLAALPAQAFLTT
FT                   TDRRLIEPAAGPDTAFYKVEGGMVSPLIS"
FT   gene            4373..6760
FT                   /locus_tag="Anae109_0004"
FT   CDS_pept        4373..6760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ade:Adeh_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24224"
FT                   /db_xref="GOA:A7H678"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A7H678"
FT                   /protein_id="ABS24224.1"
FT                   /translation="MLEGLEAVRKRPHMYIGDVGERGLHHLVYEVVDNSVDEAMAGRAN
FT                   EITVTIHADSSITIVDNGSGIPIGPHPSVKGMDTLDVVLTKLHAGGKFESNAYKVSGGL
FT                   HGVGVTCVNALSEWLKAEVYREGKVWLQRYDRGTPAGKVTAVGETQRRGTKITFKPDAT
FT                   IFEVTEFSFETLSGRLRELAFLNAGLTITIEDERSGKKHEFLFKDGIREFVGYLNKSRD
FT                   VLFQPPISLRQEVETERGTALVEIALQWNDGYDEKVFAFANNIHNHEGGTHLIGFKAAL
FT                   TRTINAYGQKNNLFKDLKDELPSGDDMREGLAAVISIRLPGASFEGQTKTKLSNTEAKS
FT                   MVETMLNERLGAFLEENPNVAKRVCAKVAEATRARIAARKARETVRRKGALDGASLPGK
FT                   LADCQSRDPRESELFIVEGDSAGGSAKQGRDRRTQAILPLRGKILNVEKARFDKMLSSA
FT                   EIATMITALGTGIGPEEYDVSKIRYHKIVIMTDADVDGSHIRTLLLTFFFRQMPELVEK
FT                   GYLYIAQPPLYRVQKGKKESYLKDEAALDDFLLQLGTEKAKLVAGDLVVEGADLKRLAQ
FT                   DAIRYRGLLARVDRRRDSRIVDAAVQLGDLDLELLKHHEQVKEQVQKIFDKAQKLHPEL
FT                   EVRLAKIERDEEHGCDALVFQTTMSGATRTTRIDFDYLSGPEWGELAGLYGELAELGAG
FT                   PHKLRTGDGEEEVDDVFGAVEVLKRAATAGQTIQRYKGLGEMNPEQLWETTMDHARRTL
FT                   LQVRVDDTVEADEVFSVLMGDAVEPRREFIEKHALDVQNLDI"
FT   gene            6778..7773
FT                   /locus_tag="Anae109_0005"
FT   CDS_pept        6778..7773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0005"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; KEGG: ade:Adeh_0005
FT                   3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24225"
FT                   /db_xref="GOA:A7H679"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A7H679"
FT                   /protein_id="ABS24225.1"
FT                   /translation="MPRAAFAALGTFVPDRVVTNEELTRLMETSDAWIQERTGIRERRW
FT                   VREGTENSDLALEATRRALDGAGWKASDIEAIVYASLSPDHMFPGDGCFLNAKLGIPGV
FT                   PALDIRNQCSGFLYGLSVVDAWIRAGVYRRVLLVGSEIHSTGLDVSTRGRDVAVIFGDG
FT                   AGAALLEATDDPGRGVLSVHLHADGRYAKELWTDAPGSKYHPRVQPAHIESGAVYPHME
FT                   GQKVFKHAISKMPEVVRTALERNGLTTRDLKLLVPHQANLRISQMVQRSLELSDEQVFN
FT                   NIQKYGNTTAGSIPIALAEGIETRGVKRGDLVGLCAFGAGFTWGSALVRW"
FT   gene            7872..7945
FT                   /locus_tag="Anae109_R0001"
FT                   /note="tRNA-Gln1"
FT   tRNA            7872..7945
FT                   /locus_tag="Anae109_R0001"
FT                   /product="tRNA-Gln"
FT   gene            8017..8514
FT                   /locus_tag="Anae109_0006"
FT   CDS_pept        8017..8514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0006"
FT                   /product="peptidase zinc-dependent"
FT                   /note="PFAM: peptidase zinc-dependent; KEGG: ade:Adeh_0006
FT                   Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24226"
FT                   /db_xref="GOA:A7H680"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A7H680"
FT                   /protein_id="ABS24226.1"
FT                   /translation="MPLGGVGSKIVAQAAHALREALGIGAKGGPSLDRPRYAFNEARGQ
FT                   YHATSILRRLASLRGGAGGPPVVGIADVDLFLPDAPYVIGDADRDAGAALFSLARLSQG
FT                   EPEQLLRRAQVETVHATGHLLGLSHCADYRCAMFVSRDAADSDRKGPGLCASCRASLGA
FT                   GA"
FT   gene            8722..9318
FT                   /locus_tag="Anae109_0007"
FT   CDS_pept        8722..9318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24227"
FT                   /db_xref="UniProtKB/TrEMBL:A7H681"
FT                   /protein_id="ABS24227.1"
FT                   /translation="MRICPLLGFLDAEETRVGCLAHPLATGGADLRDCGAYDVATCDAF
FT                   LCPSHAFLSEEEAAILDGALAGDFHLYGLVVTDVPFLRAALAGVSARTGAKVELRQLAH
FT                   AAFRAALRRLLALKEELAPGSDGLFGAFRPGKNGEDLPRRIDYDALGSAPSPYDEILTC
FT                   VGADPRSGNDLEALEGEVARRLDAAAAAFPVPARR"
FT   gene            complement(9352..10266)
FT                   /locus_tag="Anae109_0008"
FT   CDS_pept        complement(9352..10266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0008"
FT                   /product="Haloalkane dehalogenase"
FT                   /EC_number="3.8.1.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: jan:Jann_2625
FT                   alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24228"
FT                   /db_xref="GOA:A7H682"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H682"
FT                   /protein_id="ABS24228.1"
FT                   /translation="MERLPAPPLPPFLARALPFERSVVVAGGLALHVMESGPAAAPTVV
FT                   LLHGNPTWSFLWREVALRLRDAPLRLVMPDLPGLGLSEKPRDPRFHTLERHARVMGALL
FT                   DAAAPGRFVLAVHDWGGPIALAALADRPGRLAGLVVTNTGVGPPRPGARKTAFHRLANL
FT                   PVLSTILFRLLGFPQNALHLAQADRRSIRGDVARAYRWPLRRLRDRAAPLALARMVPLS
FT                   PGHPSMPFLERALGVATAFDGPAAVVWGERDPVLGRALRGVASALPAARVTRLPAGHTP
FT                   QEEAPGPIADAIRDVARRAGFLR"
FT   gene            complement(10274..12310)
FT                   /locus_tag="Anae109_0009"
FT   CDS_pept        complement(10274..12310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0009"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: ade:Adeh_0008 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24229"
FT                   /db_xref="GOA:A7H683"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A7H683"
FT                   /protein_id="ABS24229.1"
FT                   /translation="MGPFLTAAMLLVGLALFAFTMLGRIVPLLALRRDDRLSRTGERVA
FT                   ALLRYGFGQRRLVDPEERGPGVLHVLVFAAFLVLALRTITLFGMGFTEGFHLPLLGPES
FT                   PLGRVYGFLKDLVLLGALVGVAGFLWRRLVTKPDRVTLSTEGVVILLFIGGLMVTDLLF
FT                   EGSVLLARGEHGSAWEPAGALGRALLAPLAPGPARAIGVLSFWLHLAIILVFLNVLPFG
FT                   KHFHIITGLPNVFFARLSPTGALRKLELEAEDASYGAATVKDLSWKEAWDVYSCTECGR
FT                   CQTHCPTYVTGKPLSHKEVNRTIRHHLLDVAPALAAAARAKEPAAREAALGALPPIASV
FT                   VPPETFWACTTCGWCETACPVLIENVPRLVDMRRQQVLVESSFPDEAARVFKGIETQGN
FT                   PWGIGSNKRAEWCEDLDVPRASSGEPFEWLFFVGCAGAFDDRQKKVSRAIVRILREAKV
FT                   SFAILGEEETCNGEAARRLGNEYLFQLQAQANVETLNGYGVKKILVQCPHCLNTLENEL
FT                   PQFGGRYEVVHHAELIARLVAEGRLTPAAAEGLGTITFHDPCYLARWNGVTEAPREALG
FT                   AVPGLKMVEMPRNRRQGFCCGAGGGRFWLEEKLGTRVNQHRVDEAAATLGEAGGVVATG
FT                   CPFCLTMMKDGVNETGREERLRVMDVAEIVALGLPGARAPREG"
FT   sig_peptide     complement(12254..12310)
FT                   /locus_tag="Anae109_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.504 at
FT                   residue 19"
FT   gene            complement(12461..13609)
FT                   /locus_tag="Anae109_0010"
FT   CDS_pept        complement(12461..13609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24230"
FT                   /db_xref="UniProtKB/TrEMBL:A7H684"
FT                   /protein_id="ABS24230.1"
FT                   /translation="MKRLLLLVAAAALASGCVVHSGASRPIYTPPPPPAPAPPPVVSYW
FT                   YHGQHFVPDDLGGGWCYGEGPHQHDYAPHRADWYDLHEGYYYFNGPYVFAYHGGHPVPG
FT                   RGWCYVRGPHTHEYFPPQGTDFAWNRGRGWIYRGGWRPNRPPPPSYWPVVRAPRPSPRP
FT                   AHYDDPRPAPAPARPVYDPRPAPAPYPRPAPTPPRPSPGYERPVPAPAPYPVPSRPGPG
FT                   HSDDAPGHGNLPPGHGGTPPGHASPAPQPPRPPAPVPTTPGRGGEAPGHGGTPPGHAAP
FT                   PPAHGRPDRAVPPSSTPSPGNSGDARGHGGTPPGRAAPPPAQGGRDGAEPRGNGNGKGN
FT                   REGNGRGNGRGRGQREDDDDRREGEQEQGERDGRPARGDGRR"
FT   sig_peptide     complement(13544..13609)
FT                   /locus_tag="Anae109_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.767 at
FT                   residue 22"
FT   gene            complement(13831..14499)
FT                   /locus_tag="Anae109_0011"
FT   CDS_pept        complement(13831..14499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0011"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ade:Adeh_0010 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24231"
FT                   /db_xref="GOA:A7H685"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H685"
FT                   /protein_id="ABS24231.1"
FT                   /translation="MPPRTPPVEPIPLVLYEDPLSPWCFVAEKRIAAALADLAAAYAPL
FT                   RHEPFPLRVEPRAMSRAERERLARAARKAAKEPEARGITPDLWLSTDPPLSSIPPLAAL
FT                   AAARLQGDAREEALRTLLRQAALFRGVNVSRTDVLYELAERAGLDVSRFACALATPWTE
FT                   RRVRARYEEAVDRGVDVAPALVVGEEWLIAGPRSADEYREILERYAQVRHGLPLARVLH
FT                   "
FT   gene            complement(14588..15577)
FT                   /locus_tag="Anae109_0012"
FT   CDS_pept        complement(14588..15577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0012"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: ade:Adeh_0011 S6 modification
FT                   enzyme RimK"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24232"
FT                   /db_xref="GOA:A7H686"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:A7H686"
FT                   /protein_id="ABS24232.1"
FT                   /translation="MPPPRKIGARPRARRRRVSASTEGLGVVVLSRNPKLYSTRRLVEA
FT                   VGALGHLPRVLDTLRCNMVLGRDRPRMFYAGEELLATDVHVAIPRIGASITGYGLSVVN
FT                   QLDMMGVPVLNNAIPIARSRDKLRALQLLSRFGLDIPRTVMCRYRDEVPQAVEMVGGLP
FT                   CIIKLIQGTQGVGVMIAHTSAEVEGMLDTLWTLGQEILLQELVAESRGKDVRALVVGDH
FT                   VVAAMRRTARAGEFRSNIHRGGVAEAVELDREFAEVAVKAARVMGLEVAGVDMLEARTG
FT                   PKVMEVNSSPGFEGLEAATGVDIATAYVSHAIEFGHARLSGSTGGRLV"
FT   gene            15695..18538
FT                   /locus_tag="Anae109_0013"
FT   CDS_pept        15695..18538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0013"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   ade:Adeh_0012 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24233"
FT                   /db_xref="GOA:A7H687"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A7H687"
FT                   /protein_id="ABS24233.1"
FT                   /translation="MDYKDTVNLPKTPFPMKANLPQREPEILRGWEEQAIFQRLVASNA
FT                   ERPGAKRFVLHDGPPYANGDIHIGHALNKILKDVVVKYRNLKGEVADYVPGWDCHGLPI
FT                   ELKVDKELGPKKRDMDRAQVIEACRAYARKWIERQREAFKRLGVFGRWDDPYTTMSKGY
FT                   EAEIVRTLARAAEKGFLYRGKKPVYWCVTDRTALAEAEVEYEDHTSPSIYVALDLVSPL
FT                   PDAKLAGRKARLVIWTTTPWTLPANLAVAAHPEFDYVAYELGGEVLVVAKDLLARFLAD
FT                   CAPGELAVSDAPAAHTPDAHAAATGGGGVAPSARLVHPERVLAHLDGKALEGLRYRHPF
FT                   MGRESPVILGEHVTLEAGTGLVHTAPGHGAEDYQVGLAYGLEVLNPVDGAGRFTAEAGK
FT                   YAGKKIFEANPEIVADLHASGHLLSDPKASLRHSYPHCWRCHNPVVFRATDQWFLSLEH
FT                   AGLRRQALAEIDRVRWIPRWGRERIYGMIENRPDWCLSRQRTWGVPIPVFYCEGCSEAL
FT                   VSPSVMERVAEAFEREGIEAWYRHAPADFTGGERCPACGEGEFRREQDILDVWWDSGVS
FT                   WAAVAEKRGLGVPVDLYLEGSDQHRGWFHSSLLTSVATRAHAPYRAVLTHGFVLDGQGK
FT                   AMSKSLGNTVAPDEIIKKYGADILRLWVSASDYRDDVRISSEIVSGLAEGYTKIRNTVR
FT                   YMLGALDGFDPSRDAVPLDELEPLDRWALAKLAAWDEKVKAAYEEYEFHLAYHATMQLC
FT                   AVDLSALYFDIIKDRLYTWKKDGKPRRSAQTALWLVCQDVLRLLAPVLSFTASEAWGHL
FT                   PGKPAESVFLAGLPTRARPADADALEARYGKLFEVRAAVQKKLEEARRAGLIGKSLEAA
FT                   VTVRAEGETRALLEEAKAELPTLFIVSRVTLADGPSGVEVERAPGEKCERCWIYAADRG
FT                   ADPAHPTLCGKCADAIR"
FT   gene            18535..19170
FT                   /locus_tag="Anae109_0014"
FT   CDS_pept        18535..19170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0014"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: ade:Adeh_0013
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24234"
FT                   /db_xref="GOA:A7H688"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H688"
FT                   /protein_id="ABS24234.1"
FT                   /translation="MSARRPFSKWALLALLFVTLVAIDQWTKYLAVERLTTLFERTGAE
FT                   TLGERLAGFLEHQHLEPISTDPYYVWRPVWRMNYVENPGAAWGLFRGHSEAFRNGFFTL
FT                   VSLGAVAFILHYYRKLRAEQRYLQVALALVLSGAVGNFLDRLARGYVIDFIEWYWWNRP
FT                   DIRWPTFNIADSLIVVGVALLVLHPGSGKAAQKAGADAEGDRRASTGG"
FT   sig_peptide     18535..18603
FT                   /locus_tag="Anae109_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.859) with cleavage site probability 0.752 at
FT                   residue 23"
FT   gene            19203..20285
FT                   /locus_tag="Anae109_0015"
FT   CDS_pept        19203..20285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0015"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: ade:Adeh_0014 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24235"
FT                   /db_xref="GOA:A7H689"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A7H689"
FT                   /protein_id="ABS24235.1"
FT                   /translation="MHPELLQLVVPEGLGALVALAVLVIFVVGRAAARLREARRAEEPL
FT                   PVVAAFRADWPTSAALAAAALWLWRAGALDRELRLSLHSYGVLIAAAFLSGIWLAQREA
FT                   RRCGLEAGRIADLAFWVLVAALVGSRVYFILVNWGEYFGPGRFLLATPVGRIPRVLAVW
FT                   EGGLVFYGGFIGAALAAALYMRRHRMPFLAYADVVIPSVAFGHFLGRLGCFAAGCCWGG
FT                   LAGEHLPWAARFPPESLAYRTFLDRPDPAQYLAPGGATTLPLHPTQLYEAFGELALFLV
FT                   LVLVVRPRKRFHGQVLASWLLAYAVLRTGVELFRGDVERGVYLGLGAGQWTSFALLAAG
FT                   AAVWVSARKTRPAPAAAGAP"
FT   gene            20330..21043
FT                   /locus_tag="Anae109_0016"
FT   CDS_pept        20330..21043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24236"
FT                   /db_xref="UniProtKB/TrEMBL:A7H690"
FT                   /protein_id="ABS24236.1"
FT                   /translation="MSLPKPPARPGAPLAKGALGAEDPLARSRRDKDELAESVKTLEEE
FT                   LEALKARYEQYFLGIERREPVRWREELKRNVARVKGAFTRNAALRFRIQTLNARYLSYE
FT                   RLWLRGAREREEGTYRRDLFKARLHARADEGRGQAADAAPAASAEAKPSATPAPRPTPA
FT                   PGGVDEAKLRALFDDYVAAKRRCNEDVSRLTYEAVARSVAKQVPDLMARFQAKSVDFRV
FT                   EVKDGRAVLKAIPKV"
FT   gene            21289..21699
FT                   /locus_tag="Anae109_0017"
FT   CDS_pept        21289..21699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24237"
FT                   /db_xref="UniProtKB/TrEMBL:A7H691"
FT                   /protein_id="ABS24237.1"
FT                   /translation="MPRGPWEEVRLRTLALAAAVSLLAACGASKELEVQRARLHAERRA
FT                   LEATFDHLEDRLLVNQARVRFWQEMRERHEGVTAVACTSLEQHAEEIARRMAPPPARQA
FT                   SAVRTSLHESRVAARAVPRAEPSPAARAARSE"
FT   sig_peptide     21289..21381
FT                   /locus_tag="Anae109_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.864) with cleavage site probability 0.287 at
FT                   residue 31"
FT   gene            21809..21881
FT                   /locus_tag="Anae109_R0002"
FT                   /note="tRNA-Phe1"
FT   tRNA            21809..21881
FT                   /locus_tag="Anae109_R0002"
FT                   /product="tRNA-Phe"
FT   gene            22419..24473
FT                   /locus_tag="Anae109_0018"
FT   CDS_pept        22419..24473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24238"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A7H692"
FT                   /protein_id="ABS24238.1"
FT                   /translation="MRRSSVLMAALALALAACGPPERSDERTSSSAPVEAAAAAKQIEL
FT                   TSYTYGKIDGQLADQLVKVFSPKKWRGETDGPVLLSGASLATLTDDQKAALKTILKEGH
FT                   AILITGVTQEQLVRAHDLIAQKYPSIKLSGTTPAELYVLAYPQERVRTLAIRSVSPGRL
FT                   PWDSEKRYAAHAKAVAEWFQEHVRGTQPVAMAVAADSNYNVLPTDSTQFPFMHSHQYEM
FT                   AAYYNGTCKTTDSCINIVKTNLYAWAVHNPLPSTSEQPTDYIVARVTGDINVSDCVLPL
FT                   GGDGDRFAGYWLQQANFSAHIPDMTVSGYRLVDGVLLGDTAPGNANPDVTVNKGVSFSF
FT                   GGSGTIGSSAGFSGAKPSAEVSKSLGFNFGVTYTNETQTTYKAMQTIAKVPADASNPSK
FT                   VLWTWDSWRFVEDNIKPANHACGGPGLLKENLPSIIYGGGLSGADASQAEFVWALKPDV
FT                   RRALGTNVNDGYTYLPVQVDTSMLLGWAFFWQDIGYCSESDASATGYHYKLGGKSIDIV
FT                   GTTSSPFATAPNNTALYAGDGLAFDSGCGTAVNFGTIPLGNRLSCDGNHPCLNPGPPFA
FT                   FEPMEVTIPLAPDPRRMTLTSIEPTAGPMGARITLRGTALNTATYVYIGGQPAPASLEF
FT                   ENGVPVITTVAPALNYPAGYTVRIEVQNAVVTSQDFDFTYTGMPPAPDD"
FT   sig_peptide     22419..22493
FT                   /locus_tag="Anae109_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.694 at
FT                   residue 25"
FT   gene            24758..26290
FT                   /locus_tag="Anae109_0019"
FT   CDS_pept        24758..26290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0019"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: Thrombospondin type 3 repeat; OmpA/MotB domain
FT                   protein; KEGG: ade:Adeh_3747 outer membrane protein,
FT                   OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24239"
FT                   /db_xref="GOA:A7H693"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A7H693"
FT                   /protein_id="ABS24239.1"
FT                   /translation="MNIVRSFVTLLSVALASAAAAQESFELERLQLDPAARGSLVVGDG
FT                   EVAPAGTVRGVAAFDRQHRSLVTRGDDLLGRRDDRGWAAVVEDRDTLRLTLDYVVLPRV
FT                   ELYGRVNFVMNQGEGLQAASSGFGATSFGLRLGALQQASGAPFNLALAGEFFAPWGTRS
FT                   IFAKPANPAGLFRLELGRDFGKNTVGVEGGYYLTDEQLVGSRTVGSEIRYGVVLARKGV
FT                   IRPELSYRGAVGVDGERGPAYGEVLAGLRFNIGPVEVFGLGGPGIFNRYGTPQWRALAG
FT                   FALRFERQEKAEEPAPAPEPAPAAAPPPPPPADPCAPGQAHTPDQCPDLDDDGDGVANR
FT                   DDECPSEQGLAELKGCAAKDGDGDGVPDHQDKCPAEAGSADNEGCPRVVVEKEAKKVEL
FT                   REKVQFDTGKATIKPESAGLLDEIAKVLAEHAEITRVVIEGHSDSSGGAALNKRLSQAR
FT                   ADAVLKALVERGIAKERLSAKGFGPSRPIASNDTPEGREANRRVEISIAQSE"
FT   sig_peptide     24758..24823
FT                   /locus_tag="Anae109_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.950 at
FT                   residue 22"
FT   gene            26540..27934
FT                   /locus_tag="Anae109_0020"
FT   CDS_pept        26540..27934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0020"
FT                   /product="Stage II sporulation E family protein"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: mlo:mll6700
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24240"
FT                   /db_xref="GOA:A7H694"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A7H694"
FT                   /protein_id="ABS24240.1"
FT                   /translation="MHSEVVQNLLVLLAGAALINTGFAAALWRSTRDPLFRMLFVAWAS
FT                   VIASALLQSALTQNHLAVTLGFASVFVNNAAFAQLLASVAEVAVPWRRLVLLLGGGLAC
FT                   SVLAAAAGAPFVVVAGPTAVAVAAPSLAVGLDVIRHRWTTLHAQGRALALACILFSAHN
FT                   LDYVFLRGREGLAPVGFTVAFLVIFAISISAPAALLEVVTKRQARLAAQIEIARTLQAR
FT                   LVPPDSRLERFEFACHMRQADSVGGDYLHHFETEDSEWFFAGDVVGHGFHSGLLALMAH
FT                   SALSSIIEARPEVSPRELNHLVNRVLWRNLAQLEDRRFMTIVAIRRDARGDRLVVSGCH
FT                   EDLLVYRAASKEVQTLEVQHLPLGVGFTPDLPLERIGDATLELRPGDLVFVGTDGVFEA
FT                   ARHGRHELGLFGPEPVVELLSRCGDEPLGELRRRLVERLDEFTDGRYADDVAFFMLRAR
FT                   APGAPA"
FT   sig_peptide     26540..26614
FT                   /locus_tag="Anae109_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.836 at
FT                   residue 25"
FT   gene            28021..28587
FT                   /locus_tag="Anae109_0021"
FT   CDS_pept        28021..28587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24241"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H695"
FT                   /protein_id="ABS24241.1"
FT                   /translation="MVFSGDTYDLDRKIEPWPHRFLMGFAGDELAAVCGLYVRNTYVER
FT                   FGRVTDDEVAGHVRALGLEDRYEPAARRELTKLVVAPRLRNSGLGPLFVAIAHARAFVE
FT                   LDAARPPLVTFCVVRSMRRLVERHGIRPRHLKPFPHYKVHELYRSERNPMDSYLVVPHL
FT                   DVPTAFRDLRIPGEHELDPWLGDER"
FT   gene            28584..29123
FT                   /locus_tag="Anae109_0022"
FT   CDS_pept        28584..29123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lil:LA0092 sensory transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24242"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H696"
FT                   /protein_id="ABS24242.1"
FT                   /translation="MSTPTVLGAFPEVTPPPLSAIELEVFPIDLVTEWRRCGMIADFMA
FT                   DYMGQGFERPDTARSVLSTVMNELVENAAKFSADARAPARASIRHHGEVVHLEIQNEAT
FT                   EQHLQSLRDLLPALARGDAADVFHRRVQDRRGLGIALLAKDYGATVGATVLPAQAGGRV
FT                   TVCLRVELSAAEVEQR"
FT   gene            29120..29461
FT                   /locus_tag="Anae109_0023"
FT   CDS_pept        29120..29461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMb20452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24243"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A7H697"
FT                   /protein_id="ABS24243.1"
FT                   /translation="MKPNKADYSVEAGPSPGTWLLRGVMRLESPEAYARAFEPLIASLG
FT                   RGPAISIDLTQVAFLNSSGIRALADVLLQARDKRCQVKLFGSAAVPWQKKLASSLTALF
FT                   PEIVMRVDR"
FT   gene            complement(29495..29737)
FT                   /locus_tag="Anae109_0024"
FT   CDS_pept        complement(29495..29737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0024"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ade:Adeh_2436 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24244"
FT                   /db_xref="GOA:A7H698"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7H698"
FT                   /protein_id="ABS24244.1"
FT                   /translation="MSRRAYLTRSLHMPALADKFALNLKSERLRRKLSQEALATKARLS
FT                   VSYISMLERRQRTPPLETLECLAKALAVSPTSLLE"
FT   gene            complement(29822..30547)
FT                   /locus_tag="Anae109_0025"
FT   CDS_pept        complement(29822..30547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0025"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ade:Adeh_2435 putative transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24245"
FT                   /db_xref="GOA:A7H699"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H699"
FT                   /protein_id="ABS24245.1"
FT                   /translation="MRAIRWDHPDAFDDVLLLVAPDDAHRRVLRERLAQVRGREQPGER
FT                   GLHPRFKIVAVPGGRESLRRAGGVTIAMVNLELPKGPGLETIRELREAREDLAILAYAT
FT                   TAGASDAMAAVMAGADFFFDCRDESSAALAHVVDLAIERRRLTHTIEKQEADVEEARGR
FT                   LAQLAGELVGTMPGLWPLHSREDVLPFREAARRYLLAATRFFARDPRGLAKALGVSYFS
FT                   LRRLLARYDVPFPAARPRK"
FT   gene            30632..33085
FT                   /locus_tag="Anae109_0026"
FT   CDS_pept        30632..33085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0026"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   chu:CHU_2794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24246"
FT                   /db_xref="GOA:A7H6A0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A0"
FT                   /protein_id="ABS24246.1"
FT                   /translation="MRGPHQLEFRETAQSPRPRPAGPPGFEHAPPDPDRVLRPGHEGNR
FT                   WRPEAFAAGDPAARERLAARVVEGGLAVHDTLREQLVELLETREPARELEPAELGERLA
FT                   AHLEGAPLAHHGTWFLYPWSRRVVHVLPEDEFRELRASRNRNKISSEEQERLRALRLGV
FT                   IGLSVGSASAVALAMEQVGGELYLADHDRLSLSNLNRLRAGVHEIGLPKAVLTARAIAE
FT                   LDPYLRVRPFLDGITDGNMDAFLRPGGRPLDLLVEECDDLYVKVRVREAARALRIPVLM
FT                   ETSDRGLLDVERFDLEPGRPVLHGLVGAIDAERLRGLDTSEKVPIVLRILGERSISPRL
FT                   AASLVEVKATLKTWPQLASAVSLGAAVVTDAARRIALGQLTSSGRFYVDLDELVRDGAG
FT                   AALPGLQDPPPAQVEAACAAAPAPVAPMVVRSRAALDAQRVRELVWLATLAPSGGNCQP
FT                   WRFSWDGKRLRLVHDAARSRSFLDHRDLASWLAFGAAVENVALAAAAMGLDAAVELRPD
FT                   PGDPAAVCDLRFAATGGAAPASVVALAAAIPERVTNRKLAPRAPLARHAHDLLLRVAAE
FT                   VPGAALHLVEDPERLAALGEVLGRGDRLRFLSRTMHREMMGELRWSAEEARATRDGLDV
FT                   ATLELSGADQAGLRVMSSWAAMELVGRLGGGRALEKPAARAMAAASAAGLVSVPEHTRE
FT                   AYFAGGRAMQRVWLQATVLGLAFQPMTPLTYLFARLASGGGEGLTPAEATTLRELRGRL
FT                   DRLFPDARGRGEPMLFRLAVAPPASARALRRGVEEVLEVDPSAETRAGPLRAAPFTSAT
FT                   HRRAG"
FT   gene            complement(33104..35857)
FT                   /locus_tag="Anae109_0027"
FT   CDS_pept        complement(33104..35857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0027"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ade:Adeh_3529 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; GAF domain protein; ATP-binding region
FT                   ATPase domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24247"
FT                   /db_xref="GOA:A7H6A1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A1"
FT                   /protein_id="ABS24247.1"
FT                   /translation="MEPGPVPTATDTDPLLDILFAHAGIGLCLVAPDGRVVRANGDWLR
FT                   AMGLSSQAVGEDVLALLGEDGGLTSLLERARRGEPVELPSRRRIDQHGRSTCWEGRLVP
FT                   VPTRLGAGVLLTAREVPGALARERGSEPERSRSGATPTAERLARERAELLASMAQDLSG
FT                   GADLDAVLRAAVERGTELLGGVDGAFLLLEPDGRHARVHSEAWKLGRTGTVLDVDAIPA
FT                   GRAALAERRPRFVSGGHGQGEGLAWLKSRGARSWLIAPVSVQGQRLGLLYVARAEGDRP
FT                   PQPDLDFAEAIANHAALAITRARGSQALRRSEERFRTLAEHAPDVITRFDRDMRLLYAN
FT                   AALGRVTGIPAAHVTGKTSAELELPADLVACLEAGLARVFETGEPRTLEFRFDGPHGTG
FT                   YHEARLAPEPGEDEGVASVLAVTRDITERKHAEHSLREAEERARARADELEAVLDAVPA
FT                   AVCITRERDARHVEANNLCRELLRLPPAVNLSRTVPGDGAPSFRAMKDGVEIPAHELPL
FT                   QVAAARGVEVRNHEFSLVFADGTRRHVLGNAAPLRDELGDPRGAVVALVDITERRRDED
FT                   ALGASRASRARAEAGRGGARLVDDLLDVTRISRGKIQLRRTLVDLAGIVRRTVDDHAAL
FT                   FAQQELGLRVSGADRPLWVDGDRTRLAQIVGNVLVNAAKFTGAGGRVEVEVAAEDDARA
FT                   RVTVRDTGVGIAPRLLGRVFEPFIQAEDSLHRSRGGLGLGLALVKGLVELHGGTVEARS
FT                   EGIARGAEFTLRFPRCADAPSGSVRDEEPAAAARPRRVLIVEDNLDAAETLCLMLEMCG
FT                   HEVGVAHDGHGAMEQVRAFRPDVVLCDIGLPGMDGYEVARAIRSDLALADLPLVALTGY
FT                   ALPDDQRRAIEAGFDRHLAKPVSSDELQRVIGALSARAPGLTPARA"
FT   gene            complement(36003..36938)
FT                   /locus_tag="Anae109_0028"
FT   CDS_pept        complement(36003..36938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0028"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pol:Bpro_2819
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24248"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A2"
FT                   /protein_id="ABS24248.1"
FT                   /translation="METWNRSLTRRRFLGRLGLAAAAAAAASPPRAEAGASRSVVKKKI
FT                   PSSGEAIPVVGLGTSRTFDAPPGAERAALAPVVQAFFDHGGALLDSSPMYGRAEEVVGE
FT                   LLKTTRHGQVFAATKVWTDGKQAGVDQMERSRRLWGVPRLDLIQIHNLRDWQVHLATLK
FT                   EWKAAGRIRYLGITTSHGRMHEELEQALRRERFDFVQLSYNLEDREVESRLLPLAAERG
FT                   VAVLVNRPFQLGGLFDKVRGKPLPPWAKELGIASWAQYFLKFAVSHPAVTCAIPATSKV
FT                   KHLVDNMGAAHGLLPDAAARERMVRFVESA"
FT   sig_peptide     complement(36840..36938)
FT                   /locus_tag="Anae109_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.523 at
FT                   residue 33"
FT   gene            complement(36914..38260)
FT                   /locus_tag="Anae109_0029"
FT   CDS_pept        complement(36914..38260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0029"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mxa:MXAN_0532 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24249"
FT                   /db_xref="GOA:A7H6A3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A3"
FT                   /protein_id="ABS24249.1"
FT                   /translation="MAAPARAAASALHVRLTRLVQVEPGEVRALLWSFAYFFSLLCGYY
FT                   IVRPMRDAMGIAGGVEQLHWLFTGTFVAMLAAVPLFGWVTSRFPRRRFLPLVYYFFIAN
FT                   LLVFYALLAGERGGVHAARAFFIWTSVYNLFVVSVFWSFMADLYTNAQARRLFGFIAAG
FT                   GTIGALVGPALATALARPLGNASLLLLSAGFMGVAVLCVHRLIAWKDRQRAAAPGQARA
FT                   AEARPLGGGVLAAVPLVLRSPYLLGIALFMLLFTTASTVLYFQQAEIVRDAFASAAERT
FT                   AVFGAMDLAVNALTVGVQVLLTGRLVRVLGVAGTLALVPALLGLGFLALAFAPVLPVIV
FT                   AVQVLRRAGDYAVTRPARELLYVVLGREEKYKAKSFVDTVVYRGGDALSAWAYAGLRAL
FT                   GASLGAIAWLAVPVAGCWAWLAYRLGRRQEALAATSTEGGAEWRPGTAP"
FT   gene            complement(38391..39773)
FT                   /locus_tag="Anae109_0030"
FT   CDS_pept        complement(38391..39773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0030"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mxa:MXAN_0336
FT                   sensory box histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24250"
FT                   /db_xref="GOA:A7H6A4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A4"
FT                   /protein_id="ABS24250.1"
FT                   /translation="MPSRPVAGFVAAITAIVLALAVYLAVAISRQANAARAAESTRAVL
FT                   ALERLDASMREAESSHRGYLLDGSAAELARHERAVSEIRAHLAALTARAEREPALRART
FT                   EALVAGADAALATMRAERDARDGALVGGAPWHAVADPGLLDGMDRVRAGLVAVERDALE
FT                   RREQAWSGKTALGDAVFLVANLALAAVLLFAATSVRRALAAHEARERERHVALEAQARM
FT                   FGIVGHDLRTPLSAIEAGATLLSRRSLAPAEARTLARILASSRRMARMIGDLLDFTRVR
FT                   DAGGIPLAPRATDLREVCRPVVEEVRLRHGADAVALSLDGHLDGNWDPDRLQQAIGNLV
FT                   SNALQHQPTGAPVRLRAIGDHDAVCVEVENDGPPIPAEAARAIFEPFRRGDARQAGADG
FT                   LGLGLFIVRTIVEAHGGNVEVASGPDRPTTFTVRLPRGRPRERHAWAGSGLKAPAPPFD
FT                   AG"
FT   sig_peptide     complement(39669..39773)
FT                   /locus_tag="Anae109_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.808 at
FT                   residue 35"
FT   gene            complement(39892..41343)
FT                   /locus_tag="Anae109_0031"
FT   CDS_pept        complement(39892..41343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0031"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mxa:MXAN_0292 drug resistance transporter, EmrB/QacA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24251"
FT                   /db_xref="GOA:A7H6A5"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A5"
FT                   /protein_id="ABS24251.1"
FT                   /translation="MDGTLRYGSRAGRGVLLVAVLGSGLAFLDATVVNVILPVLGRELG
FT                   ASLGALQWTLDAYLLTLSALLLPAGALGDRHGRRRVFTVGLVWFALASLLCGIAPSAGA
FT                   LVAARAVQGIGAALLVPGSLALIRSCFAPEDQGRAIGAWAGLSGVTTALGPLLGGWLAD
FT                   AVSWRAVFLVNPPLAALGVWAAVRFVPESRGRRGARLDLAGAALAAVGLGALTFALIEA
FT                   TGGAARSPRVLVGAAGGLAALAAFALVERRSAAPMLPPSLFRSRQFTGVNAATLALYFG
FT                   LGGATFLLALQLQRGLGWSPLAAGAALLPLTFCILVLSPWSGRLAARVGNRPPMAAGAL
FT                   VAGAGLALLARVTPGAAYLPDVFPGVATLGVGLGLAIAPLTSAALSAVGVERAGVASAV
FT                   NNAVARVAGLLAVAVLPLAAGIAPAEVASGSFTSGFQRAMTISAALCALGGVTAWATVE
FT                   RGRRATPPHRALGEATGPIAPGRVR"
FT   gene            41514..42542
FT                   /locus_tag="Anae109_0032"
FT   CDS_pept        41514..42542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0032"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: ade:Adeh_0031 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24252"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A6"
FT                   /protein_id="ABS24252.1"
FT                   /translation="MRRLETWTALAIVGGAAALTLSRRIGRVRLPGKIALVTGGSRGLG
FT                   LLVARELGRRGMRVVVLARDEEELERARSSLAAEGIDVTALPCDVTDEEGIQGLVADVE
FT                   QNLGPIDVLVNNAGIIQVGPVETMKPDDYRRAMDVMFWGALNAAEAVLPGMRQRRRGTI
FT                   VNVTSIGAAVGLPHLAPYDAAKFALRGWSEALGAESIRHGVRVVTVVPGLMRTGSFGHA
FT                   LVKGKRYAEASLFTLFASLPLVTASAERAARRIVRAVENDERFVVIGLPAKGLRLAHAL
FT                   FPGTVVRTLGMVNRLLPPAEPGAREAIPLPGELFRRGLARSILTALGDRAARRYNEEPE
FT                   PA"
FT   gene            complement(42625..43872)
FT                   /locus_tag="Anae109_0033"
FT   CDS_pept        complement(42625..43872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0033"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: ade:Adeh_0032 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24253"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A7"
FT                   /protein_id="ABS24253.1"
FT                   /translation="MRTTPILATLLLAPALASASGYEVISVNPRDLALSHSAVAVQVDA
FT                   AAASLNPAALSKLEGPTVSVGGSLLNIWTEWDGDPARGPAGHAQTRFEPVTPVAIYAGW
FT                   GTKLADRGFGVGVGFTQPFGGNVFWEDDWEGRGRIVEVQRRFFGTYATAGYEVLPQLRL
FT                   GGGLVWYYGFEYLKQGIQPIPAAYGELDTKGGGVTYQVSAEIQPVPSYPLVFGVDYKHK
FT                   AHVTLEGDGNFVVPPSLESADTRDQGVSHDVTLPNLLNVGVGWRPAKPVLLTLQYSWSR
FT                   WVEYVDDTFEGDAGLTLTVPRDYRNGQVVRGGVEWQALPALALRLGLMRDTSGLRDTTY
FT                   SPTLPDSNTTGVSTGLTWAFGKRGLAVNAAFFYGYRDEVETEGDIAFPGTFQTDIMITS
FT                   LSLSWNTDLARAARAR"
FT   sig_peptide     complement(43813..43872)
FT                   /locus_tag="Anae109_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.758 at
FT                   residue 20"
FT   gene            complement(43893..46820)
FT                   /locus_tag="Anae109_0034"
FT   CDS_pept        complement(43893..46820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24254"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A8"
FT                   /protein_id="ABS24254.1"
FT                   /translation="MLHRRAPILAALAVLAAACTETVDREPPAESAVIASYSSPNIPTP
FT                   NDLALAAAPTLPAGPGRQFLELLAAQGGFPADQAPTLTVPLRAVTYDAETGEYVDAARP
FT                   TVDVATVTPETFALFRLGDGTAVRVDTEPLAAQSQVPGELRVQPRADASGSRRLAPGRY
FT                   VFAARGGANGVKTREGVPLSPDKAIALNLENEDLSERENQPPGGLEPAELALLLNVQNA
FT                   LWKPLEWNTAGAAGWAPAPDPRIVPAFEAIDAAFPRAEVASIATFEIAPLSTGAAVLTD
FT                   SGSGQLPFPSDFLLDPTRPVPGTNETRFYVRNLPSLGPAAPGLATLDGFSTTSLLLAPL
FT                   SAPVQASTITHDTVRIYELIPTGATTPPTTRRLVDVTSGGSPEYLTQPPNLKVTVGGTQ
FT                   VSSAIGLQPAIPVPTSPTTIAPLPPLKQKARYLVVITDGVKDLRNDGLARSTLGKILFE
FT                   LEGPLYDPATGQSTVGGISATDARSLQALRGAVQLVAPTFELDGHRVVMAYTLSTQSVS
FT                   DVSASLTGLPYGAEAAAATAIFTPSQVADFDPTSFGLPAGAFPSVARFHTANIATLDVL
FT                   DAATGALNPAVPTWGPAELSANRKEIPALIAVPRPENVASPCGAEPPLSQVRCAPLVVF
FT                   HHGLNGGHYQLLTVANDLAARGFVVAAIDAPFHGDRAYCDSNDDCDGGTCTLDASNQKA
FT                   PGVCTGGALAFDPARLTTTASGNYFISENFFRIRDAIRQDLLDHSALVLAVARPPQGVP
FT                   QQANDPLQAALLGSGVAVNPLEVHFAGVSLGGMIGTSLTATNPRIGRAAFNVTGGTMVD
FT                   VFTNAPAFRERVGALFATLIPGFTFEKVDSANAAFDPAVAARYAQTLIVAKWILDPAEP
FT                   LNYAAEADTNALASAALVTALGPLAPETTALYGQMVQGDPVVPNPFNGLLYALGEMPVT
FT                   LYTSALGPAELHGVIASPANGVKVRADLAEFLSTGNPGPATNALP"
FT   sig_peptide     complement(46764..46820)
FT                   /locus_tag="Anae109_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.634 at
FT                   residue 19"
FT   gene            complement(47076..48455)
FT                   /locus_tag="Anae109_0035"
FT   CDS_pept        complement(47076..48455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0035"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: azo:azo0467 probable
FT                   long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24255"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A9"
FT                   /protein_id="ABS24255.1"
FT                   /translation="MNKILIRRASLAAAIACALIASPSGALASGFQLIEQNGSGLGNAY
FT                   AGQAAAAEDASAIFFNPAGLTRVQGLQVVAALNLIRPSPDFSDGGSTPATLQPTLGGTG
FT                   GDGGSLALVPNGYVSFETVPGVIWTGLGLSVPFGLETEWDSGWMGRFHAIKSAVQTINL
FT                   NPTVAWKVAPWLSLGAGANYQWLDAELTNSVNYSAAAFAVGGATALGALAASGCGGATG
FT                   GCEGVANVSGDTWSWGWNVGALVELPTKTRVGVSYRSRIKHYVKGDVSFANRPALLAAG
FT                   LPDGAIQTTIELPDTLSAAVAQPVGDALELLADYTWTGWSTLKDLSIFRESGAPLTSTP
FT                   LEFDDSWRVGLGASYRATEALKIRLGTAYDRTPVQDEFRTPRLPDEDRWWLAGGVQWAF
FT                   TRQAALDVGAAYLIIDEASSDLPNVDASPPAGFSAPPRGHLVGSYDASVWLASAQVRFS
FT                   F"
FT   sig_peptide     complement(48369..48455)
FT                   /locus_tag="Anae109_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 29"
FT   gene            48959..50572
FT                   /locus_tag="Anae109_0036"
FT   CDS_pept        48959..50572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0036"
FT                   /product="Na+ symporter"
FT                   /note="PFAM: Na+ symporter; KEGG: ade:Adeh_0034 Na+/solute
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24256"
FT                   /db_xref="GOA:A7H6B0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B0"
FT                   /protein_id="ABS24256.1"
FT                   /translation="MNVPLLATIVALYTAVVVFLGWLGYRNTKSAADFLVGGRQIHPVL
FT                   MALAYGSTFISTSAIVGFGGVAALFGMGLLWLTALNILIGIFVAFVVFGRPTRRLGAAL
FT                   DAHTFPELLGRRFGSRFIQGFAGGTIALLMPLYAAAVLIGGARFLEVQLQLRYDLALLV
FT                   FAAITMAYVLFGGLKGVVYTDAFQGSLMFVGMIVLLVTTYALTGGAGAHDALTDLAGQV
FT                   PPALQKGGHRGWTAMPALGSPIWWQLVSTIVLGVGVGVLAQPQLTLRFMTVKSGKELNR
FT                   ALVPGGVFILFMTGVAFLVGALTNVYFWNRDGKIALAMVVDPATGKPNVDKLIPTFTQA
FT                   AMPEWFGYLFMLTLLAAAMSTLSAQFHVIGTAIGRDLYQEVVARGAHQERTVPIAKVGI
FT                   FAGFLVTLVLAFQLGAGIVAIATSLFFGMCAAAFLPLFVAALFWKRATKAGALAGMIAG
FT                   TVAWAGWVLLVHEKESAALGLARLLSGKPSLGAGTVWAVVDPIVVALPISALVTIAVSL
FT                   ATKPMTLASAPPAHARRDAA"
FT   gene            50644..51876
FT                   /locus_tag="Anae109_0037"
FT   CDS_pept        50644..51876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B1"
FT                   /protein_id="ABS24257.1"
FT                   /translation="MTRTAPMLAALLLASPLAARAEEPQKLTLDTSGWIILNTYASSGA
FT                   LNANDLPRFAKAGSADEAALGMGVRQSRLRVNAGIPSDGLLFDAKLKAFVELDFMGGNA
FT                   VGSDDPSLPLVRLRHAWVSAAWPQRGNLSVLAGQTWGIVGGPYFAQSISHLAVPRFAGA
FT                   GFLYRRAPQVRVSGELGRAFGVTYQAGALAPIDRAGVTADAASGAPGPVGERSGLPNLE
FT                   ARVAGVYRPEGKTRAELGVSGHYGWEKYSFAATETRAADDFTAHSSAVALDLKLELPYV
FT                   QLVGGAFSGENLDILYAVNAKGVVPDAAAARVANVETRGLWGQAAVTPVAGYTLLLGAG
FT                   LEDPRDATLPAASASPILRNVQYSAGALVNLTSKWRVGFEVTRYVTDTATPAGHDTFTG
FT                   NQFELSTLLAL"
FT   sig_peptide     50644..50709
FT                   /locus_tag="Anae109_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            51936..52628
FT                   /locus_tag="Anae109_0038"
FT   CDS_pept        51936..52628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24258"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B2"
FT                   /protein_id="ABS24258.1"
FT                   /translation="MGSSRGRAGCVAALAAATVLLPACAGWKRDLVARTSSVIEPLVVR
FT                   CDAPPAPGAALRVASVTVEGELHPKAKVGSQFDWGRPFEEDPNLPDWLRLERKPLVVDA
FT                   DAFGRTLREDAQRLLAASGGEPPAGAHLFLRFEDVRTVAIPGRWNELRGRVLARVAFRA
FT                   ALRDAAGGRLWSGVFEGEAEDRVIYFRQVHHERMLSEAYCRALTRFGESLPVAARALAP
FT                   ARAPAGAP"
FT   sig_peptide     51936..52013
FT                   /locus_tag="Anae109_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            complement(52652..53977)
FT                   /locus_tag="Anae109_0039"
FT   CDS_pept        complement(52652..53977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0039"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: ade:Adeh_0036 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24259"
FT                   /db_xref="GOA:A7H6B3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B3"
FT                   /protein_id="ABS24259.1"
FT                   /translation="MSTPLLESAIFDPAETLPVPERRALQARRLAETVRRAAAVPFYRD
FT                   ALGRAGAGADAIRSADDVRRLPFTTKDDLRQSYPLGLLAVPRAELARVHGSSGTTGKPT
FT                   FVAYTRADLDTWSGLVARFLVAGGLRPEHLVHVAFGYGLFTGGFGLHYGIERVGAAVVP
FT                   AAGGNTPRQVMLIRDLGAEVLVCTPSYALHIAEVARAEGYRPGELPLRFGHFGGEPWTE
FT                   EMRITLERELGILAFNNYGLSEVVGPGVAGECSHRTGMHVQEDHFLVECVDPDTLAHVP
FT                   DGEVGELVFTTLTKQAMPVLRYRTRDLAALDRSPCPCGRTGVRMSRVVGRSDDMLIIRG
FT                   VNVFPSQVEEALLRVEGTAPHYLIEVSRPGSLDEAVVKVEMRPADFRDEMRQLQELHDR
FT                   IDREIHAVTGVRMTVELVAPNTLERSAGKAQRVLDHRRTGRA"
FT   gene            complement(53988..54431)
FT                   /locus_tag="Anae109_0040"
FT   CDS_pept        complement(53988..54431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0040"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   ade:Adeh_0037 amino acid-binding ACT"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24260"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B4"
FT                   /protein_id="ABS24260.1"
FT                   /translation="MKIRQLSLFLENRPGQLRFPCKVLGDAGIDILTMSLADTAQFGIL
FT                   RLVVKEWQRAREVLEAAGVVVNVTEVLAVDVPDRPGGLAGVLEAFEKAGVGVEYMYAFA
FT                   SRERGRHATLLFRLEDPDRAAKLLEAAGVKLVPSDELFARSGA"
FT   gene            complement(54428..55768)
FT                   /locus_tag="Anae109_0041"
FT   CDS_pept        complement(54428..55768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0041"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: ade:Adeh_0038 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24261"
FT                   /db_xref="GOA:A7H6B5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B5"
FT                   /protein_id="ABS24261.1"
FT                   /translation="MTTQWNDAPGGFHPASAPDFLPRRELARLQLGRLQSVVARAYARV
FT                   PLFRGRMEERGLSPADVRSLEDLARLPFTVKTDLRDTYPFGLFASPMEEVVRLHASSGT
FT                   TGKPIVVAYTEADLRVWTSVMVRTFAACGLHRGDVIQNAYGYGLFTGGLGAHYGGEALG
FT                   ATVIPISGGNTERQLMVLQDFRVTAICCTPSYMLHLVERAREAGISFERLQVGVFGAEP
FT                   WSEEMRRHIEATAGIRAHDIYGLSEIIGPGVGIECQRREGLHLFEDHFFPEIIDPETGD
FT                   VLPDGAEGELVLTTLSKEAMPMIRYRTRDITALLPEPCACGRTIRRIRRIGRRSDDMLI
FT                   VRGVNVFPSQIEAALLAVEGTLPHYQLVLTREHGLDEMEVQVEVTPEVFSDTIGAMEGL
FT                   RRRLEAAIDHVVGIRAKVTLVAPRTLARSEGKAKRVSDRRNIQGGVS"
FT   gene            complement(55825..56310)
FT                   /locus_tag="Anae109_0042"
FT   CDS_pept        complement(55825..56310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0042"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: ade:Adeh_0039 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24262"
FT                   /db_xref="GOA:A7H6B6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B6"
FT                   /protein_id="ABS24262.1"
FT                   /translation="MSDVVNVVFAGLGGQGVIKASDILADAAFRAGRDVKKAEVHGMSQ
FT                   RGGSVTSDVRFGREVLSPMVPRGEAHYLVVLSPSEVAVTRPLLGKAGVLIPPDLVDEAA
FT                   LPNRKSLNVALLGALARHLDLPDEHWLAAIRAALPERLHEVNERAFRLGREAAGRAG"
FT   gene            complement(56303..57922)
FT                   /locus_tag="Anae109_0043"
FT   CDS_pept        complement(56303..57922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0043"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: ade:Adeh_0040 indolepyruvate ferredoxin
FT                   oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24263"
FT                   /db_xref="GOA:A7H6B7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B7"
FT                   /protein_id="ABS24263.1"
FT                   /translation="MERRLLSGDEAVAAAAMDGGVHLGTGYPGTPSTEILEAFSALGGR
FT                   AQWAPNEKVALEVGLGAAFAGARAVVTMKHVGLNVAADPLFTAAYTGVSGALVVVAADD
FT                   PGMASSQNEQDSRRYAIAAGLPMLEPADSQEAYELALAALELSQRWQLPVLLRMTTRVC
FT                   HSKSIVTRQSAVAPAPVPRFARDVASRVMIPAYARPAHRRLRKKLESLEAWGETAPLAI
FT                   WREGSKALGVIANGVTARHVREAAPEASLLELKLVHPLPLEKIRAFAASVERCVVIEEG
FT                   DPVIADAVRAAGIPVEGKAPSFRFGELDVPRVRRILARDLSPEPEAPKGKPPQLCEACP
FT                   YHPVYSTLKKLGCIVAGDIGCYTLGVLPPYEGMDTCVAMGASLGVGLGLRHVLPEEDAR
FT                   KVVSIIGDSTFVHTGLNGLVEMVYNPPPTGHVLVVLDNGTTAMTGQQEHPGTGRTLDHE
FT                   PTAKLSIEGLARALGVANVDVVDPIADPAGFERLLAGRLSRPQLSVIVARRPCILAAAD
FT                   IRKYEKAAAAAGCAACPEVENV"
FT   gene            58054..59007
FT                   /locus_tag="Anae109_0044"
FT   CDS_pept        58054..59007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0044"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   ade:Adeh_0041 phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24264"
FT                   /db_xref="GOA:A7H6B8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B8"
FT                   /protein_id="ABS24264.1"
FT                   /translation="MMPIPTLERLVAAARAAGPLRVAVAAAENDTALAAAALAVRQRIA
FT                   EIVLVGDPQAIRARLAAAGEDPADFSVEPAESDADAARRAVAMVRGGEAAVLMKGRLPT
FT                   GELLRAVLDREGGLRAGRLLSDVLVADHPLSERPRLLGVTDGGVNVAPTLPQKKEIVAN
FT                   AVRLFQALGYARPKVACLCAVETVSEVMAATKDAQALAEANARGELPGCVVSGPLALDN
FT                   ALSPEAARAKGIDHPVAGHADVLLVPTIETGNALGKAFTYLARRHVGHVIVGALAPVLI
FT                   PSRVERAEDKIYSIALGVLAAASERWRREGGGRERP"
FT   sig_peptide     58054..58134
FT                   /locus_tag="Anae109_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.777) with cleavage site probability 0.406 at
FT                   residue 27"
FT   gene            59004..60104
FT                   /locus_tag="Anae109_0045"
FT   CDS_pept        59004..60104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0045"
FT                   /product="Butyrate kinase"
FT                   /note="TIGRFAM: Butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: ade:Adeh_0042 acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24265"
FT                   /db_xref="GOA:A7H6B9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B9"
FT                   /protein_id="ABS24265.1"
FT                   /translation="MTEATPEHAGPLVLAVNPGAGSTKLALYRGDALVREEKLTHPPLM
FT                   ERPAARVLDELPARLEAARALLSAAAIPLGRLAAVVGRGGLLPPLRSGTYLVDAEMLRD
FT                   LARAERGEHASNLGAPMARALADDHACPAFIVDPVSVDELDPVARVSGLCGVERRSLSH
FT                   ALNMRAVARRHAARAGRALEDLRLVVVHMGTGVSLSAQRDGRMVDVVNPQDEGPFSGDR
FT                   AGGVPAMAVVELCFAPGAEERAVRRRLFGDGGLYSHLRTRDAREAIRRCEAGDSQACLV
FT                   LDAMCYQIAKAVGGLAAALEGRVDAVLLTGGMAHLPHVVEGVRRRVGWIAPVHVLPGED
FT                   ELRALAEGALRVLRGEERPRRYGDRE"
FT   gene            complement(60316..61272)
FT                   /locus_tag="Anae109_0046"
FT   CDS_pept        complement(60316..61272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0046"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: ade:Adeh_0027
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24266"
FT                   /db_xref="GOA:A7H6C0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C0"
FT                   /protein_id="ABS24266.1"
FT                   /translation="MIAPLHVVFGAGQVGQHLARALAARGFAVRVARRGAGEVPPGAEL
FT                   LRGDAADAAFCAEAARGAAAVYHCMNPPYSARAWADLVPRFATNLARAAGGAGARLVVL
FT                   DNLYALGRTGGHPMREDTPPAPVSRKGEIRARTQALLAEAQRRGEVRAVVGRASDFYGP
FT                   GGEQSFFGPRFWPAALGGRPVTWIGNPDTPHSYHFIPDVARALAALGTADDDVLGRTFM
FT                   LPCAPAEPTRALVARLSAALGREIRLRVLPRPLVRAIALAVPIVRELDEMLYQWEEPFV
FT                   VDDRRFRARFPELVPVAPDAGATETVAWARERFGADR"
FT   gene            complement(61359..63296)
FT                   /locus_tag="Anae109_0047"
FT   CDS_pept        complement(61359..63296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24267"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C1"
FT                   /protein_id="ABS24267.1"
FT                   /translation="MASTGAALLLCSFLLAAPAGAAEAVPSPAQAAAPHVARARAARLA
FT                   EDLGWLRLGHWRKGLFGWKSEIDGPQFFLAPEGKEDPAAELEATLEGFFSSGPFADELS
FT                   DPVCRFPARLAFLAARLGLDPAALPPRSCPKRDDFLARVRPAGVTLVFSSYYLNNPSSS
FT                   FGHTLLRLDKAEGAREGKHFELLDYGVDYAATVDTSNAILYAVKGVFGLFKGEFKHYAY
FT                   YYKVRQYGDFESRDLWEYDLAFTPDETALLARHLWELGGTWFAYWYLDENCSYHVLGAL
FT                   EAAAPRLELLARVRGGVVLPSDTVKALFANPGLVRAVHYRPSIRTQFEARARTLSGLEL
FT                   DTAVELASRPSAPFPPALAPARRVAVLDAAQDLLDLRHGRKLVMGEDPRAARLRQALLE
FT                   RRAELPVPSAPLQVPAPEARRPDRGHGSLRAGLMGGASRAYGGFAALEGRLALHDLADP
FT                   LQGYPPTAQIEFLPARLRYYPERSRLELDDASLVKVVSLNPLSRWDQRPSWRMRVGATT
FT                   VRDAGCAGCLAGVAELGGGLGLADLGGAIDLLALGDAELLGAPSLEGIRGAGARLGLGP
FT                   SALVRVRAGDRAVLLADARWRYLPLATPEQTWSVSGTLRLHLTRALSLAVEARAAPEDR
FT                   DVQAGLLLYR"
FT   sig_peptide     complement(63231..63296)
FT                   /locus_tag="Anae109_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.729 at
FT                   residue 22"
FT   gene            complement(63353..63853)
FT                   /locus_tag="Anae109_0048"
FT   CDS_pept        complement(63353..63853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24268"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C2"
FT                   /protein_id="ABS24268.1"
FT                   /translation="MRSSFALAIAAVLFALPAAAQSQAESAIRGTGKYGTAGCGLGSMA
FT                   FGDTPGAVQILAATTNGLFGTQTFGITTGTSNCGPGLFAMGTQNFVEANREALAKDISR
FT                   GEGEAIGALTVINACEDSHKVGAALQKNFKTIFPSESASNEDVTRAILETLHGDQSLGC
FT                   GKS"
FT   sig_peptide     complement(63791..63853)
FT                   /locus_tag="Anae109_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.845 at
FT                   residue 21"
FT   gene            64064..64867
FT                   /locus_tag="Anae109_0049"
FT   CDS_pept        64064..64867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0049"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: ade:Adeh_0048 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24269"
FT                   /db_xref="GOA:A7H6C3"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C3"
FT                   /protein_id="ABS24269.1"
FT                   /translation="MPLKILVTAKRVEDPESKIKVKPDGSGIVTDGVNYKMNPFDEIAV
FT                   EEALRLKEKHGGEVVVASIGGEKSATELRAALAMGADRGILVRHDGPLDPVVVSALLAK
FT                   VFELEKPDLVVLGKQSIDDDQNQAGQYLAARLGLAQATFASKTESLESEAEQKKQPGLA
FT                   LAADGKTLAVVREVDGGVETLEVTLPAVVTTDLRLNKPRFASLPGIMKAKKKELKELAA
FT                   ASLGVDLAPKVVVRRLSEPPARKGGVKVQDVEELWKKLHDEAKVV"
FT   gene            64888..65850
FT                   /locus_tag="Anae109_0050"
FT   CDS_pept        64888..65850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0050"
FT                   /product="electron transfer flavoprotein alpha and beta
FT                   subunits"
FT                   /note="KEGG: ade:Adeh_0049 electron transfer flavoprotein
FT                   alpha and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24270"
FT                   /db_xref="GOA:A7H6C4"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C4"
FT                   /protein_id="ABS24270.1"
FT                   /translation="MANVLIVAEQSGGAIRKATLHAISAGREVARRTGGELHVALLGKG
FT                   IGAAAEELAGYGAEVHAADAAVLEHPLAEAHAPVVAELARAVQAAYVGAAATAMGKDLL
FT                   PRVAALLEAGMATEVLGFGGDGAELTFHRPMWAGNVLAEVAIATPVKAFTVRATEFPAA
FT                   AKEGKGAVIPAPVSVDAGALRTRYAGFKEVKSERPELTEARVVVAGGRGTKGDFKAVEA
FT                   LADELNAAVGASRAAVDAGWVPNDWQVGQTGKVVAPDLYVAAGISGAIQHLAGMKGSKV
FT                   IVAVNKDPDAPIFQLADYGLVADLFKALPELTAKVKGAR"
FT   gene            65882..66886
FT                   /locus_tag="Anae109_0051"
FT   CDS_pept        65882..66886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0051"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ade:Adeh_0050 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24271"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C5"
FT                   /protein_id="ABS24271.1"
FT                   /translation="MTEADLAALGVHRIAVPIPFPQAGGPVNVYAIEEAGGGLVLFDSG
FT                   FSSAEAHAALEDGFRRIGRRFDEVTRIVVSHGHVDHYGGARHVQELHGGTPPVYAHPAD
FT                   LPKVTEEGWRWREHAPAYAAHLARLGLPEDVIAATAAAGEKSFELAPRVPEARPLAEGE
FT                   RLRARHLDLEVLHMPGHTPGLVCLYDRARRLFLSDDHLLQKISPNPLIELGPHGEEGYF
FT                   RPLLAYLDSVRRLHALDVDLVLPGHGPPFSGHRAVIDRLVEFYGKRQARLRELLAAGPR
FT                   TAWELCRTLFPWAKPAEAFLTISETAANLELLEARGEVARTEVAGRWSYALAR"
FT   gene            66951..67712
FT                   /locus_tag="Anae109_0052"
FT   CDS_pept        66951..67712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0052"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   ade:Adeh_0051 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24272"
FT                   /db_xref="GOA:A7H6C6"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C6"
FT                   /protein_id="ABS24272.1"
FT                   /translation="MLDLLTQPDVWISLATLAAMEIVLGIDNVVFLTILAGRLPQEQQP
FT                   KARRLGLGFALATRLGLLFAISWVMGLTRELFSVAGQGFSGRDLILLAGGLFLIGKATF
FT                   EIHDKLEVEHGPEEAKKGGASFWGVIVQIGILDIVFSLDSVITAVGMARHLSVMVTAMV
FT                   LAVGVMLVFAGPIGGFVERHPTMKMLALSFLILIGVMLVAEGFGRHVEKGYIYFAMAFS
FT                   LAVELLNMRIRRAKEAPVKLHGRFEIEEPRG"
FT   gene            67705..68607
FT                   /locus_tag="Anae109_0053"
FT   CDS_pept        67705..68607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0053"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ade:Adeh_0052 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24273"
FT                   /db_xref="GOA:A7H6C7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C7"
FT                   /protein_id="ABS24273.1"
FT                   /translation="MADLALLVLTLFWGTTFHFVKGVLEVASPGVFLAARFATAAAVLG
FT                   AVALWRRERVGAGFLRHGVLLGAFMLAGFALQTVGLRHTTPARSGFFTGLAVLIVPFLA
FT                   RFLLGRAVKMASWAGVALAVAGLALLTHPFGEPVDAGVRLGDLLTAGCAVAFALQIVYT
FT                   SEWSPRHPIVPLTLAQITVTFLGAAAMLPFESRYYRPEGAAVFAVTVVFTGVFMTALAF
FT                   FVQNWGQRHTTAVRAALIFSLEPVAAALFSHFYGGEPLRATDWGGGALIALGVVAGEVG
FT                   GLVEGRRSPGPALTAGGRG"
FT   gene            68715..69893
FT                   /locus_tag="Anae109_0054"
FT   CDS_pept        68715..69893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0054"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ade:Adeh_4095 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24274"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C8"
FT                   /protein_id="ABS24274.1"
FT                   /translation="MNHPDTSLSIAYANYGEQSGVTAHVAGALRALGHRIAPVSARGPL
FT                   DLRDPQTRLPRLTRDVFAHLAVAAARFRGRALAYRWNTAYAFDVHSRYLGAAIDGLDPA
FT                   PDVVLQNGALFAPGAPPRVPYVLLLDHTRALAEASPAFPAAGLAAPPRYGPSWFARERA
FT                   CYQGAAAIATFSENVARSLVRDYGIAGQRVEIVGAGANAVPERVVRADDGETILFVGRE
FT                   FARKGGTFLLDAFELVRRRRPSARLLIAGPPEPLALPAGAEQLGPVPYEELEPLFARAT
FT                   VFALPTLWEPFGIAFLDAMACGVPCVGTHVEAVPEIVEDGKTGVLVPPGDPAALAEALL
FT                   ALLGDPARARAMGAAGRARVQGRFLWSHVGGRLDGLLQSVRATPRQPARAAS"
FT   gene            69957..71174
FT                   /locus_tag="Anae109_0055"
FT   CDS_pept        69957..71174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0055"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   ade:Adeh_0053 membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24275"
FT                   /db_xref="GOA:A7H6C9"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C9"
FT                   /protein_id="ABS24275.1"
FT                   /translation="MPPAGPELSCAMRRALRLALAATLALAACRTVPPPPPQPATTAER
FT                   ALEELSPGAFPAFGDDLDYAGLDAALEGSLQHFARVARADPGRTLAFGKERVPVAKVAA
FT                   SLRRFRELVGARPAPAALREALRREFRVFRSIGDGRGTVLFTGYYLPEIAGSLERGGRY
FT                   QVPLHRAPVDLVQVRARDFPALSADLIGRVRDGRLVPYPTRAEIADGAIAGQGAELAWV
FT                   ASAVDAFFLEIQGSGLLRLPDGTTRVVTYAGKNGHRYEAIGAELIRRGALTREQVSMQA
FT                   IRAWLAANPAEQPLLLATNPSYVFFRFADDAIGSLGVPVTPDRTIAADARVFPKGALAF
FT                   VETERPADATGGPMKPFGRFFLDQDAGGAIKSSARVDLFLGSGAYAESAAGRMKQPGRL
FT                   YYLLLK"
FT   gene            complement(71234..72538)
FT                   /locus_tag="Anae109_0056"
FT   CDS_pept        complement(71234..72538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0056"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: ade:Adeh_0054
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24276"
FT                   /db_xref="GOA:A7H6D0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D0"
FT                   /protein_id="ABS24276.1"
FT                   /translation="MKAEQRTVDVGERLPLLQSIPLSLQHLFAMFGATVLVPYLVGLDT
FT                   SVTLFTSGVGTLLYIFVTKGKIPAYLGSSFAFIAAFIGLLGAKAGELASPDRIAVAMGG
FT                   CVVVGLVYIVVAAIIGKFGTGWIDRLLPPVVIGSVVMVIGLGLARTAVVTMAMEGGTGT
FT                   YHPEYFAVALSALAIAILAAVFLKGFLGVIPILIGIVGGYLVALLAGQVSFDAVRSAAP
FT                   VALPPFVPPKFTWGAILTLAPISLVVITEHIGHLIVTNNIVGRDFVKDPGLHRSLAGDG
FT                   VATAFAGLLGGPPNTTYGENIGVMAITRVFSVWVIGGAAVIAIVMSFFPPVGALIRTIP
FT                   THVMGGICILLFGIIASAGIRMLVEAGIDFSQKRNLIIASVVLVIGIGGAKLHIGGIEF
FT                   GEMSLAAYVGMLLNLILPRAMEKGAGEAAGEAADV"
FT   gene            73011..74003
FT                   /locus_tag="Anae109_0057"
FT   CDS_pept        73011..74003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0057"
FT                   /product="putative mRNA 3'-end processing factor"
FT                   /note="KEGG: ade:Adeh_0055 putative mRNA 3'-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24277"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D1"
FT                   /protein_id="ABS24277.1"
FT                   /translation="MRRPPIELHKGELRITHSALHLDAKRRVECAFVSHAHGDHIGRHD
FT                   RTIATTPTLALMRHRLGEPKRRKTEALPVDYRTPFGLGELTLELFSAGHVLGSAQLRVT
FT                   RNEVAVGYTGDLCTEPTHAAERADVMPCDVLVMESTFGLPRYVFPPKEETLAAVRRFVD
FT                   DALSDGVTPVLLGYALGKAQEILKFLSDAGYPCRAHPVVHAVNRVYEAHGVAFPNVRAL
FT                   GPEGPERGEVVVAPPHLARSPAMRGVGKRRTAILTGWAIDGGRWFRGVDAAFPLSDHAD
FT                   FPSLVRYAKATGAGRVFTVHGHADALSAALRKEGVRSEPLREHMQLELL"
FT   gene            complement(74009..74686)
FT                   /locus_tag="Anae109_0058"
FT   CDS_pept        complement(74009..74686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0058"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   ade:Adeh_3725 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24278"
FT                   /db_xref="GOA:A7H6D2"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D2"
FT                   /protein_id="ABS24278.1"
FT                   /translation="MGSPPVKGFGQGDPALAAWAESVYAPEDEVLREIRARSDAAGLPP
FT                   IHVGRFDGLHLEVLARACAARRIVEIGTLAGYSGVCLARALPEDGVLHTFELLERHAAL
FT                   ARAAFARAGVAGRVRVHVGPALERLREVEGEGPFDLVFVDADKGGYPAYLAWAEEHLRV
FT                   GGVLLADNTFGFGHVHEPASAGEDAAAMEPLRRFSERLARGGRFRATMLPTAEGLSLGV
FT                   KVR"
FT   gene            74844..75863
FT                   /locus_tag="Anae109_0059"
FT   CDS_pept        74844..75863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0059"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: ade:Adeh_0056 pseudouridine synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24279"
FT                   /db_xref="GOA:A7H6D3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D3"
FT                   /protein_id="ABS24279.1"
FT                   /translation="MLTFTISEDAAGQRLDKLVRKALRDVPLSHVYKMFRTRKIRVNGG
FT                   RGKAEQLVAAGDVVVIRGDEERLLARQEPEPGARAGAVTFGVLHEDADVLAVDKPAGLA
FT                   AHPGTGISGATLVEMARAHLGTPADLPPTEFKPSPAHRLDRDTSGVVLVAKNRKTMVRL
FT                   TELFTDGADVKKTYLALVKGKMPREAGTIDLPLAEHEQTARSKAARGVNLQEALTRWKV
FT                   VSAMKEASLLAVTIETGRTHQIRRHLEAVGHPVLGDRRYGDFPTNRAARQRWGLRRMFL
FT                   HAWRLELPHPTTGAPLRLEAPLPGELLEALSRANLSSPAGTASGRAAPRGAARPHGER"
FT   gene            75899..78457
FT                   /locus_tag="Anae109_0060"
FT   CDS_pept        75899..78457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0060"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: ade:Adeh_0057
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24280"
FT                   /db_xref="GOA:A7H6D4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D4"
FT                   /protein_id="ABS24280.1"
FT                   /translation="MTDSRDPTVESGGAPDAPPRVVLDGLPPRRPFVRGLVRWALFLAI
FT                   VAVNAGVVAGIAGYLYFSRGLPELPKLSDYRPPIVTEMVSADGQIAGEFFVERRKVVPY
FT                   ERIPKRLLQAFVASEDQDFFEHGGVDWTGTLRAALNTYVLRRRIQGGSTITQQTAKALL
FT                   ISAEGFESGTRRNLARKLREFILAKRLERAFTKEEILWMYLNGVYLGHHSYGVQAAAEN
FT                   YYRKNVEDLTLEEAALIAGLPQAPSRYSPFSHPEAAKDRRRYVLRRMAEEGFITQEERA
FT                   RGSEAEVKVFGVDDVFRETAPFYVEHARRYVVDRFGNERLLQDGLRVELAMDLEKQRAA
FT                   QAAMLSGLMEVDHRQGYNGPVANVAGAERKTLAERLARAWPKGRLERGEYCVGIVARVD
FT                   DRAGFAEVEVGENRGLLPLSGMRWARRPNPEVFYPDALISRASIAVKTGDVVLLRRVAR
FT                   EDLQKRERELGLGKAASVPEAELLFTLEQEPKLQGALVSVDPWTGYVVAMVGGYDFDAS
FT                   EFNRAFQACRQPGSAFKPLVYAAAIEKLDFTPATILTDAPIVFRDDENSWKPQNYGQDF
FT                   KGDVTLRTALVDSMNIPAVKTAEALSAKVGMQALAEWAKALGLTTPVKLELGTALGSSC
FT                   VNLWELTNVYALFARYGEKRPATFVKRVLDRDGNVLEDRTDWRDPWVGLDARLAAGFAE
FT                   VTRPRARVMDERTAYILVRLLREVATVGTGARASALGKPAAGKTGTTNDSFDTWFMGFT
FT                   HDLATGVWLGYDVNVTPLGRYETGGHAALPIWLSYMRTALDRRPQPEFTAPAGIVEVRI
FT                   DPDTGKPAADGVFEPFKQGTEPSAPAEGQQQVEVQDLFMQ"
FT   gene            complement(78532..78972)
FT                   /locus_tag="Anae109_0061"
FT   CDS_pept        complement(78532..78972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0061"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   ade:Adeh_0059 protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24281"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D5"
FT                   /protein_id="ABS24281.1"
FT                   /translation="MAYWLLKTEPGTYAWDDLVREGTTAWTGVSNPQAQANLRAMQAGD
FT                   RTVIYHSGEKRAVGVAEVVRTAYPDPSAGEGAVCVDVKAVAPLPAPVPLEALKQEPAFE
FT                   GSALVRQGRLSVVPLSPAEWRDLTALADIIAKTGGLRRDERF"
FT   gene            79057..79413
FT                   /locus_tag="Anae109_0062"
FT   CDS_pept        79057..79413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0062"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /note="PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: ade:Adeh_0060 sec-independent
FT                   translocation protein MttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24282"
FT                   /db_xref="GOA:A7H6D6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D6"
FT                   /protein_id="ABS24282.1"
FT                   /translation="MFGLGFGEIIIIAILALLLLGPERLPEAAKALGKTLRDVRRATDD
FT                   IKGQIETEIYAEERKAAKPALVPPVPAAPLAPAGPPPPATSENVPGLEAALAEPPASAS
FT                   PETTPGEPAPSRTA"
FT   gene            79410..80222
FT                   /locus_tag="Anae109_0063"
FT   CDS_pept        79410..80222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0063"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: ade:Adeh_0061 sec-independent protein
FT                   translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24283"
FT                   /db_xref="GOA:A7H6D7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D7"
FT                   /protein_id="ABS24283.1"
FT                   /translation="MSSTAPQLPPAGAAAPEPENEVRLTFMEHLRDLRKRLTHAILGVL
FT                   VGMLAVGGFVDGIFHWLMAPVRAALPPNQQVLHYTSSIEPLMVYLKVAVYGGVFVAAPW
FT                   VLYQLWQFVAPGLYKKEKRLVIPFLFFGTLLFYVGAAFCYFLVMPPAFPAMLAVAADAS
FT                   LAPMLTMSSTLGLVLAMLLGFGVVFEVPVILAFLSLIGVVSAQTLAKYRRVAIIVNVLV
FT                   AAVITPTGDPLNLAMMAVPMIVFYEIGILLARILGKRKAEPVGAAANP"
FT   gene            80530..81738
FT                   /locus_tag="Anae109_0064"
FT   CDS_pept        80530..81738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0064"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: ade:Adeh_0062 acetyl-CoA
FT                   C-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24284"
FT                   /db_xref="GOA:A7H6D8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D8"
FT                   /protein_id="ABS24284.1"
FT                   /translation="MKRAGQKDVVILAAKRTPFGTFGGALKDHSATDLAVHAAGAAIAQ
FT                   AGVPAEDYGHVVMGNVVQTSPDAIYLARHVGLRAGLPQRVAALTVNRLCGSGFEAIIQA
FT                   ARLIELGEAELVLAGGTESMSQAPLVVRGTRFGYAFGKPPAMEDMLWSAVTDSYAGMPM
FT                   ALTAEKLAEQYALSQDEVDDYSVLSQRRWAAAHEAGRFREELAPLELKGRKGPVAFERD
FT                   EHPRPDTTVEGLRTLPKAFKKDGVIHAGAASGIADGAGALVVATREYAERRGVKPIARV
FT                   VNWGHAGVDPTVMGIGPVPAIRNALERAGATLADVDLFEVNEAFAPQYLAVEKELGLPR
FT                   ERTNVDGGAIAVGHPLGASGARITMHLAYELRRRGGRAAVGAACIGGGQGVAIVLAPAE
FT                   PGA"
FT   gene            81805..82002
FT                   /locus_tag="Anae109_0065"
FT   CDS_pept        81805..82002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24285"
FT                   /db_xref="GOA:A7H6D9"
FT                   /db_xref="InterPro:IPR023128"
FT                   /db_xref="InterPro:IPR037132"
FT                   /db_xref="InterPro:IPR037259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6D9"
FT                   /protein_id="ABS24285.1"
FT                   /translation="MASFTGVKVFSTTLARDREHMGEQVGRWLAEHPDYEVVEREVRQS
FT                   SDKEFHCLSIILFYRDRRKA"
FT   gene            82009..82743
FT                   /locus_tag="Anae109_0066"
FT   CDS_pept        82009..82743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0066"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ade:Adeh_0064
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24286"
FT                   /db_xref="GOA:A7H6E0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E0"
FT                   /protein_id="ABS24286.1"
FT                   /translation="MPTARRRAPRLGDTFTFGGRVPAVVGLLIAAMAVVTIASWLDRRL
FT                   LQLLAFDPASVLYGQLWRLLTWVFVQDSPLTLFFAGFMLWWLGQQLVYVWGERRFLLRF
FT                   LGITVGAGVLATLFALVYRPAAVGHVNAWPTVNGLLVAWALMFPDRPLSWFGVINMSAK
FT                   MMAALVAFGTVLYAIAYGGPGRFAVHFAALAIGWALSRGLSFGGFFRKARRNLEEREAR
FT                   RRAKHLKVVRRNGQDEPPRWMN"
FT   gene            complement(82789..85368)
FT                   /locus_tag="Anae109_0067"
FT   CDS_pept        complement(82789..85368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24287"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E1"
FT                   /protein_id="ABS24287.1"
FT                   /translation="MPDPRSVMQEFRTLDAKRRAGKLSPEEERRLAELRDLVGGDAGGG
FT                   APRGGFDVNAAAARLRESLLPAGLRNRPPPPPELSPEPEPEPFFPASAPPVALEAAPAE
FT                   PAGENPLADLDPSALFDPATLGWEGELGAQPPYDPAALPQETAAWDPNAAAPPWDPGAA
FT                   SQDPASWDPNAPEGAQAWDPAAIPQDAAWDPSAGAEGQPWDPATLADETAAWAPDALPA
FT                   DPGAPPAWDPASAAGWDPSGDAAASPTPDDAAAWSGADGAAAPLDPAALAGAPALAYDD
FT                   AGLPEAGLQPAGIAPEPFDLSALGGEGEAAWDPASLAADGAAEPAFDGGWDAGLAPEAE
FT                   PEPTRAFPLGAAAPAGALEELPALDLDAADLDLLGLEDVALAAEPEGAELDPASAPEPT
FT                   QLLGLASEPEPTQTLPLGGDASTLPPAGWDPTPPPAPSAPGAPLGAYDEDPGAGASAFG
FT                   PDDGLSLDAGFSAEPGAPIDATAAFALGEYDDTAAFAPGAVFEPPADGFEAGEPLALDP
FT                   DGSALDGAGDWPPGAALDPDFSLASGGSFDAADPGAAWATAEAPAPWELAAGAAAAPVA
FT                   HADATPDAAEADSVTESHSLVPVSAAAPDGDDLSLPEIVEEIPTVDGEEILEEIPADEA
FT                   DLPPPALDFAAPATAAAPRPAAAPPAAVPAPAPRPAAATSTAPAAPAAPAPRAATPAAP
FT                   AAVAPPPALSPARGAAVPAPPSAPEPPRAAAMPARAASPAGPTVASGTQRVVVHTLEGT
FT                   VKRGVVEDLDLAAPALALLPAPGAAGETIATEKVKAIFFMLAPGEPTPAAEGKKVRVTF
FT                   RDGRQVAGYSPDYREDGPGFFMVPGDTRTNTGRIWVYRAAVKEVSVS"
FT   gene            85470..87446
FT                   /locus_tag="Anae109_0068"
FT   CDS_pept        85470..87446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0068"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   ade:Adeh_0066 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24288"
FT                   /db_xref="GOA:A7H6E2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E2"
FT                   /protein_id="ABS24288.1"
FT                   /translation="MISLAPAAMYGAPMNRLPVLHDGRAQPPAARADSFLPTSAAELRA
FT                   RGWSALDVLLVTGDAYVDHPSFGAAVIGRVLEAQGYKVGIVAQPDWRSTADVLRMGRPR
FT                   LFVGVTSGAMDSMVNHYTAHKRRRSDDAYTPDAVAGKRPDRATTAYARLCRQAFGATTP
FT                   IVVGGIEASLRRIAHYDYWDDRVLPSVLVPSGADLLVYGQGEKPVLEIARRLASGEDLC
FT                   GLVDVPGTALAVPDLALAMLEGRERKTLELPAYEEIALDRRRFAEFSRLYHLEHNAENA
FT                   RILVQRHGRGERARFVVVNEPMAAPSTEELDRIAELPYVREAHPSYGGAHIPALEQIRW
FT                   SIQILRGCAAGCAFCCITEHQGRDIASRSEASVLRELATLASKESFKGTITDVGGATAN
FT                   MWGMRCTDAEAHAVCRRASCVYPTVCKFFAVDHGPLVDLYEKARKVKGVKHLFVGSGVR
FT                   YDLAQADTKNGARYLKTLVQHHVSGQLKVAPEHVCEPVLKLMKKPGVSSFERLRKDFER
FT                   YSREAGKEQYLVPYFISSHPGSSLEQAAELMDYLQDNRWKPQQVQDFMPTPMTLASDMY
FT                   WSGYHPMTGEPVHVTRDMDEKRMQKALLRWGDPANRPLIEKALRKLGRLKPGERLGPGM
FT                   RPSRGSPKRRGPAGGPGPRRPRA"
FT   gene            87457..88191
FT                   /locus_tag="Anae109_0069"
FT   CDS_pept        87457..88191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0069"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ade:Adeh_0068 lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24289"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E3"
FT                   /protein_id="ABS24289.1"
FT                   /translation="MIPHRGRAALAAALLLLAGAARAQLPERPKAGRGAPIAYLAMGDS
FT                   TAVGVGGGAGGGYPQRLARRLEASGVPVKLAVVAASGATIADLRRDQLPEVMAKRPALV
FT                   TIGVGINDLMQGRKLADFARDLEVVADLVRRTKATVVLQTLPDLTFSPAGHGAPPSLGR
FT                   RLEAYNATIARVAERHGFVLSDVYGKSRRAFRDRQAELFAKDGFHPSSAGYEVWTEALW
FT                   PDVERAVVAPRVQARTPAAGER"
FT   sig_peptide     87457..87528
FT                   /locus_tag="Anae109_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            88311..89699
FT                   /locus_tag="Anae109_0070"
FT   CDS_pept        88311..89699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0070"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   ade:Adeh_0069 adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24290"
FT                   /db_xref="GOA:A7H6E4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E4"
FT                   /protein_id="ABS24290.1"
FT                   /translation="MSDPSGSLAARAARHRRLCEADHRHLWHPFTQMQDWLAEEPLVVD
FT                   AADGVHLVDTLGNRYLDGVSSLWCNVHGHRVKAIDDAIRAQLDRVAHSTLLGLASTASI
FT                   ECAEELVRHLPEGLTRVFFSDAGATAVEIALKMAFQHHQLRGDVERSEFVALRGGYHGD
FT                   TLGSVSVGGIELFHRIFKPLLFDVHHAPQPYCYRCPLAKEPSSCGMACADAVEEVFAAR
FT                   PGKIAALVMEPVMQGADGMIAQPPGYVRRMRELCDRHGALLVCDEVATGFGRTGTTFAV
FT                   EQEGVVPDILTMAKGITGGYLPLAATVTTERVFESFLGPYEEKRTFFHGHTYAGNPLAC
FT                   AAATASMRLLREERVIEGLPAKIAALARALEPARRLAHVGEVRQRGLMVGIELVRDRET
FT                   REEYAYALRAGHQVILEARKRGAILRPLGNVVVLMPPLAMTERQLEELAAIALAGIERA
FT                   TARI"
FT   gene            89775..90446
FT                   /locus_tag="Anae109_0071"
FT   CDS_pept        89775..90446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0071"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: ade:Adeh_0070
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24291"
FT                   /db_xref="GOA:A7H6E5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6E5"
FT                   /protein_id="ABS24291.1"
FT                   /translation="MRGLFITGTDTGVGKTEVTCALVANARAAGLDAVPMKPAQSGVAP
FT                   GEPTDADRLHAACDGAEPLEVLCPYSFAAPLAPAVAARLEGRQVSFGAIVDGVRALAAR
FT                   HEAVLVEGAGGLLVPLTEEETYADLAVALGLSVLVVARAGLGTVNHTALTVEALRARGL
FT                   VLTAIVLNQACETDDPSVPYNPAEIARVTGREPLARLAHVRDIAERQRFLRSRLAGKIQ
FT                   F"
FT   gene            complement(90815..91090)
FT                   /locus_tag="Anae109_0072"
FT   CDS_pept        complement(90815..91090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24292"
FT                   /db_xref="InterPro:IPR014995"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E6"
FT                   /protein_id="ABS24292.1"
FT                   /translation="MDEKSAGGIDFYTFVLSLASSAFVHLGDAPHPDTGLPGKPDLALA
FT                   HQTIDILAMLREKTKGNLTAEEEQFIDHLLTDLRLRYVSRQGGKPE"
FT   gene            complement(91139..92518)
FT                   /locus_tag="Anae109_0073"
FT   CDS_pept        complement(91139..92518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0073"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: ade:Adeh_0073 peptidase
FT                   S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24293"
FT                   /db_xref="GOA:A7H6E7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E7"
FT                   /protein_id="ABS24293.1"
FT                   /translation="MRAHRAILASLALGASVLAASASARPNALPRPDERPSPSRRTPVV
FT                   QAVEKVRGAVVNVSAEELVRIRVPSRASSMAELLFGDFFEKPRFRKGYAVSSLGSGVIV
FT                   SPDGYVLTNNHVVERGARFRVGLLDGREINAKVVGTDPSSDLAVLKLETKERLPFATLG
FT                   RSDDLLIGETLIAIGNPFGLSHTVTTGVVSAVHRNFRAGDRMLFDFVQTDASINPGNSG
FT                   GALLDIEGRLVGINTAILGDRNAGIGFAIPIDRARRIAEDLIAHGEVREGYVGVAVDDL
FT                   PAKDGAAEGASGGVVVTGVDPGSPAAKAGVKKGDVVEAVQGFAARSAEEFRFRMRDLPI
FT                   GQAARLELVRGGKRIALSVPSVELSPEAAAQLATRSTGLTLAEERLHRGSVLIVKTVAP
FT                   ASPAARVGIRQGDLVREVNSTEVATLADFRRAAARARRSGQLVLLVQRGYAAERIAFDF
FT                   Q"
FT   sig_peptide     complement(92444..92518)
FT                   /locus_tag="Anae109_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.812 at
FT                   residue 25"
FT   gene            complement(92522..92755)
FT                   /locus_tag="Anae109_0074"
FT   CDS_pept        complement(92522..92755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24294"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E8"
FT                   /protein_id="ABS24294.1"
FT                   /translation="MADQPENKLVDKRVAQRYLRKGVLDEKDYEKHLKSLPDLADQAMP
FT                   IEASMDSDDRDDLDDVDDEPESPADTGEAPQT"
FT   gene            92836..93504
FT                   /locus_tag="Anae109_0075"
FT   CDS_pept        92836..93504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0075"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase; KEGG: ade:Adeh_0075
FT                   thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24295"
FT                   /db_xref="GOA:A7H6E9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6E9"
FT                   /protein_id="ABS24295.1"
FT                   /translation="MPTSDGSAGAARRARLAGLYAIVGGAAAVEQARAAIAGGARVVQV
FT                   RIKDAPAGAVLAAAREIVALARGRALVIVNDRADLALLSGADGVHLGDEDLPPAEARRL
FT                   LGPDLLVGRTTRTLEEAREALREGADHVGFGPIFPTGSKALAVPARGAGMLREVAAALA
FT                   APVVAIGGIGPANAGEVARAGAACAAVIGALFDAGDARANAERLAAAFEAGRAAREATR
FT                   "
FT   gene            93501..94211
FT                   /locus_tag="Anae109_0076"
FT   CDS_pept        93501..94211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0076"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: ade:Adeh_0076 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24296"
FT                   /db_xref="GOA:A7H6F0"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F0"
FT                   /protein_id="ABS24296.1"
FT                   /translation="MTRPRIGLTLDAEEGAGRYFLGRAYVDAVLAAGGLPILLPHSREA
FT                   AAAYLALLDGLVVTGGFFDVPPELYGEARREACGVTRPERTAFEKEVLEAALAARMPVL
FT                   GVCGGMQLLNVVRGGTLYQDLPQDAGIRGHEQPAPRDVPSHEVVVQPGTHLAALVGAGS
FT                   LQVNSTHHQALREPGAGVLVSARAPDGVAEAIELPDLPFALGVQWHPEAVARHEPRHAA
FT                   LYRGLVAAARDRRR"
FT   gene            94208..94999
FT                   /locus_tag="Anae109_0077"
FT   CDS_pept        94208..94999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0077"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   ade:Adeh_0077 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24297"
FT                   /db_xref="GOA:A7H6F1"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F1"
FT                   /protein_id="ABS24297.1"
FT                   /translation="MTPRGSSARARAPRAPHAGPRVLVVAGLDPSGGAGLLADLEAVRA
FT                   AGAQGWAVAAALTAQGPGGARGFEPASPEILVAQIDALVLGAERPRAVKTGMLATATLA
FT                   RALATRLGERPLGRVPLVVDPVLVASSGAPLFDAEGGGAGDALAPLLARARLVTPNLPE
FT                   LRALTGLDVSTDDAAIRAARALPARAVLVKGGHREGAPLDLLVIARAVVRVPGRRRAGT
FT                   ARGTGCRLASGIAALLAQGASLEEAVRGAKRLVERYLDRMI"
FT   gene            complement(95034..96458)
FT                   /locus_tag="Anae109_0078"
FT   CDS_pept        complement(95034..96458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0078"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: ade:Adeh_0079
FT                   replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24298"
FT                   /db_xref="GOA:A7H6F2"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F2"
FT                   /protein_id="ABS24298.1"
FT                   /translation="MAEHDPVRRVSEAPVAPLRSARDLPHSLEAEQAVIGAILVEETAF
FT                   DQVAALIKSGDFYLLAHQHVYAVCEELARESKTLDPILVQQRLDAKGLLGSAVPRELPL
FT                   SLARAIGTTANVQHYGRTVQELARLRQMMLTAQRVVERGYEAGASVQQFLDSAQQDVFG
FT                   AAQGTGTETLKKIAEPVMRAIENLEAVQKRVQAGLSPITGVPTGIQSLDKNTLGFQPGT
FT                   LTVLAARPSVGKTAFALNIATHAATRAGKKVAFFSLEMPSDQLALRMLASEARLDWRRL
FT                   SAGQLSAYDWQKIATHADKLGAASIWLDDNFVLTPVELRSKCRKLKRENGGLDLVMIDY
FT                   LQLMHAPSDRASQSREQEIATISRSLKSLAKELECPIVALSQLNRGVEKRKGEPPMLSD
FT                   LRESGAIEQDADIVMFLHRNDEDNKDVQSGTASGDTLEVQLVVAKQRQGPTGTIPLVFF
FT                   KTTTYFAEMERRRDGQ"
FT   gene            96711..97541
FT                   /locus_tag="Anae109_0079"
FT   CDS_pept        96711..97541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0079"
FT                   /product="Water Stress and Hypersensitive response domain
FT                   protein"
FT                   /note="SMART: Water Stress and Hypersensitive response
FT                   domain protein; KEGG: ade:Adeh_0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24299"
FT                   /db_xref="GOA:A7H6F3"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F3"
FT                   /protein_id="ABS24299.1"
FT                   /translation="MKKTFALALLALTGAGCAGLSDLARVAFEEPKLSFRSASVEALDL
FT                   EGATIGVKFDLENPNGFGLDVARVGWGVEVEGTRVATGDMPGGLAIPAKGVAPLTIPVR
FT                   VRYQDVPGIVGLLTSRRDAIGYRLSGKVGVRTPIGIVDLPVSHSDRVALPSLPSFSLEG
FT                   VSLRTASFTDMALDVKLRVKNPNAFPIPAGSLDYALSLAGTEVVRAQDTALARVAGGAA
FT                   QIVSIPVRVSVLKAGRAATELARGAPVQLGLAGTADVAGIPVPLDLAATVPARR"
FT   sig_peptide     96711..96773
FT                   /locus_tag="Anae109_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.312 at
FT                   residue 21"
FT   gene            97667..98983
FT                   /locus_tag="Anae109_0080"
FT   CDS_pept        97667..98983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0080"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; KEGG:
FT                   ade:Adeh_3944 magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24300"
FT                   /db_xref="GOA:A7H6F4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F4"
FT                   /protein_id="ABS24300.1"
FT                   /translation="MDADELVDVPLTAEELRDAWPALSWEERIEGFHRLVRAEADDFFL
FT                   ELPPADEAALLLALPPPERRLWIRLLAPDDAADVIQETPEEERPRLIELLDPVARREVT
FT                   ALLAYAEDAAGGLMSPRFARLRPEMTADEAIRYLRRQAREQAETIYYAYVLDPEQKLSG
FT                   VVSFRDLLTAPPDRRISELMKRDVVSVPDTLDQEAVARIMAREDINAIPVVDGQGRMQG
FT                   IVTVDDVVDVVQQEATEDIQKIGGTEALDAPYLDTGLFAMVKKRAGWLALLFVGEMMTA
FT                   SAMGRFEEHIASAVVLALFVPLIISSGGNSGSQASTLVIRAMALGEVGIADAWRVARRE
FT                   ILSGLVLGGILAVLGVVRIFLWQGLFGTYGHQAARLALTVGSSVIAVVTFGTIAGSMMP
FT                   LLIRRLGFDPASASAPFIATMVDVSGVVIYFSMARLVLL"
FT   gene            99113..100504
FT                   /locus_tag="Anae109_0081"
FT   CDS_pept        99113..100504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0081"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_1623 peptidase, M16 (pitrilysin) family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24301"
FT                   /db_xref="GOA:A7H6F5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F5"
FT                   /protein_id="ABS24301.1"
FT                   /translation="MKPVLPLALALAALACASSRGAAGGAEPARATRLSVPLEYHTLEN
FT                   GLRVVLSPERSVPKVAVGVYYGIGFRVEPKDRTGFAHLFEHMMFQGSRSLGKMEFIKLV
FT                   QSNGGTLNGSTRFDFTNYFEVVPSNVLETILWAEADRMRGLAVTQENLANQQGVVANEV
FT                   KVNVLNRPYGGFPWLDLPQVANENWYNAHNFYGDLADLEAATLADVRRFFETYYAPNNA
FT                   VVALVGDFEPKEALAWVERHFGDIRPASQPPRPDLSEPRQEREKRAEKVDPLAERPAVA
FT                   LAWHAPARNTPAHAAFVLLDQMILQGRDSALYQKLVQEQGLTGEVSGGLNLLGNPWNYQ
FT                   GPMLHIAYLFHDKDRSAGEILRAVDEALAPYLERPVEPEALARAKVKARSALYAEMESF
FT                   AGFGLADLLAAHALFDDDPARVSRIEAELEAVTPALVLETAREYLRPTNRTVLLVKTKD
FT                   QGVAP"
FT   sig_peptide     99113..99190
FT                   /locus_tag="Anae109_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.404 at
FT                   residue 26"
FT   gene            100501..101934
FT                   /locus_tag="Anae109_0082"
FT   CDS_pept        100501..101934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0082"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   mxa:MXAN_1624 peptidase, M16 (pitrilysin) family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24302"
FT                   /db_xref="GOA:A7H6F6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F6"
FT                   /protein_id="ABS24302.1"
FT                   /translation="MTVLAAALALALAAQDPAAAAPKQAPPPPRPPPDFRVPGTRSFTL
FT                   DNGLAVTLVEMGQLPKATVALVLRAGTGDDPLEKTGLSSFLGALLTEGTTTRSAADIAA
FT                   AAARWGGAIETNVTPDETVVGGTVLSEFAPELVALVADVALNPAFPPREVERVRQDTLR
FT                   AVTIARTQPQVLAQERFLASLYPDHPYGRLLPTPEIVRGYTVDEARAFHRASYGARRAH
FT                   LYVAGRFDRAATEARIRAALAAMPPGAPREPTPPRPASRRAVELVPRPGAVQSSLYLGL
FT                   PVLDPRHPDYLRLAVANTLLGGYFSSRITANIREAKGYTYSPYSLVSVRAGTGYWAQVA
FT                   DVTTAVTGASLKEIFAEVERLRAAPPGADELRAVQAYLAGTFVLQTSDRDGLIARLRFV
FT                   DLHGLGERWLEEYVKNVRAVTPADAQRMAQAWLDPARITVVVVGDPALVTEQVRPFGEI
FT                   VTAPAAPQPDAAAPSKPRT"
FT   sig_peptide     100501..100563
FT                   /locus_tag="Anae109_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.679 at
FT                   residue 21"
FT   gene            102060..102458
FT                   /locus_tag="Anae109_0083"
FT   CDS_pept        102060..102458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24303"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F7"
FT                   /protein_id="ABS24303.1"
FT                   /translation="MSEEIAHDIRAFLLAYVESYEQLEILLLLHREAAAWQPPGVADAL
FT                   KIPLSSAAASLDELAARGLLRRERGGYRFDPGDPSVACLVAGLARAYEERRVAVIDLMS
FT                   ANAMDRIRRSALRTFAEAFRLRGTKKDG"
FT   gene            102451..102708
FT                   /locus_tag="Anae109_0084"
FT   CDS_pept        102451..102708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24304"
FT                   /db_xref="GOA:A7H6F8"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F8"
FT                   /protein_id="ABS24304.1"
FT                   /translation="MAEAVYLLCALTSIACAALLVRSYLATRVRLTLWSALCFVGLALN
FT                   NVMLYVDHIVVPGADLWLLRTAPAVLGIGVLVAGLVWEST"
FT   sig_peptide     102451..102504
FT                   /locus_tag="Anae109_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.290 at
FT                   residue 18"
FT   gene            102705..102965
FT                   /locus_tag="Anae109_0085"
FT   CDS_pept        102705..102965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24305"
FT                   /db_xref="GOA:A7H6F9"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6F9"
FT                   /protein_id="ABS24305.1"
FT                   /translation="MRGFAWGVLAAGCAVAGLFFLRFWRESRDRLFAGFAAAFFILCVN
FT                   WLVLGITNSGDETRHNAYVLRLVAFLVLIWAIVDKNRRSAR"
FT   gene            complement(102967..104379)
FT                   /locus_tag="Anae109_0086"
FT   CDS_pept        complement(102967..104379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0086"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; AAA ATPase;
FT                   KEGG: ade:Adeh_3091 sigma54 specific transcriptional
FT                   regulator with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24306"
FT                   /db_xref="GOA:A7H6G0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G0"
FT                   /protein_id="ABS24306.1"
FT                   /translation="MIPSLPYLGLGSAESLQQVADAFPDGVFTTDRDGVITYWNPAAGA
FT                   ITGYSAAEAIGRTCALLAGDMGRGCMCGGGPVRCGISDRGKSSKCCSIRTKDGRERLIV
FT                   KNAVAFHGPDGTVAGALESFTDVTDLSVGAIPWESACALPAPSAGVAAAAEAAPPESEC
FT                   AGLLGCHPVMRELYRMIALVARSDATVMILGESGVGKERVAEAIHRQSRRAAGPLVRVS
FT                   CSALNENLLESELFGHVKGAFTGALRDRRGRFQEAHGGTLLLDEIGDISPAVQVKLLRV
FT                   IEQRVVERVGDSQPLPVDVRLLCATHRDLKQLVTDGRFRADLYFRLAVFPLRVPPLRER
FT                   AEDVALLSEGFLARLGAPPPSPEASRLLAAYAWPGNVRELQNVLEYAALQAGGAPISPA
FT                   HLPAEIRGAAPPTPERAAPDRSAIVEALIRTGWNRARAADVLGISRVTLWKRMKRLGVV
FT                   GPGPMASGREPL"
FT   gene            complement(104672..108121)
FT                   /locus_tag="Anae109_0087"
FT   CDS_pept        complement(104672..108121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0087"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: ade:Adeh_0085
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24307"
FT                   /db_xref="GOA:A7H6G1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G1"
FT                   /protein_id="ABS24307.1"
FT                   /translation="MTFREAIDRRPLVFDGAMGTQIQRHQLTAAEFGGKDGANDLLTLT
FT                   RPDLVEDIHARYFAVGCDVVETNTFGSSRLKLDEYGLGHRTYEVNFRAAILARRAAERF
FT                   ATPDHPRFVAGSMGPTGMLPSSSDPALGNITSDALERIFFEQAKGLIEGGVDALIIETQ
FT                   QDMLELRAAVLAADACRKEFLRDVFIIAQPTLIDANGRMLLGTDVASALATLERLPVDA
FT                   VGLNCSTGPAEMRAAVRTLAEKSSHYVSVLPNAGMPENEDGRAVYKLSPAALADALAGF
FT                   VAEYGVELVGGCCGTTPEHMRAVVERVRGLRAPRRARPAPAPELSSAMKAVPLAMEPRP
FT                   LIVGERLNSQGSKKVKELLLADDYAGLLQIARGQVDAGAHVLDVCVALNERDDEGAQMR
FT                   TLAKLLAQAVDAPLMIDSTEADVVEGALKVYPGRCIVNSVNLEKSGERVRKILPLVRRY
FT                   GAAVVAMTIDEKGMAQTAERKAEIARRTVAIARDHGIPPDSLVFDALTFTLATGGEEYR
FT                   KSAIETLEGIRRIKAENPGVLTTLGVSNVSFGLAKSAREVVNSVFLYHAVQAGLDLAIV
FT                   NPKDIRPYPAIAEEERVLAEDLLLDRRPDALARLIAHFGAKGAPEKAAVDPLAAAGGKS
FT                   AEERIHLQILHRRPEGIEALIDDALTRRSAVEVLNQVLLPAMKDVGDRFGAGELILPFV
FT                   LQSAEVMKKAVAHLEQFLEKKEGATKGTVVLATVYGDVHDIGKNLVKTILANNGFTVHD
FT                   LGKQVPIATVIEKAVAANADAIGLSALLVSTSKQMPFCVEELARRNLSFPVIIGGAAIN
FT                   RRFGYRALFTQGGAPYPGGVFYAKDAFEGLEVVEALVDPARREGLKQGVLQKAIANRDM
FT                   PASPVPPPAPARRSGVAPALRIPSPPFWGARVVPAGEIALAELWPLLDLPELFKLQWGV
FT                   KAKGEEYERLIREQFGPKLEELKAEAQANGWLVPKVVYGYFPCHAEGNDLVVLDPTHRK
FT                   AEVARLVLPRQPDDRNLCMADWFREERGSDVCALQVVTVGDQATHLAEAAQERGDYSRG
FT                   LFVHGLAVEAAEALAEYWHRRVRAELGVPEGQGKRYSPGYPSWPELADQRQVWKLLEPD
FT                   RTIGVSLTEANQMVPEASTSAIVLHHPDAIYFVVRGATAAAV"
FT   gene            108328..109401
FT                   /locus_tag="Anae109_0088"
FT   CDS_pept        108328..109401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0088"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ade:Adeh_0086 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24308"
FT                   /db_xref="GOA:A7H6G2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G2"
FT                   /protein_id="ABS24308.1"
FT                   /translation="MLHEARYWEPAEGGRVLCTLCPRACRIGDGQAGFCFIRQNRGGRL
FT                   LTAGYGRSTGFAVDPVEKKPLAHWLPGSAVLSFGTAGCCLGCRFCQNWDISKARLDDRA
FT                   AEDRWSPERVAALAVEAGAAGVAFTYNDPIIWAEYAIDVAEAAHARGLYTVFVTSGYVE
FT                   PAARAEIFRHMDATNVDLKAFTEDFYAKVTLAHLAPVLDTLEWLARETDVWVEVTNLLI
FT                   PGLNDAEDETRRLADWVAAHMGVDVPLHFTAFHPDYKLRDRPRTPPRTLSHARELARAA
FT                   GLRHVYTGNVHDPEGQTTFCPRCGARVIERDWHAVRAVRMARGACAACGERIAGRFADG
FT                   PVAPTSGRRVALGLPDA"
FT   gene            complement(109424..109720)
FT                   /locus_tag="Anae109_0089"
FT   CDS_pept        complement(109424..109720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24309"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G3"
FT                   /protein_id="ABS24309.1"
FT                   /translation="MRRLVTALAFALLSACTEPCQELANRFCECAGGGSSQDSCERGAE
FT                   DRLSDVGAGDAKQKQCEGWLDTCHAPSGAEFCEWISTADAKEKCGISLAADAP"
FT   sig_peptide     complement(109652..109720)
FT                   /locus_tag="Anae109_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.901) with cleavage site probability 0.256 at
FT                   residue 23"
FT   gene            109810..110433
FT                   /locus_tag="Anae109_0090"
FT   CDS_pept        109810..110433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0090"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: ade:Adeh_0088 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24310"
FT                   /db_xref="GOA:A7H6G4"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G4"
FT                   /protein_id="ABS24310.1"
FT                   /translation="MIAALAALLLAAAPPPADAGQLARKVQTFYERTRDLEARFQQTYT
FT                   YSGFGRRQVSAGTLKVKKPGMMRWDYETPAPKTVAVKGSRLVQFEPEENQAYVDERFDA
FT                   TAMSAAVTFLLGKGDLAREFGLSTDGTGALVLRPKEEDPRVESIALTVGPDGEVRATRV
FT                   VDGAGNVNEIRFEKVKRNAGLPDGAFEVKLPKDVRRIAPPGAER"
FT   sig_peptide     109810..109869
FT                   /locus_tag="Anae109_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            110443..111909
FT                   /locus_tag="Anae109_0091"
FT   CDS_pept        110443..111909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0091"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; KEGG: ade:Adeh_0089 protein of unknown
FT                   function DUF853, NPT hydrolase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24311"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G5"
FT                   /protein_id="ABS24311.1"
FT                   /translation="MSPPAPLLVAKSTQELLLLPGLANRHGLVAGATGTGKTVTLRVLA
FT                   EGFSRLGVPVFLADVKGDLSGLARPGGDSPKIVERARELGLALAPEASPVVFLDVFGEA
FT                   GHPLRTTISEMGPLLLARVLGLNETQAGVLQVAFRVADEGGLLLLDVKDLRAMLEHLSQ
FT                   QAAELRQRYGNVAPASVGAIQRSLLALEAQGADRLFGEPALALEDLLRTDLGGRGQVTI
FT                   LHAERLVRAPQLYATLLLWLLSELFEQLPEVGDPEKPRLVFFFDEAHLLFDDAPDELRA
FT                   KIEQVVRLVRSKGVGVYFVTQNPLDVPDAVLGQLGNRVQHALRAFTPRDQKAVRAAAET
FT                   FRPNPGLDVEAAITELGVGEALVSFLDAKGTPAPVERALVVPPRSRLAPLTPEERAQVL
FT                   SASPLRGRYDAAVDRESAHELLQKRAAEREAPAREEAPRGRQEPGALGGAGDMLGKMAT
FT                   SAVRAAGTQIGREIMRGILGSMFGGGRRRR"
FT   gene            complement(111947..112720)
FT                   /locus_tag="Anae109_0092"
FT   CDS_pept        complement(111947..112720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0092"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mxa:MXAN_5335 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24312"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G6"
FT                   /protein_id="ABS24312.1"
FT                   /translation="MPQEVVLVVPCYNEAARLDRAELLRLARARDGLALLLVDDGSTDA
FT                   TAAALEELRRAEPARISVLSLARNSGKAEAVRAGLRAALASGAAFTGYADADLSTPVDE
FT                   LLRLVDVAAASSRDAVMGSRVRLLGWRIERRAHRHYLGRVFATFASLALGLPVYDTQCG
FT                   AKLFRATPALAAALEAPFRTRWIFDVELLARLRAGGPGAPPLAAEAFEEVPLRAWRDVG
FT                   GSKLRPGAMLAAGLQLLVLALRLRLRLRLRLGSRR"
FT   gene            complement(112705..113502)
FT                   /locus_tag="Anae109_0093"
FT   CDS_pept        complement(112705..113502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0093"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bch:Bcen2424_1485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24313"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6G7"
FT                   /protein_id="ABS24313.1"
FT                   /translation="MRWIPAGFRATVPAMDLVELESGAPVRRHPWEEARLAFFLRVLRG
FT                   AGLLRSRVAVLDVGAGDGFIARRLAEELAPGSTVTCWDANYTAAHLASPAFAPTGRLHF
FT                   TRAAPADAFGLALLLDVLEHVADDLGFLSEVVARRLLPGAHALVSVPAWPALSSSHDEG
FT                   LRHHRRYAPGAARALLAGAGLEVVRGGGLFHALIPPRAAQVALERLRHRPRPPAELGGW
FT                   SAPAPVTALVRGALSLDASLSLLLSRLGIDLPGLSWWALCRKR"
FT   gene            complement(113569..114981)
FT                   /locus_tag="Anae109_0094"
FT   CDS_pept        complement(113569..114981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0094"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: ade:Adeh_0093 hypothetical protein; TIGRFAM:
FT                   RNA modification enzyme, MiaB family; MiaB-like tRNA
FT                   modifying enzyme YliG; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24314"
FT                   /db_xref="GOA:A7H6G8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6G8"
FT                   /protein_id="ABS24314.1"
FT                   /translation="MATTRVYLHTLGCPKNRVDSEVMLGTLTGAGYRLERDPAQADVIV
FT                   VNTCGFIESAKEESVDAIVELAGMKQEGRCKKLVVTGCLVQRHAEELSAELPEVDHFLG
FT                   TGAYAEIARVVSDAQAKRLVVPDPDFVHSAATPRVNSLPSHTAYLKISEGCDNACAFCI
FT                   IPKLRGAQRSRPVDDVVAEAAALAAQGTVELSLVAQDLTAYGYDLPGKVRLHHLLPELC
FT                   KVDGIRWLRLHYAYPRDVPDALVEVIAREPKIVKYLDMPLQHSSDRLLRSMKRGRDSVF
FT                   LRELLARLRARVPGIALRTSLIVGLPGETEEDFEDLVRFVEEQRFERLGVFEFSPEDGT
FT                   PAADMAEQVPDVVKRARRDRIMALQQEISREHQRAMVGRRLEVLVEGRAEETEHLLAGR
FT                   HAQQAPEIDGITYVNDGVAYPGELVTVEITDASEYDLVGHVVARDPERARRPLPAPAGG
FT                   ETPRRGGLPVVG"
FT   gene            complement(115040..115528)
FT                   /locus_tag="Anae109_0095"
FT   CDS_pept        complement(115040..115528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0095"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   ade:Adeh_0094 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24315"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6G9"
FT                   /protein_id="ABS24315.1"
FT                   /translation="MPSFDVVSELNLMEVENAFNQARKEILQRFDFKGTSTDLERDKDE
FT                   NVVVKAGSEGRAEAALQVLMEKLAKRGVPLEGLDPQKLEPASGGSVRQLVKLKRGLKQE
FT                   DAKRIVALMKESGLKVQAAIQGEAVRISGKKKDDLQAAMQAIRTGGLGVPLQFQNFRE"
FT   gene            complement(115610..117262)
FT                   /locus_tag="Anae109_0096"
FT   CDS_pept        complement(115610..117262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0096"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   ade:Adeh_0095 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24316"
FT                   /db_xref="GOA:A7H6H0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H0"
FT                   /protein_id="ABS24316.1"
FT                   /translation="MAPPVRIVPLGGLGEIGMNCMAIEADGRMAVVDCGILFPNEPIGV
FT                   DVIAPDLGWLRERREQVGAIYLTHGHEDHIGALPFLLREVKAPVYGTRFTLALLRPRLE
FT                   EAGVEADLREVAPGDARPAGEASPLSAEFYAVTHSIPDACGLALSTPQGTILHSGDFKI
FT                   DPRPISGPGFDLARVEALGRRGVRLLLSDSTNSERPGSSLSEAEVGAALEEAFERAPAR
FT                   VFVACFASNIHRIQQVANAARAFGRRLALLGRSMETNVRLAQALGYLELPGWMPVGFPE
FT                   ARELPPKELCVLTTGTQGEPRSALARLARGEHLDLDVAPGDLVVLSSRFIPGNEVAVGE
FT                   LVNALCRRGAQVAYEGLRPLHVSGHAQEAEQRRLIALARPEHFVPIHGEYRHLARHAAH
FT                   AAAEGVRGRHLLLDGQVLELGDLGATVLEEPVPVGRVYTDRDALLGQDIGALVVKDRRL
FT                   LAEAGLCIAVLAVDKVTGAVIRGPELFARGVAGFEGAEEEIRAEALRALDELTPQARVA
FT                   IEEVQETLRVAVRRFLKRTTGKRPTVLPVVLEL"
FT   gene            117655..118596
FT                   /locus_tag="Anae109_0097"
FT   CDS_pept        117655..118596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24317"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H1"
FT                   /protein_id="ABS24317.1"
FT                   /translation="MGRADPKLVRLRFDWPAAAEVQATQRRTRTRTGHAPVTTTTRFTQ
FT                   RLERREGALRISTSGTTWEGDAPYPGPPAAVEGVLRAAERVVQVVSPEGEFRGLEGVEA
FT                   LRPALARVLAGSVPPEQVERALGFAESSMQAQAQEMWNLAVGFWIGADLELGERYGMRT
FT                   EAEVPLAHAEAEFEQEFSVRRRVPCSARDREERCVEVTLRSAPDPAALPALARGVVAQL
FT                   AGGEAPVAAEALRELVVENELLLVTEPARLLPHRVVWTRTVRATAAAGEGAGGEPRLLE
FT                   QVDRHEADYRYDAPRKKPPRKPKRAQPRSASR"
FT   gene            118647..120986
FT                   /locus_tag="Anae109_0098"
FT   CDS_pept        118647..120986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0098"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: ade:Adeh_0097
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24318"
FT                   /db_xref="GOA:A7H6H2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H2"
FT                   /protein_id="ABS24318.1"
FT                   /translation="MAPPDPLLEGLNDAQREAVLHGDGPLLVLAGAGSGKTRVIVHRIA
FT                   RLVRDERVMPWHVLAVTFTNKAAGEMKDRLEALLGTQASELWVQTFHAFGARFLRREAA
FT                   RAGLPPSFAIYDDDDQIRVVKRIFQELRVEDGEPLTARQALSRIDRWKNAALRPAEVVV
FT                   GEYDVEGQLAREVYGRFEAALARAGAVDFGDLLLRPVRLLEEDATVRRAWAGRFRYLLV
FT                   DEFQDTNAAQYRLLKLLANEKRNVCVVGDDDQAIYRWRGADVTNILEFDQGFPGARVVK
FT                   LEQNYRSTRTVLDAAHAVISKARRRREKRLWTESGAGETLALVVGQDEHDEAERVARAV
FT                   AAERARGTAGEEIAVLYRTNAQSRPLEAALRAARIPYVIVRGTSFYDRAEVRDAAAYLR
FT                   LALSPRSDLDLERVLNRPARGVGEKTLERLRAHASARGIALFDAIAERDAVEDLKPAAR
FT                   RALGEFHALVAGLAADVPALDAGIAVQEALKRSGLLARLEAEHTDEAVERAENLAELVA
FT                   AAREFDESLLGEPPPRDPEEVRPPPLARFLEQIALLGEADAETPEGRVSLMTLHAAKGL
FT                   EFEAVFLAGLEDGTLPYERPWSDAGPAEREAAEDEERRLCYVGMTRAKKRLTLSLARRR
FT                   IGYGEGGPSYRSMEPSRFLADLPPELFGLAPRLASAPAARGPVIRRPPGSLPGEPHIEL
FT                   EEDGPREPPPPRRPAAARAGPVVDYDFDQRPRAAGTIARGTRVAHESLGEGTVAACEGS
FT                   GPGAKVTVFFDEVGEKRVLARFLRPA"
FT   gene            complement(121028..122860)
FT                   /locus_tag="Anae109_0099"
FT   CDS_pept        complement(121028..122860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0099"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG: ade:Adeh_3317
FT                   spore coat assembly protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24319"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H3"
FT                   /protein_id="ABS24319.1"
FT                   /translation="MVLPAGGLPVRPRRIARCPVNRQAPFLVAAILSLACGRGDGTTVV
FT                   RPPDEQPPPYQPPQQQLPPPGPSWPVASAPGAFPTPEPRLRRVDLTLAPGDLAALEAEP
FT                   TWDVMYPATVALDGRAAEGLVRFRGASSRTRPQRSWRIDLDPGYALEGRDRFALLAEYD
FT                   DAAKLVERFAVDLYRALGLPVPFARYVKLYVNGAYRGVFLDMERVGGEYLVHHGHETDA
FT                   SLYRCGGRNCELKLLPRYEPAYQQDFTKTRNEALPWDDLDRLLETVSRTDDAELERRLG
FT                   EVMDLDAYLGNLAADELIANTVLEDARGYWLHELHRDVWTYVPWDLNNSQAYWSRDIAA
FT                   NAPLGGVWREAQIFSIYDDAVRRIYDVRVTERAGQKPTWSVLATRVWDHPALRARLLAK
FT                   LEAALAGPFTPERVGPYLEALWAAAGPEIVTDPFVDATRAQTVPSRLVTFVRDRRSVLL
FT                   GRLARLRAHGSGPLVVNEVGMPGGTGPGYVELYNRADVALDLSGAHVTDDLRAPGKYAL
FT                   PEGTTIPPRGHLLLVADGTPWPPPAGAPAGEPLRLPFVLSPAGGELGVFAPGTLHAPYD
FT                   LVYFGPRAEGGAYGRTGDGVEAWSDVARTPGAPN"
FT   gene            122928..124052
FT                   /locus_tag="Anae109_0100"
FT   CDS_pept        122928..124052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0100"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="TIGRFAM: adenosine deaminase; PFAM: adenosine/AMP
FT                   deaminase; KEGG: ade:Adeh_0098 adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24320"
FT                   /db_xref="GOA:A7H6H4"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H4"
FT                   /protein_id="ABS24320.1"
FT                   /translation="MPSNAGASPMPVTDELLRALPKTDLHCHLDGSLRLTTLLELAEAQ
FT                   GVRLPADTPEGVGRAVRMGAQCASLEEYLTAFDVTLSVLQTEDALRRVAYELALDCAAE
FT                   NVRYLEVRYSPVLHTRKGLKPTAIVDAVLDGLRAAGRESGIRSNVIICGIRHIDPQTSV
FT                   RLAELAVAYKGKGVVGFDLAGAEEGHPASRHREAVQLILDNNVNVTIHAGEAFGPESIA
FT                   QAVHTCGAHRIGHGVRLRENGDLLNYLNDHRIPLEMCPSSNVQTRSVTGYESHPLKFYF
FT                   DFGLRVTVNTDNRLITDTTITKELRLAHERMGFTLEDLCTLLVQGFKSAFLPFREKAEL
FT                   LRDVNAEIAAVLARFAGPGAGGPAAAVTEAVAVR"
FT   gene            124220..125455
FT                   /locus_tag="Anae109_0101"
FT   CDS_pept        124220..125455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0101"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: ade:Adeh_0100
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24321"
FT                   /db_xref="GOA:A7H6H5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6H5"
FT                   /protein_id="ABS24321.1"
FT                   /translation="MAKLLAMILAGGEGRRLDPLTRERAKPAVPFGGRYRIVDFVLSNF
FT                   ANSGVLKMKVLVQYKSESLNAHIQRGWRLTALLDQYVEIVPAQMRVGPKWFEGSADAIY
FT                   QNLNIITDEEPEFTFIFGADHVYRMDVRQMLQFHQDKGADLTVAAIPVPVEEASEFGII
FT                   EVDGDGRMIGFVEKPKAGVKTMPGDPTRALASMGNYLFTTDALVQEIVRDAGDTKSAHD
FT                   FGKSIVAAMYERKRVFVYDFAKNVVPGQGDKERGYWRDVGSLDAYYQANMDLVDVDPSF
FT                   SLYNDRWPIFTAQHNFPPVKFVFNNQTEGRVGYATDSLVSEGCIISGGHAHHCILSPKV
FT                   RINSYSLVEDSILFENVNIGRHCKIRRAIVDKHVEIPANTTIGYDLEHDRKRFHVTESG
FT                   IVVIPKAMRVEP"
FT   gene            complement(125494..125883)
FT                   /locus_tag="Anae109_0102"
FT   CDS_pept        complement(125494..125883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0102"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_0101 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24322"
FT                   /db_xref="GOA:A7H6H6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H6"
FT                   /protein_id="ABS24322.1"
FT                   /translation="MALTPPAPIRILLAEDDAALAKLYASYATGRGHAVSHARDGVETL
FT                   AAALSQLPDVIVLDVAMPALDGRDVLLRLKADPRTAGIPVLVVSALGGDQHMRDLLVEL
FT                   GASDVMEKPVDLQIAFNKAERLVNG"
FT   gene            complement(125964..128570)
FT                   /locus_tag="Anae109_0103"
FT   CDS_pept        complement(125964..128570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24323"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H7"
FT                   /protein_id="ABS24323.1"
FT                   /translation="MIRRSLALLAAALAPPALAAAPGDPLTAARRQGEIVLDGRLEEPG
FT                   WALAPAYDGFVQIFPSEGAAPSERTEVRVLFDDRALYVGIAARDRSPGEVRRPLGRRDR
FT                   APYSDAVTVIVDSMHDHRAAYAFEINAAGVQSDALLFEDDTSTSDWDAVWEGATAALAD
FT                   GWGAELRIPLAALRFSNAPVQTWGFAVKRVVARRHEELLSVHLPRGARGQLARMGSLTG
FT                   LQGLAPVQDLEVAPYTAARLAFRPRVSDVPSPRDADPVGDVGVDVRASLGRALSLQGTV
FT                   NPDFGQVEADEIIQNLSSFEIFFPEKRPFFTQGMDLFQPVALPGRRSPQQLFYSRRIGL
FT                   DAPILGAVKLVGKPTGTLQVGILDALVTGAGSGLPEASPDRSFRLDAAQPFHFGPRSSL
FT                   PELAPAPRNFLAGVARWQPAPGRTLGATVTSTLPLGPGCSISDAEKDDEAEDPRERRPA
FT                   RCDALSGSAAALDWSLRSRDGEWFLLGQVTGSQSLGGAPARAAPGAPVSSPRRTLADGT
FT                   VLDEGELGYGAHAAVGRAGGEPWRFELHWEYESPTLDLNALGYQRTQNEQLGRALVRYV
FT                   RPSGGGPFHTYSVVSGVQGQRTTDGRGLARMKQLWLSAEAQLRSYQWVGCTGVVELRAW
FT                   DVREIEESGVALERPRSTFGECWLSLDPSKAVFLEGGAGMGRSEALGPVQGQRYWGTSG
FT                   VVVVRPHARVESRFDVRYEVSRWGARYVDEPAPGVYRFAGLEAPSLSVTLRQQVVLTPR
FT                   LTLQGYVQLFTSFGEYRAFRQASGVDRKVTLASLSPAEAPGPSENDFREGALNLNAVLR
FT                   WEYRLGSTLYLVYTRAQRELEWDGSAPLASTLRPVALGAGPATDTFLVKWTYYWAR"
FT   sig_peptide     complement(128511..128570)
FT                   /locus_tag="Anae109_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.941 at
FT                   residue 20"
FT   gene            128699..131703
FT                   /pseudo
FT                   /locus_tag="Anae109_0104"
FT                   /note="peptidase M16 domain protein"
FT   gene            131783..133168
FT                   /locus_tag="Anae109_0106"
FT   CDS_pept        131783..133168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0106"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_1782
FT                   PAS/PAC sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24324"
FT                   /db_xref="GOA:A7H6H8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H8"
FT                   /protein_id="ABS24324.1"
FT                   /translation="MPAPAGKTGRWFGLPKRVALGFAVAIGSLIASGILTGVTLGKRTD
FT                   ASVAAELAADTQLALEELESAMLVADTALDAYLAGGEARHRARLQRARDKIPGELDHLT
FT                   RAIAAERIDEDGELLGRLRPAVKRMVDALDRAAALADAGGREEARLHRLAEGVPPFDRA
FT                   HAALEAVEEREKSEVARAAAWAHRARIISNGVFLGLDTILLLFVLGAARVVRQEIRARE
FT                   EHEAELARTQAVQQRLVAVVSHDLRNPLSGILTASWALARVSLPDDALRAVRRITAAGR
FT                   RMERLIRDLLDWSRAKAGAEIPVTLLEADLWDVCTRVAEDLCDPRCQRLELARHGDTRA
FT                   EFDPERMEQVVANLVSNALKYGDPDRPVYVEAAGEEGAVRIEVRNEGPPLDSATIAAIF
FT                   EPFHRAPRDHPDSRTSVGLGLFVVRTLTEAQGAEVNVHSSVGQGTTFVVRVRRAVRAEA
FT                   RAG"
FT   gene            133380..134312
FT                   /locus_tag="Anae109_0107"
FT   CDS_pept        133380..134312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24325"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H9"
FT                   /protein_id="ABS24325.1"
FT                   /translation="MADLQNEFSWSKSRHEKFAECRRAYFYAYYGSWGGWEAAPGTPVR
FT                   ELYVLKKLSSRWQWAGSVVHDALKQMLSRARVTGDFLPLERVLERTRTRARAQFAVSRE
FT                   KSYWREASRIVGLVEHEYGDAVADEDWRRLYEGVVDGSLRAFYASPTFEEIRRTPRERW
FT                   LSVDELDSWEFEGTKIWVAIDFAFRDSDGQVRILDWKTGKERGVDHTQVGIYALYAQRK
FT                   WSAPPDQVLGGLVYLVANGAGAGGETVSVAADPAALERCQSEMRHSIGEMKATLQDPAR
FT                   NHALIDQFPQRAQRESCRRCPFRRPCGRM"
FT   gene            complement(134395..134703)
FT                   /locus_tag="Anae109_0108"
FT   CDS_pept        complement(134395..134703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0108"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; Stress
FT                   responsive alpha-beta barrel domain protein; KEGG:
FT                   cte:CT1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24326"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I0"
FT                   /protein_id="ABS24326.1"
FT                   /translation="MVKHLVFWTLKEQADGASREENARRVKAALEGLAGRIPGLLELEV
FT                   GIDFSRGEASYDVALSSTFADRAALDAYQAHPEHRAVADLIGRVRERRAVVDYETGS"
FT   gene            complement(134709..135317)
FT                   /locus_tag="Anae109_0109"
FT   CDS_pept        complement(134709..135317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0109"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ade:Adeh_0105 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24327"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I1"
FT                   /protein_id="ABS24327.1"
FT                   /translation="MSGRTAASGGAPPPRRAPRAPRLRAGDVADAPALARVMRAAIRGQ
FT                   GAAAYGHSEVRAWSSLPALYHRWAMTAGGERYVVAERDGAIVGYAARRDAELTAVFVLP
FT                   RAAGAGVGTALVRHVERAARRAGVARLRVVAALGAVPFYARLGFGRRGAARVPLPGETS
FT                   LAAVRMEKRLDSTAGAPGERSARRAARSSGRARVRPRGR"
FT   gene            complement(135314..136687)
FT                   /locus_tag="Anae109_0110"
FT   CDS_pept        complement(135314..136687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0110"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ade:Adeh_0106
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24328"
FT                   /db_xref="GOA:A7H6I2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I2"
FT                   /protein_id="ABS24328.1"
FT                   /translation="MTKPNLMVIDDLDSARQMMKRTLGRSYAVFDFASVAEALPAVERA
FT                   EFDAIVTDLRMPGIDGIEGMRRFKERVPEIPVILVTAFATVETAVEAMKAGAFDYLKKP
FT                   FEPEELELVVARAVEHARIKRDNARLRSALAGEFGVHGIIGKSQPMKALVEMLGRIAPS
FT                   DVPILVEGESGTGKDLLARAAHAMSRRASGPYVALNMSAIPENLAEAELFGHEKGAFTG
FT                   AEQARAGFFAEAEGGTLFLDEIGLLPPALQPKLLRVLQDGEYIPVGSRKARKGNVRVVA
FT                   ATNEDLARAVKEGKFREDLWFRLRVVPLRLPPLRERKEDIPLLVHHFVEKHALRLGRPP
FT                   LEPDAEAMRALLDHPWPGNIRELEHAIERGLLLARGETITLADLPPELAQPAAEAAAGG
FT                   AEGRYRRARDAWERKFLEDLLREAGGNVAKAAEAAGLHRSTLYEKLQRYGLVEKDAKA"
FT   gene            complement(136726..138219)
FT                   /locus_tag="Anae109_0111"
FT   CDS_pept        complement(136726..138219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0111"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ade:Adeh_0107 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24329"
FT                   /db_xref="GOA:A7H6I3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I3"
FT                   /protein_id="ABS24329.1"
FT                   /translation="MTLRLKLFVLIAGVIIFAMSGVTAVALWREVVRGQELLAREGVAI
FT                   ASTAATAAAHWVRADGVDPGGASALPAVLERVVASAPLDRAWIVDRTGKVLACVTRTEE
FT                   ACPEGAPPSEFQLAESPLQALGRLLQPEGIVASAPILRSGAVVGAVRVDFTHEEVVGNA
FT                   RNLAWGASIVAAFWIFVGQLLAAIFLRRVTSPLVRLSEAAESLAEERGVRLEEPEEREL
FT                   ADLVRAFNDMSRRLDDRRSENQRLIAELEARVAQKTREVLRADRLATLGGIAAGFAHEI
FT                   GNSLNVIRGYASVAARELPADAEVKSDVEAIRREVTRAAGLIERFLVFARARTVHPIAQ
FT                   PVEPILREAVEVVGPAAAHANVERVVEIAPALPEVVADGELLRQAFLNLCVNAVQAMQE
FT                   RGGGTLVARARREGDGLVVEVSDSGPGLPRDIAAHVFDPFFTTKANGTGLGLAIVRQAA
FT                   EAHGGTVEVESAPGHGATFRIRLPVAPAEPAAAGAGAAP"
FT   sig_peptide     complement(138145..138219)
FT                   /locus_tag="Anae109_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            complement(138216..139124)
FT                   /locus_tag="Anae109_0112"
FT   CDS_pept        complement(138216..139124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24330"
FT                   /db_xref="GOA:A7H6I4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I4"
FT                   /protein_id="ABS24330.1"
FT                   /translation="MRLGRTAKTLLLAVAALAVAAAVAGGLRFKRYVDEDPRLCATCHQ
FT                   ASPEFALWMQGTHKSVACQRCHHARPEQGVAMLGAFLLGKAPAGHGGVEIGSCAECHFS
FT                   HDPRWPQVGGSRGHRIHYEEHKIACVRCHAASMHGFEPIAAKCADCHPGHAVRVHGMEG
FT                   MHCFACHEFLGDEPGLRPTRRDCLRCHTAQGIHAPVGEHGAPMAMACATCHRPHAPPGE
FT                   TLVSCTHCHDAPATRRAGLHANPGHFRCLDCHPAHTWTPEPARCLRCHAHAQSHAHGKS
FT                   CTACHEFGGAPRPPPRGESSP"
FT   sig_peptide     complement(139050..139124)
FT                   /locus_tag="Anae109_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.916 at
FT                   residue 25"
FT   gene            complement(139242..140975)
FT                   /locus_tag="Anae109_0113"
FT   CDS_pept        complement(139242..140975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24331"
FT                   /db_xref="GOA:A7H6I5"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I5"
FT                   /protein_id="ABS24331.1"
FT                   /translation="MHTRTPPMRAILLSFALLLAPAARAEGPKLPEGSDTCLQCHSPGG
FT                   DGPTVHADTFAKSVHAENGVACTDCHAGYTEEHAMGGTLPPLSDAEQQFVARLEKGTFG
FT                   EEGQKVAVTSPRAYLACQNCHTEQTDAFAASIHSKWLREDTKASGPTCASCHGSVHAVK
FT                   SLAFYDPKAEARQPVPADRREMTRRCEGCHGNEEFAAVAGLKPEATVNYHDSIHGRMVR
FT                   VGNAFAPVCVSCHAAPQGKGGTHAIVAKTDPNSIVNVANRKDACARCHAGATDNFASLI
FT                   AHETPQETGGHPVPHVIHIAFSYLTTLTLLFFAFHVVVDFVYELRQRLKAKQGHGPSAD
FT                   AVRSVIRFDIHQRIQHWFMLSGVILLGITGWPLRGAGTFGNAPIIGGRDAAPYSEAFMK
FT                   IFGGAEGAALWHRVGAVLIIISAAYHLFYLTFLASQKRLPLSMLPGPKDALDMRDNILF
FT                   MLGVKKERPKFDRYMYLEKFDYWAVFWGIVMMVGTGFIFWFPAFFAAWAPSWLITAALI
FT                   IHGEEATLAILFLFVVHFYNVHLKPSIFPMNWAWLNGRISVEMMKHEHPLEYDRMSDEQ
FT                   K"
FT   sig_peptide     complement(140898..140975)
FT                   /locus_tag="Anae109_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(141167..141526)
FT                   /locus_tag="Anae109_0114"
FT   CDS_pept        complement(141167..141526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24332"
FT                   /db_xref="GOA:A7H6I6"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I6"
FT                   /protein_id="ABS24332.1"
FT                   /translation="MRCGSPGPFRPQPTRRTEMQSKTPSLIGAGIGLALFLAVALLPAM
FT                   LYGGYAGVLLAGGIFGTPLQATFLVRGLIVFGIVLGVAGVGSLFAVMGAAAGAGVGALT
FT                   SLASRKPAAQEASSK"
FT   gene            complement(141708..143450)
FT                   /locus_tag="Anae109_0115"
FT   CDS_pept        complement(141708..143450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0115"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; KEGG:
FT                   ade:Adeh_0111 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24333"
FT                   /db_xref="GOA:A7H6I7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I7"
FT                   /protein_id="ABS24333.1"
FT                   /translation="MPIAPAALAAALLTVAAPDLSTTAERTAFERTGRHDEAVGLCRAF
FT                   AKAFPRRARCVSFGVTPERRQLVALVASADGVLTPHAARARRRPVVLFQGAIHAGELDG
FT                   KDAGFIALRGLLAAKAGPLSRVTAVFVPIFNADGHERFGPQQRPNQRGPVEAGWRATAA
FT                   NLNLNRDYAKADAPETRAMLGLLRKWDPIVYADLHVTDGAQFQHDLAVMVEPRLGYAEA
FT                   LRPEGAALSAALLARLTAAGHLPLDFYPSFREDGDPASGFAAGVAPPRFGHGYWAARNR
FT                   LGVLLEAHSWRPYGERVRGAVAFLRALLELAAEHGPRWRAAADRADREAPALAGREVAL
FT                   SFEPTGAATTLAFRGYAYVREPSVVTGAQVSRYDESRPELWSVPFLGELRPAVRAVLPR
FT                   GGWIVPAGWAEQVASTLATHGVIFERLGQARPAREVEVFRAADARFRAEPFEGRQLLAV
FT                   KGAWARERRAIGPGALFVPAAQARALLAAHLLEPTGPDALLAWGTFNAAFERKEYVEDY
FT                   VLEPFARELLAKDAAVRAEWERLLADPAFAADREARTDFFYRRHPAWDEAYRTYPVTRV
FT                   DARP"
FT   sig_peptide     complement(143385..143450)
FT                   /locus_tag="Anae109_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.563 at
FT                   residue 22"
FT   gene            complement(143460..144239)
FT                   /locus_tag="Anae109_0116"
FT   CDS_pept        complement(143460..144239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_0445 membrane protein involved in
FT                   colicin uptake-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24334"
FT                   /db_xref="GOA:A7H6I8"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I8"
FT                   /protein_id="ABS24334.1"
FT                   /translation="MGPFELEGSPIAFAAAGLLVAVAFAFGVAASTEPAPARDVGARVA
FT                   YAECLHAGRGRTDCAPRREAALTLCAARRPVAECEALLAEADRGPERVVAEAEAARVAG
FT                   PLHGSPRRAAVGAAVALAALATVVALRRPRAASLARLAAGAMVGLALASVPALAAAAFG
FT                   VLVSAVVPRSEVALVGFGLFVATFAAVVGMPVAAGAADAPGAARRRRVHASLGVVAGGM
FT                   ALWIVLVGPIPAGAAGALQALSAVALALTGYLAPRPL"
FT   sig_peptide     complement(144147..144239)
FT                   /locus_tag="Anae109_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.870 at
FT                   residue 31"
FT   gene            complement(144368..145402)
FT                   /locus_tag="Anae109_0117"
FT   CDS_pept        complement(144368..145402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0117"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ade:Adeh_0113 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24335"
FT                   /db_xref="GOA:A7H6I9"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I9"
FT                   /protein_id="ABS24335.1"
FT                   /translation="MLNWLHNMLSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQQDA
FT                   RGGRKVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKYFIQSAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRIAGDKMDEAIIQHIKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALSEPINGIVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSSVVIGAGKALEELDILRQV
FT                   TAHG"
FT   gene            complement(145474..147537)
FT                   /locus_tag="Anae109_0118"
FT   CDS_pept        complement(145474..147537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0118"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller; KEGG:
FT                   ade:Adeh_0114 peptidase S9, prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24336"
FT                   /db_xref="GOA:A7H6J0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6J0"
FT                   /protein_id="ABS24336.1"
FT                   /translation="MLTSALAALAVAAAAAAPRPFTVDDLVALPRVGAPELSPDGTLLA
FT                   FTVGRLTGAGDRIVSTLYVAPAAGGASRQLTDRDERISSPRFSPDGKRLAFVSTRSGAP
FT                   QAHVLDLASGQIRVASALPGGANELSWTPDGAALLVTADVDPRCGADAGCNAKAEAEAK
FT                   GKPRVATRLLFRHWNAWRERLRTHVLKVPLDGGAPSDLTPGDRDAPPAVRGGPGDLAVS
FT                   PDGKTLYFTAVDDALEAASTNADVFAVPLAGGEARRVTSGPGWDASPRPSPDGKRLAWL
FT                   SQARGGYESDRVRVMVAGIDGKDARDLTAGVDLSASDLHWARKGGALRFVALTSGYHEV
FT                   YEVDVRSGELVKLAGAPALAGRPRVNVQSVSYSADGARVAALVDGTTAPPEIAVLEGKP
FT                   GKARWAERTRLAADALAGIARPTLRPLEATSKDGTKVFGWIVLPAEHRDGQRHPAAVLV
FT                   HGGPQGAWNDAWTSRWNAMLYAARGYAVVLPNPRGSTGYGQAYVDAVSRDWGGKPYEDV
FT                   MALVDAAIALGAVDGARMCAAGASYGGYMVHWLNGQTERFRCLVSHAGIFDLEAFFYRT
FT                   EELWFPEWEFGGTPFDQPADYQKFSPHRFVQRWRTPTLVSVGELDYRTTVDHGYAAFTA
FT                   LQRRGIPSKLLVFPDEGHWVSKPKNARVFYDVVLGWLDEHLAPAANVSAKAR"
FT   sig_peptide     complement(147487..147537)
FT                   /locus_tag="Anae109_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.704 at
FT                   residue 17"
FT   gene            147712..149271
FT                   /locus_tag="Anae109_0119"
FT   CDS_pept        147712..149271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0119"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   ade:Adeh_0115 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24337"
FT                   /db_xref="GOA:A7H6J1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6J1"
FT                   /protein_id="ABS24337.1"
FT                   /translation="MNFCPACGAPLRAGARRRGGREKDGVVADRYRLVELLGEGGMGRV
FT                   YRAEHIRMGKALALKLLREDFAREPAAAERFLAEARAVSRLSHPHTIAVFDFGEAGPRG
FT                   GLYLAMEYVPGEDLAAVLRAGGPLPEARARELGRQILGSLAEAHEAGVVHRDMKPGNVM
FT                   LMRTRSGEDFAKVLDFGIAALRDDRAAGAGDAIVGTPAYLAPEQARGAAVDGRTDLYAL
FT                   GCVLYELVSGRPPFVAPSPMAVVSAHLSQEPPALAKLVPGVSRAFAEVVHRALAKRPED
FT                   RFPSADAMREALVGTSGRAGRRARPGDGERDAGGGLASRADFDALAARILRPGRVVLAL
FT                   AALAVLGGAAVAWRWEDVHALLAARAPALAAALPAALQPAPRLDGAPQGSSHPSPEGEH
FT                   AVSPVSPSPTPAEEAPPDVEPAGAPQAETPPPAAEAGAAAPDDPSQAAGGAEPDAGAPQ
FT                   REAAPSSEPLAEEPEALGPGARSESGDEALREVVDGEGRFRLSFEPRPEAALPLVAPSP
FT                   AP"
FT   gene            complement(149345..149794)
FT                   /locus_tag="Anae109_0120"
FT   CDS_pept        complement(149345..149794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0120"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: ade:Adeh_0116
FT                   ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24338"
FT                   /db_xref="GOA:A7H6J2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J2"
FT                   /protein_id="ABS24338.1"
FT                   /translation="MKLILREDVENLGKGGELVDVKPGYGRNFLLPRGLAVLANPKNVR
FT                   ELEHQKAIATAKAAKMKASAQAVAKRLAETPITLSRKVGEQDKLYGSVTAMDVAEALAA
FT                   RGLQIDRRAIDLAEPIKTTGDFEVPVKLHSEVVGKVKVKVEAEAA"
FT   gene            complement(149805..150236)
FT                   /locus_tag="Anae109_0121"
FT   CDS_pept        complement(149805..150236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0121"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: ade:Adeh_0117
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24339"
FT                   /db_xref="GOA:A7H6J3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J3"
FT                   /protein_id="ABS24339.1"
FT                   /translation="MARPDMGGPKSSGGFGGPRSGGGFGGGGYGGGGGGGGGYGGGGGG
FT                   GFGGRGGDRGDRGDRDDRGGEEGGRRGFGRRKVCRFCADKTLKVDYKDQSQMKYFLTER
FT                   GKIIPRRISGNCAKHQREVATAVKRGRMLAILPYTVGGM"
FT   gene            complement(150240..150692)
FT                   /locus_tag="Anae109_0122"
FT   CDS_pept        complement(150240..150692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0122"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: ade:Adeh_0118
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24340"
FT                   /db_xref="GOA:A7H6J4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6J4"
FT                   /protein_id="ABS24340.1"
FT                   /translation="MAETRKLVREYETIYLLKAETPDDQVEEIKERLRGVVTREGGKVI
FT                   RFTNQGKRKTAFPVGKNPKALYMHCLYIGQPGLVAELERNLKMIDQVSKFQSVRLAEGV
FT                   DFDARQVEPDVKIQAVEDEPKPREERGEFAPGDEPFEAEAPEAAEE"
FT   gene            complement(150799..151377)
FT                   /locus_tag="Anae109_0123"
FT   CDS_pept        complement(150799..151377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0123"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: ade:Adeh_0119
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24341"
FT                   /db_xref="GOA:A7H6J5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J5"
FT                   /protein_id="ABS24341.1"
FT                   /translation="MKLVVGLGNPGPEYARTRHNVGFLVADRLALALRAEFTLRKFASE
FT                   LAEGRAGGERVWIMKPQTYMNHSGESVGSALHFWKLGLEDLVVVHDDLELEPFRVQLKV
FT                   GGGHGGHNGLKSVNAHVGGPDYARVRVGVGRPPPRMDPADYVLGRFAKADEAPLEECLV
FT                   RATEAARLAIELGAAKAMNQVNRRASAAG"
FT   gene            complement(151386..152093)
FT                   /locus_tag="Anae109_0124"
FT   CDS_pept        complement(151386..152093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0124"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   ade:Adeh_0120 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24342"
FT                   /db_xref="GOA:A7H6J6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J6"
FT                   /protein_id="ABS24342.1"
FT                   /translation="MADNIINAQRREEKGKGPARRLRQKGLIPAVVYGRKQEPTHLSVD
FT                   PASLLKAIETPHKFNTLLTLKLDGAEKHVLFKDWAVDPVSRKLEHADFLEVKLDEAVKV
FT                   AVPVVTSGRSVGQAEGGILSLATHEVVLEALPSKIPVRIEVDVTNLKIGQSIHVSQLTP
FT                   PEGCKLKYSSDYVIAFVAVPEKEEVAAPVAAAVPGAAPAEGAAAAGAPAAGAAPAAGGE
FT                   AAKKAPEAKGAKK"
FT   gene            complement(152287..153252)
FT                   /locus_tag="Anae109_0125"
FT   CDS_pept        complement(152287..153252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0125"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; KEGG: ade:Adeh_0121
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24343"
FT                   /db_xref="GOA:A7H6J7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6J7"
FT                   /protein_id="ABS24343.1"
FT                   /translation="MEFHGIRPDYRVFSGNSNRKLAEAMCKELGRPLAHATVGRFSDGE
FT                   IQVEIGENVRGLDTYVVQSTSPDANTNLMELLIMIDALKRASAGSITAVLPYYGYARQD
FT                   RKSAPRVPITAKLIADLIEAAGATRVVSMDMHAGQIQGFFNVPFDHLYAAPVLLEHMRK
FT                   RFDGDAQNVVIVSPDAGGVERARAYSKRLGSTLGIVDKRRTKPNVAEIMNVIGEVQGKI
FT                   AVLLDDMIDTAGTLTQAANALMDKGAVKVYAYATHAVLSGPAVERIVKSPIEEVVVTDT
FT                   IALGPAAEACRKIRSLTIAGLLAEAVRRIHSADSLSSLFV"
FT   gene            complement(153383..153676)
FT                   /locus_tag="Anae109_0126"
FT   CDS_pept        complement(153383..153676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0126"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: ade:Adeh_0122
FT                   SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24344"
FT                   /db_xref="GOA:A7H6J8"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J8"
FT                   /protein_id="ABS24344.1"
FT                   /translation="MEITEVRVFPVNEEKLKAYVTITLDDCFVVRDLKVIHGNTGLFIA
FT                   MPAKRRKDGTFKDIAHPLNTETRERMERTILAEYDRELRKGAAPRPTGTHDD"
FT   gene            complement(153628..154545)
FT                   /locus_tag="Anae109_0127"
FT   CDS_pept        complement(153628..154545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0127"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: ade:Adeh_0123
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24345"
FT                   /db_xref="GOA:A7H6J9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6J9"
FT                   /protein_id="ABS24345.1"
FT                   /translation="MRLQTIAPAKVNLVLRVGPPRRDGYHGIRSLMVPLDLGDRVDVSV
FT                   GERAGPVTCRVPGRPELDGADNLAARAAERFRARFGVERTIGIRIAKRIPVTAGLGGGS
FT                   SDAAAVLRCLARAFGIRDRAALAAIALEVGSDVPFFLGPGPAWAEGRGERLTPADVPPQ
FT                   HLVLVYPDDPALAIRAGEAYRWLDASRQGRRPRLPPRFARFEPSRAGNDLQPPCLLERP
FT                   PLATLLGLLVGRGATAAIMSGSGPTVFGTFHSRNAAARAARTIAEEVVDRKVMVLAATT
FT                   VRRHPGVTPWRSPRSASSPSTKRS"
FT   gene            154700..155119
FT                   /locus_tag="Anae109_0128"
FT   CDS_pept        154700..155119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24346"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K0"
FT                   /protein_id="ABS24346.1"
FT                   /translation="MSRLFARLSVPCLAALAVAASGCASAFGPEPVTRLSEAPQAQLSA
FT                   TVKQEVALRTGPDKLAHVVERLPAGASVTASDRAVRGYRRVRTEAGRTGYVEESALEVG
FT                   AAVAAPATPAAPAPAPADGAPAAAAPEAAGQPVAN"
FT   sig_peptide     154700..154780
FT                   /locus_tag="Anae109_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            complement(155209..156828)
FT                   /locus_tag="Anae109_0129"
FT   CDS_pept        complement(155209..156828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0129"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: mxa:MXAN_5988 thermostable
FT                   carboxypeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24347"
FT                   /db_xref="GOA:A7H6K1"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K1"
FT                   /protein_id="ABS24347.1"
FT                   /translation="MADPAPSPRSAAWETLAAVMSDVRALGGAVSLLQWDQETFMPARG
FT                   AAARGDQLAVVQAALHERLTSRAVAEALDRAERDADGDPDRAAALRALRFDHERAARVP
FT                   QELVRALAQAQAEGIDAWKAARAERSFARFAPSLERLLALRREQADALLPMLERRAQAQ
FT                   PEEAAPERAGGPGGRGLSRPPGKIEPYDALLEGYEPGMRVARLAPILQRLAGWLAPVVA
FT                   AIDAAPAPEDGFLAGRFDAEAQWSFTLELLQALGFDPAAGRQDRSVHPFTLGLDPGDVR
FT                   ITTRIHEDQPLSAIFSTLHEAGHGLYEQHLPAQDRRSLLCAAPSMGLHESQSRLWENLV
FT                   GRSLPFWRAFLPRLAARFPRLAGVAPEDFHRAANRVRRSLVRVEADEVTYNLHIALRFE
FT                   LELGLLRGALAVRELPEAWAARSEALLGVRPRHDVEGVLQDIHWAWGDLGYFPTYTIGN
FT                   LYAATLYAAAARSLPGLDEALARGELAPLRVWLAERVYRVGRRKDAEEIVRDATGEGLT
FT                   DRDFERYVKTKYGALYGLSLAG"
FT   gene            156952..157698
FT                   /locus_tag="Anae109_0130"
FT   CDS_pept        156952..157698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24348"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K2"
FT                   /protein_id="ABS24348.1"
FT                   /translation="MHIVANPFLLGHLATLCAKETRQPEITRLVRILYEDLIRTVLNVE
FT                   FPRRRVSVPTRMIDSSPQGIFEGEVIDRAVRAVTVNIARAGALPSQVAYDLLNETLEPS
FT                   LVRQDHIIMSRMLGMNEEVVGAGIGGMKIGGDVDEAFLLFPDPMGATGSSLATAIETYK
FT                   TKVPGKPRRIVNIHLIVTPEYLRTMTAAHPDVVVYAIRVDRGLSPPEVLATVPGTRWDE
FT                   ERGLDDHQYIVPGGGGFGEILNNAYV"
FT   gene            157691..158218
FT                   /locus_tag="Anae109_0131"
FT   CDS_pept        157691..158218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0131"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; KEGG: ade:Adeh_0127
FT                   hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24349"
FT                   /db_xref="GOA:A7H6K3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K3"
FT                   /protein_id="ABS24349.1"
FT                   /translation="MSSGASKVEVLISEADLQARVKALGAEITRDHAGRSLVVIGVLKG
FT                   CFIFLADLVRAIDLPISIDFIGISSYQGTRSTGVVQITSDLTRPIEGKDVLLVEDIVDT
FT                   GLSMRYLLDNLATRRPASLQVCALLEKPSRAVVKVPIHYRGFEIGDEFVVGYGLDWDGK
FT                   MRNLPFIGVPRS"
FT   gene            158374..159159
FT                   /locus_tag="Anae109_0132"
FT   CDS_pept        158374..159159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24350"
FT                   /db_xref="GOA:A7H6K4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K4"
FT                   /protein_id="ABS24350.1"
FT                   /translation="MADDTTRAPRRGGGARAAVAWLAILALLGVVVWLVSERNARTWYL
FT                   VPDEGRLVVMRGVLAPIGRQTFKTADPVLAQAYEPIVAPPGKPLPEARGFEERSLLDQG
FT                   IYEIVSGWARDEIASGDPARLERGLGYLSRAERLAGLSAAQREDLSALRAESGFYEAQR
FT                   LLDRAVGELRQAAEKLRHTAASRSAHANDARALLHDVEPALDAAAVALRSAGGAPRPRT
FT                   GPPQPAQESQPAPQGATPAEPAPPAPAPAAPETGAAGER"
FT   gene            159355..161859
FT                   /locus_tag="Anae109_0133"
FT   CDS_pept        159355..161859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0133"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ade:Adeh_0129
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24351"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K5"
FT                   /protein_id="ABS24351.1"
FT                   /translation="MAPFHARNGAGELLARYSFLEPLLAGRRVLEVGAAAATDGVTALF
FT                   LAERGAAAVLSIADAEPELAAAREAGHHPFVQFRAAAAEALRPGTFDLALVADGAALAR
FT                   DPARLAALRRLLAPGGRLVTALPAGGVGLADLAGEPPAPDAPPYEAFVAALADQFPLVE
FT                   VATQSATVGWVLALAGEGEDDEPDVAMDGTLAGTPETAAYVAVCGDEPCGLAGLAVVAL
FT                   PVTPLADGARAAAGAVAAAREALATAEAQRALAAGEAAQAAAERDAAASERAAERAARA
FT                   ESDAARAALAAEVNDARAAAEAADAALAPTRMAAEAARARAAELEALLEEEREGALELR
FT                   AAVDRVRAAEAEHARETREARAGLEAARAEAQAAKSGLDAALARAIAAETRAAELEEAG
FT                   DELAAARAEAAGRLEAVEAALHAADAERDAARAELDAGRAERDAARTELEAARAERDAA
FT                   RTELEAARTERDAARTAERDSRAGREAEGAELERVRTALEAAERERARQAAEAEAARCD
FT                   RERMREEAASVRERLAALEEGTVARDAEGARLAEAAARAQEAVAAAQSARELLEAQVAE
FT                   LGARLEAEAERLRIAEARVAEAQARSEVVAGVEARAREAEEALRAAEGRAQAAERRAEE
FT                   LEARAAGAAELAGDAEARVLAAERAASERERELSAARGAAEERARAAETELARLRESAE
FT                   AAGAEAASLEAELQAARWERDELAEKLRAAPAGGDATPDGAGEDAARLRDALAEALRRA
FT                   ADAEAAAVAARATAPEGAAEGAADALRAASVERDALAAQLAERDQKIARLQREVADKTD
FT                   RLGRLAREMGELKARGAGKLWG"
FT   gene            161999..162541
FT                   /locus_tag="Anae109_0134"
FT   CDS_pept        161999..162541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0134"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ade:Adeh_0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24352"
FT                   /db_xref="GOA:A7H6K6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K6"
FT                   /protein_id="ABS24352.1"
FT                   /translation="MSVPRRYERIDIELPCRLFIPGEVGLRFEAFCTSQNLGLGGLFVT
FT                   SSFLLRAGLELYVELALPDGPLAIRSRIAHVVPHGDRAHPTGMGIEFLDVDAHGRETLL
FT                   RYFTPARYTSFYEAFIAEFPHLDETVPLRDVSLVLNLWEEWKIRGEGGPLSTASGAPPA
FT                   PALGEGTTDARGVRSRR"
FT   gene            162577..164745
FT                   /locus_tag="Anae109_0135"
FT   CDS_pept        162577..164745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0135"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   ade:Adeh_0131 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24353"
FT                   /db_xref="GOA:A7H6K7"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K7"
FT                   /protein_id="ABS24353.1"
FT                   /translation="MQKARLALLWHMHQPPYRDADTGEYLLPWVRLHATRAYNDMAWML
FT                   ERHPALRCTVNFTPILLEQLEDYVAGRARDRFLELSARPASELGHDERSAVVRGFFMVD
FT                   WGRNVRPVPRYWELLHKRGQDLGDRDPRRLAAGFSDADLTDLQVHFNLAWMGFGALADD
FT                   EGLRALREKGRDFDRADVAYLLEAQRRILAGVVPRWTRLAERGQVELSTTPYYHPILPL
FT                   LCDSDAARRALPHLPLPPRFAHPEDARWHVREALASHERRFGHRPAGMWPAEGSVSPEA
FT                   VEVLAREGVRWAASDEGVLLHSLPPTAPRLASVYRPWRIAAGEGRELTMLFRDRALSDA
FT                   IGFTYAGVPAQEAAGDFVANVGAIARAWEAERLPGRPTVGVFLDGENAWEHYPESGREF
FT                   LDRLYGGLAVSDAIETVTLSEATADAESGIVTRIHSGSWIEASYRVWIGHAEDRHAWTA
FT                   LGRARAALAEAERQGSVDAGRLEQARRHLHAAEASDWFWWYGDDFSTDLGAEFDGLFRG
FT                   HVVRACLLIGATPPAEVLEPIKRVAPGAEARAAREPTALLAPRIDGRETTFFEWAGAGV
FT                   HRPGQHRGSMFGGAQAFRELHFGFGLDALYLRLDPAESPARSAEVVSHVRVVILAGERQ
FT                   ATVELAVVPDGAVRPGRAAAAELGEAAFGKVLEARLPFAALGLVPGGEVALGVHAVRGE
FT                   VEVERLPRHGFVRFTVPDADFERVHWKV"
FT   gene            164752..165618
FT                   /locus_tag="Anae109_0136"
FT   CDS_pept        164752..165618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0136"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Forkhead-associated protein; KEGG:
FT                   ade:Adeh_0132 diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24354"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K8"
FT                   /protein_id="ABS24354.1"
FT                   /translation="MTGDPTRIRPPSPGASAAGSARLVFVEGAELLGVSLPLDREAVLG
FT                   REAGCALRLPADDVSRRHARIAPADGGHVVEDLGSTNGTFVNGEAVTARRLASGDRIRV
FT                   GPFVARYLAAGDEAARELEALAALARRDPLTGLANRRAFEEALAREVARAAREGGPLAA
FT                   IALDVDHFKRVNDGYGHAAGDAVLVEVAARAAQGLRASDLLARVGGEELAALLPGATLE
FT                   AAAEAAERIRARVAGAPIAAGELRLRVTLSAGCAALGPGEDGATLLARADARLYEAKRA
FT                   GRDRVAG"
FT   gene            165668..166828
FT                   /locus_tag="Anae109_0137"
FT   CDS_pept        165668..166828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0137"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_0133 major facilitator superfamily MFS_1
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24355"
FT                   /db_xref="GOA:A7H6K9"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K9"
FT                   /protein_id="ABS24355.1"
FT                   /translation="MKNRSALAILFVIVFIDLLGFGMVIPVMPLYAERLGASEAWTGLL
FT                   SAGYSAMQFVFAPIWGRLSDRVGRRPVLLVSIAMTAVAFALYGLAGTFAMLLVSRLFAG
FT                   AATANIAIARAFVADVTPPEGRARGMGIIGAAFGLGFVLGPALGGVLSQYSLSLPGFAA
FT                   AGLAAANGIAAWAILPEPEHRYSVDRRRRFAAMREELGRPGIRRIIGIYFVTILAFSAM
FT                   EATYAFLAKQRYGLAESAVSYVFAYIGVLLVLVQGGLIGRLSRRFGEKRLLVTGLVLQA
FT                   LALAALPFAGTVPGLLVATAPLAVGAGLTQPTLSALLSRFARAEDQGGTLGIGESAAAF
FT                   GRILGPEAGTWTFGQWSIAFPYLGGAALMAFAAAIGVTVRPAGEER"
FT   gene            166833..167834
FT                   /locus_tag="Anae109_0138"
FT   CDS_pept        166833..167834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0138"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: ade:Adeh_0134 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24356"
FT                   /db_xref="GOA:A7H6L0"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L0"
FT                   /protein_id="ABS24356.1"
FT                   /translation="MPDLRRDPIVGRWVIIATERARRPSDLVRPAEPAKAGLCPFCPGQ
FT                   EDKTPREVYVAGRPPSAPANGPGWSVRVVPNRFPALKIEGDLDREAEGIYDRMNGIGAH
FT                   EVLVETPNHERQMKDLSVPELTEVLFSFKARILDLRNDLRFRYILLFKNQGQLAGASLD
FT                   HAHSQLIALPVVPRQVVEEIEGAKRHYEHKERCIFCDIVGQERKERARLVHENEEFVVF
FT                   APWAPRSPFETWIVPKRHESNFEAEPKERLSLCAQALGTTLRRLAAALGDPAFNFIVHS
FT                   NPLRDAASPSYHWHIEVMPALTQVAGFEWGSGFHINPVPPEEAAEFLRGVEG"
FT   gene            167889..169316
FT                   /locus_tag="Anae109_0139"
FT   CDS_pept        167889..169316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0139"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: ade:Adeh_0135
FT                   glycogen/starch synthase, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24357"
FT                   /db_xref="GOA:A7H6L1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6L1"
FT                   /protein_id="ABS24357.1"
FT                   /translation="MEILFVASEVAPWSKTGGLGDVAGALPRALAARGHAVSVVTPRYG
FT                   TIDPHAHRLRPLHRALDVRGEPTTLWVSRDRAPVYFVEHEHFFGSRRGLYGEAHDYGDN
FT                   AERFAYLARAALALPGALGLRPHIVHLNDWQTGLVPFLLRREHARDAALAGARTVFTIH
FT                   NLAYQGVFSKHVVPALGLPWDVFRYEAMEFHDQLNFLKAGLVFADALTTVSPTYAREIA
FT                   TPQGGVGLDALLRHRARDLHGILNGIDVEEWDPATDRHLPARYSAADLSGKAACKSALQ
FT                   RELGLPERPDVPLVAMIGRLAEQKGLDLVVAALGELLARDLQLVLLGTGRPELEEAFRR
FT                   AARERPDRMAARIGFDEGLAHRMEAGADLFLMPSRFEPCGLNQMYSLRYGTIPVVRAVG
FT                   GLEDTVEDFDGWSRGTGFKFRDYHPQAMLLAVRRALEAHRDRRAWRAMMLRGMALDFSW
FT                   DRSAQAYEALYRSLAAP"
FT   gene            169370..169651
FT                   /locus_tag="Anae109_0140"
FT   CDS_pept        169370..169651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24358"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L2"
FT                   /protein_id="ABS24358.1"
FT                   /translation="MGPRFDDEPDPPEPTVQPSDRTHRERMAEADEKVVPIENVGGAAP
FT                   TPLGLDSGGNFPGSEDDLSNLPEPEPPEPPEVGAVHVREDERGRRRRR"
FT   gene            complement(169662..170921)
FT                   /locus_tag="Anae109_0141"
FT   CDS_pept        complement(169662..170921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0141"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ade:Adeh_0137
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24359"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L3"
FT                   /protein_id="ABS24359.1"
FT                   /translation="MHRPLRRAVWLVLLAACTRPPAPTAPSAPNPTAPAARASSAPTAA
FT                   VRPQGAPAPSIVSPAGARAAPPCLPAEPSASPGVLAEESAAALERGSSERALACADEAL
FT                   QRAPRHVGALTARGEALAAAGRVDEARLAFARALAIEPDEPRALLGAAELHVRRLASSP
FT                   EAIEAGLEYALRGARAANLRKDRELAGRLELVAGMAENDLGRSHLALGHLDRSVQALPG
FT                   DADAVYERGVALYELCRFDEAQRAFERALALAPDDPWTIHQLGLLAERRGDERRAASLL
FT                   GRARSLAPDDFKVELPVDMGGFRDEVEAAVASLPAEERSALGSVPIEIQDLPDLEDLLA
FT                   VHPPLSPSILGLFRGPSEDEPCTHADGPRCRTIVFYRKNLLRFARDRRELTEQVRVTLL
FT                   HELGHLHGESDDDLRARGLE"
FT   gene            complement(171009..171980)
FT                   /locus_tag="Anae109_0142"
FT   CDS_pept        complement(171009..171980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24360"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L4"
FT                   /protein_id="ABS24360.1"
FT                   /translation="MEAPADLHELRERLLARLARGQLVLLVGAGASRWAGLPSWREIVC
FT                   ALAEDLLPALREQVPDARARFTPPAPDEPVSLDALLRLPEAYRFLRGEARLVERLRVLF
FT                   DTSRIDPAQLPLHHRLVRLAPFVPAIYTTNFDDLLERTFAWAGRPCQVVAAAEDLRRWQ
FT                   FDEVDGRQVPRFPIYKLHGTLERPGSLVIGESDFLRRSDLAANPIDLRFSSDVMGREIL
FT                   LVGYGFNDPNLRWIWTKLRDLRVPPVGWFLELGASSDLERATVAMDRIGRVDLHASDPV
FT                   HPPELLAFLEDLASWCERELGPREEPRPASPPTAAARPRPVP"
FT   gene            complement(172032..173159)
FT                   /locus_tag="Anae109_0143"
FT   CDS_pept        complement(172032..173159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0143"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: ade:Adeh_0139 glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24361"
FT                   /db_xref="GOA:A7H6L5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L5"
FT                   /protein_id="ABS24361.1"
FT                   /translation="MPAMRTDVVVVGAGIQGASVALRLAQAGRDVVVLERSIPGAEASS
FT                   AAGGILSPGVEAIEPGPFYALCRASLARYPEFVREVEARSGIAVGYRALGTLEVALDDD
FT                   HARLLAGRAEKLERSGLPVEVLDEAAVRALEPGVSSEARGALYFADEASLDPRLLARAV
FT                   YVAAARAGARFVTGDVRRIRTEGGRAAGVDHAAGRIDAGAVVLAAGSWSLLVEGNGLPP
FT                   GAVRPVRGQIAVVDTRPPLLSRVVFSGNGYVVPRPDGRILCGSTMEDVGWEKAVTAGGL
FT                   RHVLGVAVEIAPALAQAPVVETWSNFRPASPDGEPILGEGTVPGLFYATGHTRNGILLA
FT                   PVTADAIAAAVTGAAAPLDLAPFSPARLGAILGRR"
FT   gene            complement(173209..173874)
FT                   /locus_tag="Anae109_0144"
FT   CDS_pept        complement(173209..173874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0144"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_0140
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24362"
FT                   /db_xref="GOA:A7H6L6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L6"
FT                   /protein_id="ABS24362.1"
FT                   /translation="MDASVAMRKAGAPRAGIAERIWDAARAEFSKRGYHGARVQGIARG
FT                   AACNVALIYRHWASKRALYLDILRAVWLGSANEIARLVQSGPGGAAVVVAAYLDAMMKD
FT                   PMGAQILIREYLDGAPFLSQLTQTDPALLEPVRRAAAALAAGDASDLDPVLTVVTVGGL
FT                   AALVASSREAARPFVQEPIAPEAWRQHVLELLVNGLRPARPASVPGTPGGTPSNGAAV"
FT   gene            173966..175165
FT                   /locus_tag="Anae109_0145"
FT   CDS_pept        173966..175165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0145"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   ade:Adeh_0141 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24363"
FT                   /db_xref="GOA:A7H6L7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L7"
FT                   /protein_id="ABS24363.1"
FT                   /translation="MTGPRTILHLDLDAFFASVEQLDDASLRGRPVIVGGPSRRGVVCA
FT                   ASYEARRFGVRSAMPTAQARKLCPEGTFVAPRFARYAELSERVFGIYRRYTPLVEPLSL
FT                   DEAFLDVTASRALHGGGRDIATAVKRAVRGECGLAVSAGVAEVKLAAKIATDLGKPDGL
FT                   VEVPPGGVAAFLAPLPVGRLWGVGPVTEGALRKLGVTLVGELARLPETALAAVVGASNA
FT                   RGLRALASGEDPREVVPDEEARSVGAEETFGEDVTGRAALERALLEQAGRVGRRLRAAG
FT                   LAGHTVTLKVKYADFTLVTRRTTLAHPTDDDRAIYEAARAQLARVEADRPVRLTGVSVS
FT                   GFAGAAERDQLDLFASGAPARPPDAEKRRSLNAALDALALRFGDRAVTRADLADDADDD
FT                   "
FT   gene            complement(175125..175733)
FT                   /locus_tag="Anae109_0146"
FT   CDS_pept        complement(175125..175733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0146"
FT                   /product="PE-PGRS family protein"
FT                   /note="KEGG: ade:Adeh_1681 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24364"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L8"
FT                   /protein_id="ABS24364.1"
FT                   /translation="MRRAPRRLQFSARAGRGGRARRRVPAGAGGSGGVRPTRGACGGAG
FT                   ARGHRRAARRPHARGAGSPGAERALRPAPPRGRPREVGTSHRGHARAPVRGARGDPRAG
FT                   RGARDAARGDAHRHHRRRPTGAAGRAARGGRGEGVVRERAGWTPDRPLDRGALGVWSGA
FT                   PPRRRAAARRRLGPEHGRAGQPRRRVISRRPRRRRGRRA"
FT   gene            175765..176700
FT                   /locus_tag="Anae109_0147"
FT   CDS_pept        175765..176700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24365"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L9"
FT                   /protein_id="ABS24365.1"
FT                   /translation="MRRATSAGNAAPRLTRGPPRGLPPRGRAPHLLLMISTERPGEHLA
FT                   TRDREAGELDARADALRALSNAGVPHLVAGAYAFFEYTGIFRDTKDLDIFLRERDLEDA
FT                   FRVLEAAGFRTELLDPTWIGKGYRGEWFVDLIFSSGNGVAVVDDLWFEHARPGRVMGVD
FT                   VLLAPPEEIIWSKGYVLERERYDGADVNHLLRACGDSLDWDRLLQRFDRHWEVLFSHLM
FT                   LYRFTYPCERDKVPERVMHALMQRTRADMLEGNHVRPVCRGTLISRVQYRHDLEHLGYE
FT                   DGRALDEAERGGRTERDGGRGRDLPAGGDR"
FT   gene            176657..177469
FT                   /locus_tag="Anae109_0148"
FT   CDS_pept        176657..177469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0148"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ade:Adeh_0143
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24366"
FT                   /db_xref="GOA:A7H6M0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M0"
FT                   /protein_id="ABS24366.1"
FT                   /translation="MADGDGTFRLAAIADLHCRQDQHGRFREVVKMVNGEAEGLVLAGD
FT                   LTDHGSVDEAKTLAEAFSQLRVPCAAVLGNHDYEGGVVKDIVRILGESKIEVLDGDHAV
FT                   FDKRVGIAGVKGFAGGFERGMLQAFGEPVIKAFVQEGVNESLKLEAALGQLDLPIKVVL
FT                   MHYAPILETCDGEHLEIRPFLGTSRLCAPCEAFGATAVFHGHAHHGKTDGHTPKGIPVF
FT                   NVAMPLVRKLWDRRFRVFDVSEGSCTPVGDTAASPQPQQPQLIVTTTH"
FT   gene            complement(177566..177946)
FT                   /locus_tag="Anae109_0149"
FT   CDS_pept        complement(177566..177946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0149"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_0144 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24367"
FT                   /db_xref="GOA:A7H6M1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M1"
FT                   /protein_id="ABS24367.1"
FT                   /translation="MMPGQYILVVDDDDDFREALSEVLVEAGYPVQKAENGEVALARVS
FT                   DEAPGIVLLDLKMPVLDGWGVMERMRGDAKSAAVPILILSAYGFEWEAELLGAQGYIPK
FT                   SVGMDEILERVRKAAGPPPLRH"
FT   gene            complement(177943..178914)
FT                   /locus_tag="Anae109_0150"
FT   CDS_pept        complement(177943..178914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0150"
FT                   /product="phosphoesterase DHHA1"
FT                   /note="PFAM: phosphoesterase DHHA1; KEGG: ade:Adeh_0145
FT                   phosphoesterase, DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24368"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M2"
FT                   /protein_id="ABS24368.1"
FT                   /translation="MQLKVLYHGNCFDGCASAALFSRFFAEREGTRLSEVRHVPLQHGA
FT                   GDPFPSGAFDGDVNACVDFRFSASPDLHWWFDHHASAFPTPNDRAAFERDASGQKFWDP
FT                   AAPSCTGFIARTLAERFEWRADDLAELVRWADVIDAARFDSPATAVRLEAPALRIMTLL
FT                   EATKDPSIPARLIEALQHRPLAEIADEPWVARPLAPILARHAEAIDTYRRIARVEGGVV
FT                   TIDLGETPIESANKFIAYELFPQARYTVVVSRDAKRAKVSVGSNPWARPARAHDISRLC
FT                   ERYGGGGHPVVGAVSLPPDRLEDARRIAGEIAETLRTEPSAP"
FT   gene            179203..180168
FT                   /locus_tag="Anae109_0151"
FT   CDS_pept        179203..180168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0151"
FT                   /product="HPr kinase"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein; KEGG: ade:Adeh_0146 HPr
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24369"
FT                   /db_xref="GOA:A7H6M3"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M3"
FT                   /protein_id="ABS24369.1"
FT                   /translation="MDAIRVGALLDDKKFDLRLSLVAGKQGLSRRISSARIQKPGLVLA
FT                   GFTENLHRERVQVFGNTEMSYLATLPRERAVDVLRSFFSADVACLVVTKGLDVPPEMAA
FT                   AADESGVPLLRTTHLSSTFIEGVQNYLEDILTAQTSMHGVLLDVFGVGILLLGKSGIGK
FT                   SEIALDLIMRGHRLVADDIVDVKRRTPDSVYGAGSEIIKHHMEIRGLGIINIKDLFGVA
FT                   SIRERKKIEIVLELVEWDPSVEYDRLGVEEKKFRILDVEIPMLIVPVRPGRNMTTIVEV
FT                   AARNHLLKLQGHHSAREFQERLNRAIALAPGGRVGELDVE"
FT   gene            180165..181049
FT                   /locus_tag="Anae109_0152"
FT   CDS_pept        180165..181049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0152"
FT                   /product="uncharacterised P-loop ATPase protein UPF0042"
FT                   /note="PFAM: uncharacterised P-loop ATPase protein UPF0042;
FT                   KEGG: ade:Adeh_0147 uncharacterised P-loop ATPase protein
FT                   UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24370"
FT                   /db_xref="GOA:A7H6M4"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6M4"
FT                   /protein_id="ABS24370.1"
FT                   /translation="MNELVNRGGPEVVILTGVSGSGKSTALRALEDAGFYCVDNLPILF
FT                   LEKLLELSGHTAGEVSRIALVVDAREGRFLADAPRVIQEIRQQGADVEVLFLDASDESL
FT                   VRRYSETRRRHPLAGESGTVPDGIAAERQALAALKAIADEVIDTTTLNVHELKRLVTRR
FT                   FATSEGARLGVTVVSFGFRFGLPTHADVVLDVRFLPNPYFIPELKPHPGTDPRVARFVL
FT                   GQPDAKAFLERISDLLGFLLPRYRAEGKSYLTIAIGCTGGKHRSVALAGALAERLEGGG
FT                   QPVRLWHRDVEKE"
FT   gene            181119..181538
FT                   /locus_tag="Anae109_0153"
FT   CDS_pept        181119..181538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0153"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: ade:Adeh_0148 phosphotransferase system, fructose
FT                   subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24371"
FT                   /db_xref="GOA:A7H6M5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M5"
FT                   /protein_id="ABS24371.1"
FT                   /translation="MVGLVVATHGGLAEELLRTAEGIVGHLEQCEAVSIGASSSMEDCR
FT                   ARLGEAVKRVDTGEGVLVLTDMFGGTPANLALTFLDEKLEVVTGVNLPMVLKLASARAE
FT                   NLGLHAAAELLTGYGQKNITLASELLRTRARTSRP"
FT   gene            181570..182064
FT                   /locus_tag="Anae109_0154"
FT   CDS_pept        181570..182064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0154"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   KEGG: ade:Adeh_0149 phosphotransferase system, sorbose
FT                   subfamily IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24372"
FT                   /db_xref="GOA:A7H6M6"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M6"
FT                   /protein_id="ABS24372.1"
FT                   /translation="MIALVRVDNRLLHGQVLETWLPHLAVREVVVADDEAASSRLARAA
FT                   MTLCVPPELAARIEPVGAVDYAALAAAPAPVLVLVRDVAQLVQARAAGLTPALAPRLNV
FT                   GNVHYAPGRRSVTPSVFLSQEEVRALRALAAEGFEVELRAVPAEAPAGMDEIERRYAAA
FT                   R"
FT   gene            182075..182779
FT                   /locus_tag="Anae109_0155"
FT   CDS_pept        182075..182779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24373"
FT                   /db_xref="GOA:A7H6M7"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M7"
FT                   /protein_id="ABS24373.1"
FT                   /translation="MGLSYLVLGVVAGLAAVERKGFLQAMLSRPIALAPVTGWALGDPQ
FT                   GGLLVAPPLELLWLGAVNLGAALPVHEALATAAITGGAVLAGRALGAGVSPEVAILAVL
FT                   ICAPLALVGRRADRLVEGWNERIALRAEAALASGHPRAAVRWNLSGLAAPFAVAALVAP
FT                   AGAALAAVAIPAFLRAVPAAATPLQLGFFAFAALACASGAKALRAREAPRYFYGALAVA
FT                   LVAGVIVGRALS"
FT   gene            182776..183543
FT                   /locus_tag="Anae109_0156"
FT   CDS_pept        182776..183543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0156"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="PFAM: PTS system mannose/fructose/sorbose family IID
FT                   component; KEGG: ade:Adeh_0151 phosphotransferase system,
FT                   mannose/fructose/sorbose family IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24374"
FT                   /db_xref="GOA:A7H6M8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M8"
FT                   /protein_id="ABS24374.1"
FT                   /translation="MSARVPARTLARVFWRGLFLQAAWNRRGMQNLGFAYAIDPALRAL
FT                   YPEPARRREALERHLQFFNCHPYMAAAILGGAIHHEERVAAGEEPAGAALRYKATLQGP
FT                   LAALGDGFFWTALRPFCGALGAVGALLFGGAGVVAALVLYNVVHLSLRAGLFRVAYRGG
FT                   DAVIPAIARLGLPLAADRLRAAGAALCGVAAAVVALRAAGAAGAPATLVAMLAAGAGYA
FT                   ALARGARLLPTAYVAALAAVGAAVVAGHFHWSS"
FT   gene            183548..183820
FT                   /locus_tag="Anae109_0157"
FT   CDS_pept        183548..183820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0157"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: ade:Adeh_0152 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24375"
FT                   /db_xref="GOA:A7H6M9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M9"
FT                   /protein_id="ABS24375.1"
FT                   /translation="MPRHERTFVIVNSLGLHARAAAQLVQTANRYRAEIHVEKDGMQVN
FT                   GKSIMGVLTLAAAKGSSIILVVDGEDADAAMTALAKVIESGFGET"
FT   gene            183817..185616
FT                   /locus_tag="Anae109_0158"
FT   CDS_pept        183817..185616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0158"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: ade:Adeh_0153
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24376"
FT                   /db_xref="GOA:A7H6N0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N0"
FT                   /protein_id="ABS24376.1"
FT                   /translation="MTPSATSILVGIAASPGIAIGRCWPVDRRKVRAPKRLLAPEEIEN
FT                   ELARLRTALEISELQLAEVREKVERAPGTQGGAEHTAIIDMHRMMLKDEMLVLEAQRLI
FT                   REERVNAEWAVKRATRKIKSAFHEQADEYFKERRADVDYVGERVIKNLLGQAPDVEEPP
FT                   PEGAIIVAHDLSPADTALLLHERKVAAFVTDTGAKTSHTAIVARALEVPAVVGVGRITS
FT                   LAGRGDWIAVDGSRGVVVINPTPGERVEYEVARERFLEAEQVLLRTRDLPARTLDDVTV
FT                   RLAGNIEFVEEVPSLVAHGGEGVGLYRTEFLFIGRTELPGEGEQYQTYRRVLEALAPKP
FT                   VTIRTFDLGGEKLPVGMRLPAENPALGLRAIRYCLRQPEMFRAQLRALLRASVHGNLRI
FT                   MFPMISGVSELRAAKRLLAEVREELRREGAPVREEVPLGIMIELPSAALIADRLAEESD
FT                   FFSIGTNDLIQYAIGIDRQNKDVAYLYKPLHLAVLRMLKLICDAAQVKGIPVSMCGEMA
FT                   GDVMNTLVLIGLGVSELSMNGPAIPFVKRVVRAARAADGRALVERILSLTTADDIEREV
FT                   RTEMLRRFPELLEAEATFGPVSG"
FT   gene            185780..186949
FT                   /locus_tag="Anae109_0159"
FT   CDS_pept        185780..186949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0159"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   ade:Adeh_0154 methionine adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24377"
FT                   /db_xref="GOA:A7H6N1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6N1"
FT                   /protein_id="ABS24377.1"
FT                   /translation="MPHTDYLFTSESVTEGHPDKMADQISDAVLDAVLAQDKKGRVACE
FT                   TLLKTGYVMIAGEITTTARIEYPKLAREVVKRIGYVSGDMGFDGNTCGVLVAVDQQSPD
FT                   IGQGVDVGGAGDQGMMFGYACDETNELMPAPIQYAHAVTRQLAKARRGGLDFLRPDGKS
FT                   QVTVEYRGGKVARIDTVVVSTQHSESVSNRKLHAALREEVIAKALPKKLVDRKTKVFIN
FT                   PTGRFVIGGPMGDTGVTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSAAYMGRYIAKN
FT                   VVAAGLARRCEVQVAYAIGVAEPVSVMVETFGTAAVPEERIAQAVREVFGLTPKQIIEG
FT                   LDLLRPVYEKTAAYGHFGRTEKEFSWERTDKKDALRDAAGGKVRAVAGA"
FT   gene            187079..188047
FT                   /locus_tag="Anae109_0160"
FT   CDS_pept        187079..188047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0160"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: regulatory protein ArsR; UbiE/COQ5
FT                   methyltransferase; methyltransferase small;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ade:Adeh_0155 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24378"
FT                   /db_xref="GOA:A7H6N2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N2"
FT                   /protein_id="ABS24378.1"
FT                   /translation="MTQPAPARPHGEALLGWMEGLADPTRLRLLHALERKELSVLELCE
FT                   VLALPQSTVSRHLKVLADQGWLASRRQGTQSLYGYADGLAPGARRLWLLARAESEAWPA
FT                   VRQDAERLQAVRARRDGAQRFFAGAAGAWDRLRAEVYGSSVAREALLALLPSSWTVADL
FT                   GCGTGALSAELAPHVREVVAVDQSAAMLRAARRRCAALPNVELHEARLEALPIADGRCD
FT                   AALLALVLAYLDEPAAALREAARVLAPGGRLVVLDAVRHSDEALRRRMGQVRPGFAPEE
FT                   LEALLAGAGLGAVRTRALPPEPGAKGPGLVVATAERASRRR"
FT   gene            188097..189578
FT                   /locus_tag="Anae109_0161"
FT   CDS_pept        188097..189578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0161"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; TrkA-N domain protein;
FT                   KEGG: ade:Adeh_0156 adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24379"
FT                   /db_xref="GOA:A7H6N3"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N3"
FT                   /protein_id="ABS24379.1"
FT                   /translation="MAVPAAKKKLLKPPAAPVEHRVKDLALAEWGRKEIELAEKEMPGL
FT                   MAVRREYARKRPLAGQRITGSLHMTVQTAVLIETLADLGADVRWASCNIFSTQDHAAAA
FT                   VVVGRGGTPDAPRGVPVFAWKGETLEEYWDCTERALDFGGGKGPTQIVDDGGDATLLIH
FT                   KGFEFEKAGKVPRAASADSEEYAVVLRLLGRELKKDPRRWTRVAEDCAGVTEETTTGVH
FT                   RLYEMQKAGTLLFPAINVNDSVTKSKFDNLYGCRHSLVDGLNRATDVMLAGKLCVVCGY
FT                   GDVGKGCAQALRGQGARVVVTEIDPINALQASMEGYQVVRVEDVVKEADVFVTATGNLD
FT                   VITVAHMQQMKDCAIVGNIGHFDNEIDIAGLKKVPGLEKVNIKPQYDAFVFPDGHRVLV
FT                   LAEGRLLNLGCATGHPSFVMSNSFTNQTLAQLELATNRAAYEKKVYVLPKHLDEKVAAL
FT                   HLEQIGAKLTKLTKKQAGYLGVPPNGPFKPDHYRY"
FT   gene            complement(189630..190280)
FT                   /locus_tag="Anae109_0162"
FT   CDS_pept        complement(189630..190280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3781 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24380"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N4"
FT                   /protein_id="ABS24380.1"
FT                   /translation="MDRQRVAVVVALALAGLAAPVTASAGFVVGARVGWAFPFGELRNG
FT                   VDLDSAVRGQIPLQVDLGWRFADRLMLGGYARLSPGVVGDNVEDACDASSLDCDGPFGW
FT                   AVGGQVDVRLAPGNAGPWIGAFGGFEALTYGDVSEAVDTDSLELSYEGWEVGAQGGIDF
FT                   AWGPIVIGPWASVSWGRFTEISAEIGGRDTDIPEWDEATHTWVQVGLRGALDF"
FT   sig_peptide     complement(190209..190280)
FT                   /locus_tag="Anae109_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.594 at
FT                   residue 24"
FT   gene            190407..191321
FT                   /locus_tag="Anae109_0163"
FT   CDS_pept        190407..191321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0163"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA; KEGG: ade:Adeh_0157
FT                   undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24381"
FT                   /db_xref="GOA:A7H6N5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6N5"
FT                   /protein_id="ABS24381.1"
FT                   /translation="MSLLAAVFLGVLQAATEFLPVSSTAHLLVFGELLGHDLADPRFRA
FT                   FATIIQTGTTLAVLVYFRTEILSLLAAGLRSLARRRPLETPQSRLAWFIVLGTVPAAVL
FT                   GKLFEERIEALGNWVIAGSLVVLGLVLLAAERYARHLRTVEDVGARDAVLIGLGQALAL
FT                   VPGSSRSGTTITAGMLLGFTREAAARFSFLLSVPIILGAGGYKLWKTVPVLRGEPSWAL
FT                   ATLVGTAVSAVAGYLVIDWLLGWLRTRTTHLFVVWRIAAGVALAILIWQGVLPAGHASV
FT                   SAPAVEAARAADPDAPLGAALRR"
FT   gene            191318..191908
FT                   /locus_tag="Anae109_0164"
FT   CDS_pept        191318..191908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0164"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ade:Adeh_0158 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24382"
FT                   /db_xref="GOA:A7H6N6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N6"
FT                   /protein_id="ABS24382.1"
FT                   /translation="MSLEALRTALAAHAWGVAPVAEIPPEHFPLGGFLRAAVLVPLYDG
FT                   PGGTHVVLTRRTRHLRRHAGQISFPGGRIDPEEEHLAAALREAREEIGLEPAHADVLGR
FT                   LSETLVLTSAFRLTPWVASVPYPYPYAAAAHEVAEILHVPLASLLAPGAHRTERVEAWG
FT                   LPVDVHHFTFGDETIWGATARILSELLSIWRTL"
FT   gene            191905..192996
FT                   /locus_tag="Anae109_0165"
FT   CDS_pept        191905..192996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0165"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: ade:Adeh_0159
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24383"
FT                   /db_xref="GOA:A7H6N7"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N7"
FT                   /protein_id="ABS24383.1"
FT                   /translation="MKIHPVVMAGGSGTRFWPLSRKDRPKQFLALAGGAPLLAATIARL
FT                   PPLGKADRTFVVCGPRHAVAARRMLPQLPKENFIVEPCARNTAPCVGLAALHVAARDPQ
FT                   GVLAMLPADHHIAKPAAFREALAAGAQLAERGAVATIGIRPSRPETGYGYLKVGPRLAA
FT                   RSGRGKARLQAFKVERFVEKPDARTAARYLADGGYLWNSGIFVFRADVILEEIRRAMPV
FT                   LGEQLAQIGAALGTPAYARTLRRVFPECPSISIDFGVMEKSDRIAVVPADFGWSDVGSF
FT                   AALPDVRATDATGNVAEGDALVIDGRNNVVIATDGRPVAVVGIDDVVVVDAGDAILVCR
FT                   RDRAQDVRKAVEELTRRGRDEVL"
FT   gene            193102..194472
FT                   /locus_tag="Anae109_0166"
FT   CDS_pept        193102..194472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0166"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: ade:Adeh_0160 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24384"
FT                   /db_xref="GOA:A7H6N8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N8"
FT                   /protein_id="ABS24384.1"
FT                   /translation="MDTLSPTIFREYDIRGLVDQDLTEHAVHLVGKALGTRIREAGGRK
FT                   AAVGRDARLSGERFRDAMVSALTSTGIDVLDLGVVPTPLTYFAAHTAGVDGICMITGSH
FT                   NPPEYNGLKVGLGAATFHGEEIQALRRLAESGRFASGSGTVSPYDVITPYRKYVRENLR
FT                   LGGRKLKVVVDAGNGTGGVIAVPILEALGVEVVPLFIDMDGRFPNHHPDPTVEKNLEHL
FT                   KAKVLETKADLGIAYDGDADRVGAVDERGRVLWGDQIMILFSRALLAEEPGAAIVGEVK
FT                   CSMSLYDDIAKRGGRAIMWKAGHSLIKAKMKEERALLAGEMSGHIFFAHRWFGFDDGIY
FT                   SSARLVELLSRTDAPLSALLADVPRTESTPELRVDCPEDKKFEVVRRAQEFFAARYEAV
FT                   TVDGVRVVFPDGWGLVRASNTQPLLVLRFEARTKERLDEIEALVRGKVAEIMREVGA"
FT   gene            194475..195434
FT                   /locus_tag="Anae109_0167"
FT   CDS_pept        194475..195434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0167"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ade:Adeh_0161 ROK"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24385"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N9"
FT                   /protein_id="ABS24385.1"
FT                   /translation="MPLGIGVDLGGTNARAAVVDADTGEIVAAHKEPLRDRTPAGVVEI
FT                   VRHAIGEATSAASVVPGVFGAVGVGVAGQCLGRTGVVLNAPNLGWRDIAFGELLRDALG
FT                   VPVRVANDLSVAAWGEKRFGAAKGIDDVVLVFVGSGVGSGLILDGRLYDGAQGVAGEFG
FT                   HVKVTPLRAETAVRRCGCGDWGCLEAYTSGVNVATRVREELAAGARTAIFERVGGDLAR
FT                   VTASLVDDAYRAGDAYARALWAEVGELLGTAIANLVTVLNPARLILGGGVLLGCPALGE
FT                   LVRRTFDAKVSKSAGKGLSIEHAWLGDDAGVIGAAVLP"
FT   gene            complement(195437..196198)
FT                   /locus_tag="Anae109_0168"
FT   CDS_pept        complement(195437..196198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0168"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: mxa:MXAN_6485 ferric siderophore
FT                   transporter, periplasmic energy transduction protein TonB"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24386"
FT                   /db_xref="GOA:A7H6P0"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P0"
FT                   /protein_id="ABS24386.1"
FT                   /translation="MGRLPPPLAYAVSAALHLAALAGLARLPPLPALGDEVAVEVVDVA
FT                   PPPPPPPAPAPAPAPTPAPEPEPLGPAPRRAPVKAPPLAPRAARPDPAPPPPSAEPPAD
FT                   APRRAAVRVGVAMSATTEGGSFSAPSGNTLHGEMPRTAPDPQDVQPYRSERYASPAQVT
FT                   VLPRPISCEIPQAEYPEAARRAGVEGRVVLTLLVDEAGRVADAKVVESPGHGLGEAAVA
FT                   GVKRHCRFDPARRGEERVATRLRYTVRYELP"
FT   sig_peptide     complement(196130..196198)
FT                   /locus_tag="Anae109_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.894) with cleavage site probability 0.650 at
FT                   residue 23"
FT   gene            complement(196202..196615)
FT                   /locus_tag="Anae109_0169"
FT   CDS_pept        complement(196202..196615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0169"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   mxa:MXAN_6484 transport energizing protein, ExbD/TolR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24387"
FT                   /db_xref="GOA:A7H6P1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P1"
FT                   /protein_id="ABS24387.1"
FT                   /translation="MAGLSGGENDDDLISGINVTPLVDVVLVLLIIFMVTATYIVRAAI
FT                   EVELPRAAHGGETTGTVLTVVLTRDGKVYLDGVERTEQELVARTREAVRKDAGTRAVIS
FT                   ADKGALHGAVVRAIDLVRDGGVTRFAIHVERER"
FT   gene            complement(196619..197248)
FT                   /locus_tag="Anae109_0170"
FT   CDS_pept        complement(196619..197248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0170"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   mxa:MXAN_0818 MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24388"
FT                   /db_xref="GOA:A7H6P2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P2"
FT                   /protein_id="ABS24388.1"
FT                   /translation="MLQKQLLGFTNLGAEWVLWLLIALSVASIGVMIERVAFFLSRRAG
FT                   DVDALRRQLLAGDLAGASAAVEGRRGMEAEVVRAAVAHAAMGPDAVREVVSGTIERSRI
FT                   DYEQRLAFLGTLGNNAPFIGLFGTVLGIVRAFFELSRNPGAAGAGTVMAGISEALVATA
FT                   VGLFVALPAVVAYNLFQRGLRRTAQRATALGHAAIAHLEARPGREA"
FT   gene            197724..199214
FT                   /locus_tag="Anae109_0171"
FT   CDS_pept        197724..199214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0171"
FT                   /product="protein of unknown function DUF814"
FT                   /note="PFAM: protein of unknown function DUF814; KEGG:
FT                   ade:Adeh_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24389"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P3"
FT                   /protein_id="ABS24389.1"
FT                   /translation="MSLGAGEIEAVVRELAPLVGSRVDAVRVHAERALTLELFGRAGPV
FT                   LLLLSAEPDVTRLHVTRARPPQPATPFPFQVLLRREIEGARLAAIETLPGDRVVALALE
FT                   TPRGRLRLVGELTGRHGNLFLLGDDGIIRASAGRNLSQRRKLVAGEPYVAPAPPPSPRV
FT                   ERPRFTAEPSGPFPLSAAVEARYAALVQERLVAEGRRRLREPVRAGVARASRALEKLAD
FT                   EAARVPVAEADRRAADLLKANLRAVKRGEREVTLTEWTEEGPREVRVALDPALAPQANM
FT                   ERLYRRYRRIVESAERVAARTAGVRGREAALRSLLGEIDSAPLEELPRLEREARRLGAG
FT                   PRPQPQPQPRPAGPGGRARARPEPLPYRVFRSAAGAAILVGRGAAENDRLTLRVARGND
FT                   LWLHARGVPGAHVVVRLEKGRGPDQGTLLDAAHLALHFSDARGAPQADVAYTRAKYVRK
FT                   PKGAGPGAVTYSQEKVLLLRTEPQRIARLLAEEEGGQE"
FT   gene            199319..200107
FT                   /locus_tag="Anae109_0172"
FT   CDS_pept        199319..200107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P4"
FT                   /protein_id="ABS24390.1"
FT                   /translation="MPPSVGSRPPVPRPPQANRQLELFDARRASREARLSAASRLADSL
FT                   SGILSERVRLTVHDNRSTMVSFRRGSGGIHYRLHHMFLGAPGEVVRALAAFAGPTRGAS
FT                   ARRREAGSRIDAFVRHNRARIAVPRADRLQPRGRAHDLQQIFDRLNAAHFGDAIQAHIG
FT                   WGAVRGGARRRTVKTGVYVQDARIIRIHPTLDRPEVPEFYVALVVFHEMLHQAVPAREV
FT                   NGRRVVHGAEFRRRERAYPDYARAKAWEEGNLGLLLSSPT"
FT   gene            200232..202253
FT                   /locus_tag="Anae109_0173"
FT   CDS_pept        200232..202253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0173"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: ade:Adeh_0164 surface
FT                   antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24391"
FT                   /db_xref="GOA:A7H6P5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P5"
FT                   /protein_id="ABS24391.1"
FT                   /translation="MVRRVALALLVPLALGATGCLRARGTESEPIVTELKLEGVEALDA
FT                   EDIKAKLATQEPAAPGGVTGLVRREGFPLDPDALASDRRRVEAFYRDRGYYAARVDKVD
FT                   VVPDGPGRARVVMHVVEGKPVRVTELHIKGLEEVAEARERLKELPLEVGDVFRVSAYDA
FT                   TKAAITRGLRTKGWANAEVTQAAQVLPQEGTAQVTYEVKAGRRFRFGPIFVAGTSAVSR
FT                   DLVREQASVDVRTGAWFDESKLSKAQARVFNLGVFAGVRVTRGTPSAERGIIPVVVAVR
FT                   EAPFRTIRAGPGLGVEATRWEARGNASWQHRNLFGELRRFGIDLRAGYAWLPTPWADQR
FT                   SGVVALIGFEFQQPAAIARRLDVSARVEVERGLELAYGFWAERVELGLPVRISPRWTFI
FT                   PSYNLEVYQLSDAPEAVVTRPGTPEAETRPLLVGCPSSTCLLSYLEQRLAWDGRDDAVN
FT                   TRRGYYVGLSLQEGFRIGTVGYRYLRFLPEVRGFWPLSRKLVLGARARVGALVPLTEPK
FT                   EPPIVANFYSGGPLSMRGYYTRRLSPMIEVGKNDWVPVGGNGLFDGSLELRYALAGNWS
FT                   GAWFLDAGNVAPPDNGETAWREALSLGDLQLASGVGLRYATPFGPIGVDVGVRLPTDLS
FT                   SGVPFDKRFPPVPSNPNAGTAEHREPIVAVHITIGEAF"
FT   sig_peptide     200232..200303
FT                   /locus_tag="Anae109_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.612 at
FT                   residue 24"
FT   gene            202253..206770
FT                   /locus_tag="Anae109_0174"
FT   CDS_pept        202253..206770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0174"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   ade:Adeh_0165 protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24392"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P6"
FT                   /protein_id="ABS24392.1"
FT                   /translation="MRALVAALRVAGWGLLGLVALVGVLLSAVTLFATSKAGGPIVARE
FT                   VIRLVDDALAGRFELAGVAVRPDGTVEVRGLRVFDPDEHLVLAVDRARVAIDVTQLRRR
FT                   TVGAAIALDGPSVLLEEEEDGGLSLVRAFSAAHPGPPRPEGPRTPPRGPGLEVRVSALA
FT                   IRGGDVWWVDADGATRLEARDLDLDARGAWQRSAADVELRLRGMLDLPVAAPLSLDVVA
FT                   SREGDRVRAPLLRASVGGTAVSLIGHLDVVTLAGRAAITRLDVDRAQARTVVPELGGGE
FT                   DAAATVYAESDGAIATAAARVEPRDGGPALGRRADAAVALRLDGARALGFDLALERLDP
FT                   SALHAAAPAGDVTLTGRGALVGSSLEDLRADVAVSVARSRLRRGELGPGEVVARAERGA
FT                   YDVRRLTLRAPGLSLDGALRWRPGGAVSGRVDADAADLGVAMRNLGALLGKELPDLRGS
FT                   ARVEAALSGTERAPVARATVSAPALRSGGLAVGGVKLDVSAEGPLRRPTVSVEGVVAAL
FT                   RSGGDEIARGLVLRARLADEEAVVSASAALPAVGDRPFALDARGRLGPRRDRLALAQLA
FT                   IAYPGARWTLTHPAELRFAGPSVDRLELVADAQRIALEGGLTPRGGLDAHAKLVGVDLT
FT                   RLPPGVIPRNLGVAGLVSADARAGGTRRRPLLDASFDFRGGAVRGLAGLDGAGTARWDG
FT                   RARRAAVTLGVARADGGSVDLSADLPIPLDRSPAAPLAARVRGRALPVAPVLAAAGAAS
FT                   PLQGTVELDAALEGTVGAPRVRADATLAEGAYEDLGPFAIAIALEDAGERAELRASAAY
FT                   DGVRALVLEAAAPLDLSEVIAGPSEALAALRGAPVEANVAVPGLELAPLAGVRGIPAGL
FT                   EGTLEVRAALAGTIDAPRGSIAVGLARGVVAGYRDVSAGLAVALEDARVALTGQVALGG
FT                   DPVLRLGGALEAPPERLLPADRLERTPLQLEVVVPRVQLARAAGADSTLPLAGTVEGRL
FT                   SASGTLAAPVARVELAGSGVAVAGRPLGEVSVRAEHANARTRAQAAIRAVAGGVVELSG
FT                   TLEAAFGVGVRGPPLREAPLDARLVARGLDLGVLAALLPGVVRSAAGPLTADVTAHGPL
FT                   GRPRPRGKVTLTDGRLAVAEYGEWTAIALDAEVNDDTLELRTLSARRGHGTVRVWGAAR
FT                   ALREQSSPVEAHVEARSLVIPRSGQELATIDVRGDATGTYAPDALRLEVKIPEGTLKLP
FT                   RQTPRELQQLEQRPDIVVGKPKTDERRRRSGAGAGPGAKPFVLAVHAMAPGRLFVKSDD
FT                   PPMNVELKADVTYELAGGNDYTSGEISVVRGFVEPIGGRHFELGRGRVQFTGGPPAAAM
FT                   LDVEATYENPEATVTVTVTGPAREPEIRLSSKPPLDEGQIAMLIATGRTEVKSGSGDSS
FT                   AFTGEEVGRAALGAVATRAFKNLVADKLPLDTVAVDSGAVRAGKYVTDKIYVGYVRRFD
FT                   ADVERGENENEARIEYRITPRWTAESRYGTSGSGGASLVWSKSY"
FT   sig_peptide     202253..202354
FT                   /locus_tag="Anae109_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.613 at
FT                   residue 34"
FT   gene            complement(206764..207969)
FT                   /locus_tag="Anae109_0175"
FT   CDS_pept        complement(206764..207969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0175"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: ade:Adeh_0166 integral membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24393"
FT                   /db_xref="GOA:A7H6P7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P7"
FT                   /protein_id="ABS24393.1"
FT                   /translation="MDRRRSLVVTAALAGLWLAVGYVNVARGAAHAGPGYRFWSFQHHC
FT                   YSDVIALHGDRYLGGSHPLPYLEDRIEYPVLLGIALWLPSYAPGGALGHFTATYLVLAA
FT                   CLAAALLALARLPGALPWWLGATPALVYYAGLNWDVLPIALLSGALLAQERGRAGAGAA
FT                   AAALGVSAKLFPATLVPAALAALAATRPRALLRYAVVFAGVVLAVNLPFALAAPERWSW
FT                   FFRFNAGRGAENSVWQALAVPRGPLLEALSAGPLAAAAIAGAVATACAARRGGDAARAA
FT                   RLATALALVVWIATNKVWSPQYALYGFLAGALAAGPAALFAALTAVSIWDFHVAFEVRA
FT                   RRWEPWFRDHLFHPTAVVRTLLWLALAALIARALWREARGPADAATGGRAGPGGATLGA
FT                   RQ"
FT   sig_peptide     complement(207871..207969)
FT                   /locus_tag="Anae109_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.749 at
FT                   residue 33"
FT   gene            208076..208732
FT                   /locus_tag="Anae109_0176"
FT   CDS_pept        208076..208732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0176"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ade:Adeh_0167 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24394"
FT                   /db_xref="GOA:A7H6P8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P8"
FT                   /protein_id="ABS24394.1"
FT                   /translation="MASFSGLAQTLADAVSRTGPAAPAILFAASFVEYVFPPFPGDLVV
FT                   VLGAWYAVDGALSWPATFVSVTAGAMLGAWIDYRVGAAVGRRLDRRLSGTRSLSAERLL
FT                   RFEASYRRWGALLLVSNRFFPGVRAFFFLAAGAAGIPLRRVLLYGGLSAALWNAVLLGA
FT                   GALFARNVEELVHLFEHYTYAAWWALGGVAAVALAGALWRRHAARKASRAAGEER"
FT   gene            208729..209703
FT                   /locus_tag="Anae109_0177"
FT   CDS_pept        208729..209703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0177"
FT                   /product="transglutaminase-like protein"
FT                   /note="KEGG: ade:Adeh_0168 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24395"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P9"
FT                   /protein_id="ABS24395.1"
FT                   /translation="MSAAAALAALLALGLPEGAARYRVELGGVTVGLAELELRCGRERC
FT                   RARWETRLRLPEEAGGAVTTRRFETELDRAGRAVGRMRRTRDAEIARLEVPSGRVPAGL
FT                   AEALLATAAGRGEAACVEVFEEETLATGRACGAWEGDTLHATVLGVEERVTFAADGLPE
FT                   TVALASDGARFLRDRRAAVPSRPPRLTARVAGPGDPARAESFCGVPVDPPPPRAPPGLP
FT                   APRAAGESCREKTAAYLATAAAAGHEGRTAIGVAWDGDGFVWHAWAELLADGSWVPVDP
FT                   SFGELPARGPRFTVARHGAGRAAALAAGRRVLACWGRAGVLAR"
FT   sig_peptide     208729..208788
FT                   /locus_tag="Anae109_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.863) with cleavage site probability 0.682 at
FT                   residue 20"
FT   gene            209710..210270
FT                   /locus_tag="Anae109_0178"
FT   CDS_pept        209710..210270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24396"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q0"
FT                   /protein_id="ABS24396.1"
FT                   /translation="MRARAPARTHLGGVDLIALYVEDHLALSLGGIRLARRSLGENRGT
FT                   PFAAPLERLIPDLEEDRDVLKDLLRALGGSRSALKEAAVVLGEYAGRLKPNGRLLSYSP
FT                   LSRVWELEGLLAGSESRRGMWNALARVQRQDRRLEGFDFAALEARARRHLDELERWRLR
FT                   AAEEAFGLAPRRRSRAATPQPAR"
FT   gene            complement(210286..211434)
FT                   /locus_tag="Anae109_0179"
FT   CDS_pept        complement(210286..211434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0179"
FT                   /product="Glutamate carboxypeptidase"
FT                   /EC_number="3.4.17.11"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: ade:Adeh_0170 glutamate carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24397"
FT                   /db_xref="GOA:A7H6Q1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q1"
FT                   /protein_id="ABS24397.1"
FT                   /translation="MAARLDDALTWLAGQRGAMESLLERLVTVNSFTGNKAGVQSVANL
FT                   VAGQLRTLGLSVELRPSARFGPHLLFSGAADGAPVFLLGHTDTVFPPGTFEGFRRDGAR
FT                   AVGPGVFDMKGGIVVMLFGLVAAKRAGLLERVAVRGILVADEEVGSPESQPLTRTHAQG
FT                   AACALGFESGRPGDLLVTRRKGVGSLHAEARGVASHAGNEHDKGRNAIWSIARFVDRVQ
FT                   GLTDYERGVTVSVGLVSGGTTKNTVPAEARCDVDLRFETAADGLALAEAAEAIAAEAAV
FT                   PGTTLALSRGGWRDPLERTQASSALAKEYGDCQRESGLGLGEAPLVGGGSDACTTGAAG
FT                   IPSIDGLGPRGRGFHTAGEEVDLSTLVPKASAFLRFLARRGA"
FT   gene            211531..212595
FT                   /locus_tag="Anae109_0180"
FT   CDS_pept        211531..212595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0180"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region; KEGG:
FT                   ade:Adeh_0171 N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24398"
FT                   /db_xref="GOA:A7H6Q2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q2"
FT                   /protein_id="ABS24398.1"
FT                   /translation="MAPGKRYRAAVIGGSGYGGAEMIRRLLLHSDVELVRVASVDFVGE
FT                   PLAAADPALEGVTDLVFEGIPPAEAARGVDVVLLGLPHTVAASKLPELAALPGLKVVDM
FT                   SGDFRLKDAAAYERWYKHTHPCPERLRDFVYGLPELNREWIRAARFVASPGCFATTIEL
FT                   ALLPLARAGLLEGVVHVQGITGSSGSGVAPSAGTHHPVRAGNLRTYKPLEHQHVPEIVE
FT                   TLAQAGARDLALRFVPVSAPLSRGILATCFLELPEEWTQERLDRLFRESYAGEPFVRVP
FT                   RKRLPEVAAVSGSNYAEVGVAAGPPRAGRRTVTCFGATDNLVKGGAGQAIQNMNLMLGL
FT                   DEKASLADPGPWPP"
FT   gene            212592..213407
FT                   /locus_tag="Anae109_0181"
FT   CDS_pept        212592..213407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0181"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0172
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24399"
FT                   /db_xref="GOA:A7H6Q3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6Q3"
FT                   /protein_id="ABS24399.1"
FT                   /translation="MKTIVLKLGGELVHAPELDVIARDLRVLVDGFNRVAIVHGGGPQA
FT                   SALQKTLGLETRMVAGRRYTDAQTLEVMKYVVAGQLNVDLCGRLLANGVMGVGLHGASG
FT                   HVVQARRRPPRVMKGAGPEPVDLGLVGDVLGFNLPLLGDLFERRYVPVIACLGCDAQGQ
FT                   ALNINGDTVASQLAGALEADALVLVTSTPGVLRDVNDPSSRIPHITHAEFERMVADGTI
FT                   SGGMIPKLEESFAVLDSGAKSVVIVGKLGEGDLAHAVLNPGSAGTVLVG"
FT   gene            complement(213450..214454)
FT                   /locus_tag="Anae109_0182"
FT   CDS_pept        complement(213450..214454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0182"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sus:Acid_4473 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24400"
FT                   /db_xref="GOA:A7H6Q4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q4"
FT                   /protein_id="ABS24400.1"
FT                   /translation="MDQLGVATVLRLFLRGSRNYLADRPLVVSFELTGSCNARCKHCDK
FT                   GGILRDETPLSPQRIGEIYRELRPVAVQLSGGEPLLRRDVVEVARAIKERRGAPYLIVV
FT                   SNGTLLSAPKYEALRAAGVNQFSISLDFPDERHDDFRSVPGLFRRLERLVPELTSRGHG
FT                   DVVLNCAVSRLNAGDLTRLCETARRWGSSISFSAYSALRTGNTDYLVSSPEDLRGLRAQ
FT                   LDAVLDLKRRGGPVRNPAPDLDGLYRFFADGGIPGCRAGYRFLLVTPEGFFRPCAHKPV
FT                   KARSQRELIQRFARTNDCRGCYVAIRSYCDKSYLPLLREQVLTRLGLSAAAPR"
FT   gene            complement(214468..216294)
FT                   /locus_tag="Anae109_0183"
FT   CDS_pept        complement(214468..216294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0183"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sus:Acid_5929 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24401"
FT                   /db_xref="GOA:A7H6Q5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q5"
FT                   /protein_id="ABS24401.1"
FT                   /translation="MAPTVKGEIMAQASSDPRLTQAPSSPMQSQCTACERVLAATLRVS
FT                   GDGVVLEKTCPEHGAIREALHDVLFHEAAPDRPGSAVRTYSGTPIRPVVRALPKTVETL
FT                   CPECARTVLGRVFDWRGDVYMEKTCPEHGYVRDRVFTNSALFLKMQQWSFRDGAGVENP
FT                   RVPAADACPGSCGLCNMHQSHTMLGQIDLTNRCNLSCPICFANASATGYVCEPTFDEAV
FT                   ALLERLRAYRPVPATAVQFSGGEPTLHPDFLALVRRANELGFSHVQAASNGIRFAEPGF
FT                   AKAAAEAGLHTIYLQFDGVDDAVHEVTRGRPLLEVKRRALEQIHAAGMKVCLVPTIVKG
FT                   VNDDQVAKILRFAIDNIHVVSGIAYQPVSFTGRISLADREAKRYTLGDLAGDLGAAGWL
FT                   EPMRDFYPLAITAPLSRLIAAFTGDPKITATAHPACSSGAYFVVDRHGNAVPITRFLDV
FT                   EGLFRDLDRLASRVERARFRGLHKVRVPLLFARHFRKELAPEGLTVRTFLHALRGMTDK
FT                   RVGRGRAGERTYRTLLAAGMHFQDRYNFDVERVKRCVIHYSTPEGMFPFCAYNCGPVHR
FT                   QRVERKHAIPLQEWRARRGAAGEGAGAGARTV"
FT   gene            complement(216311..217006)
FT                   /locus_tag="Anae109_0184"
FT   CDS_pept        complement(216311..217006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0184"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: sat:SYN_00884 outer membrane lipoprotein
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24402"
FT                   /db_xref="GOA:A7H6Q6"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q6"
FT                   /protein_id="ABS24402.1"
FT                   /translation="MPAPELPRGARPAAAVALVALLLAAPPSPAAGRDGPPRTLAGVLD
FT                   AHCRAREATTTLRARFVQTKGFTAIGEEDRSSGVLYYRKPDRLRWEYSAPDRAWTVIAG
FT                   DRGWAVFPRIRQVQRFTVGRSRAEGILSTIGFGACGAALADAFETTLAFGAGGAPVLSL
FT                   TPRGPELAASFTRVELTLDPKDHLPRDILLHETSGDTTRFVLSDVQRGVAIEGSLFLFT
FT                   APEGYSVVP"
FT   sig_peptide     complement(216908..217006)
FT                   /locus_tag="Anae109_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.926 at
FT                   residue 33"
FT   gene            complement(216993..217676)
FT                   /locus_tag="Anae109_0185"
FT   CDS_pept        complement(216993..217676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0185"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24403"
FT                   /db_xref="GOA:A7H6Q7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q7"
FT                   /protein_id="ABS24403.1"
FT                   /translation="MSLPATRAAAATRDLAWRSWALAFTGFVAASGAALWLARNTLRSP
FT                   GLEVLILLLLYLSFACTFLPLPTAWIVLWAAREAGVLWVALVATAGTCIANLHDYHIVS
FT                   GLWRAGRLRRARESAWHARAVAWFRRAPFLSLALASFVPLPVDAVRLLAISAGYPLPAY
FT                   VLASYVGRFPRYLLFAVLGHELRPSNLTIFVVALAIALVGAAKAALDRARGARARTRSS
FT                   DDAGA"
FT   gene            complement(217673..218407)
FT                   /locus_tag="Anae109_0186"
FT   CDS_pept        complement(217673..218407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0186"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rxy:Rxyl_0848 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24404"
FT                   /db_xref="GOA:A7H6Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q8"
FT                   /protein_id="ABS24404.1"
FT                   /translation="MPGGSAIQVRGLVKEYRSGRIAVPALRGIDLDVAPGTFAAVMGPS
FT                   GCGKSTLLYVVGGMLRATSGSVRVGGLEVTRAPERALTAFRRGDVGFVFQRLNLISALT
FT                   VEDNLKLACRIAGRTDRSDERIRTLLARVGLESKRRSRPLDLSQGEQQRVAIARALVKE
FT                   PRLVLADEPTGNLDSTNARTVMSLFRQIGTGAGPTILMITHDAECAAVADTVIQMRDGA
FT                   AVPAGALRPRSASPLLAPEDGA"
FT   gene            complement(218428..219522)
FT                   /locus_tag="Anae109_0187"
FT   CDS_pept        complement(218428..219522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0187"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   aba:Acid345_0559 ABC efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24405"
FT                   /db_xref="GOA:A7H6Q9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q9"
FT                   /protein_id="ABS24405.1"
FT                   /translation="MTLALANVLQKKVRSAICVLAIGIGVALLLVVVGLTRGSIQEVAQ
FT                   RIQNVGGDLIVQPAGATQFLALKSGVLPERYAERLRALPGVAAVSPVVAWTTTFRNAFY
FT                   VVYGIDPEQFSSIGGGLRIVEGRPLRGRGEVVVDSRLAAAARLAVGDRVEILGARFEIV
FT                   GVSKEGVGARIFLPMAELQAMLHQERRVSLFFVRCTSPGAVKSTAAAIEAAIEGVRCQI
FT                   LEGLADEMARSMTGLREFIGAITGTTLVVSLLVVSLAMYMTILGKTREIGILRSLGASR
FT                   RRIMGTVVLESLLLTGCGVLAGYALTLASVAALRSWYPLLTVEVTRFWILVGGGVGIAS
FT                   GLLGALYPAWFAARQDPVQALSYE"
FT   gene            complement(219519..220388)
FT                   /locus_tag="Anae109_0188"
FT   CDS_pept        complement(219519..220388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24406"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R0"
FT                   /protein_id="ABS24406.1"
FT                   /translation="MSATHPPCDAVAMRSGPWLGAALAALIAGCAARQAPGDPLSGRPI
FT                   RTASPEELARRLVDDAAGLVALKGKVTLTFQERAAAGARSCRGALAARSPWSDGAAPGL
FT                   FVEGYRSLMPTLFTLVSDGERFWLHVPSERVVYTGTTVRGVVARGRELRLDARALLRAL
FT                   FVEPPGPADALEVREDGETYVLSIRRAGRLHRRLWVERRRFAVEREVLYDADGREELVI
FT                   LRERQRERDGRLQPERLSVQDPVAGGSVLVEFDSLTVNPPGLDARAFRPLSPPGARVER
FT                   VDGTERDR"
FT   gene            complement(220443..224687)
FT                   /locus_tag="Anae109_0189"
FT   CDS_pept        complement(220443..224687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0189"
FT                   /product="putative CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: putative CoA-substrate-specific enzyme
FT                   activase; PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   ade:Adeh_3814 CoA enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24407"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R1"
FT                   /protein_id="ABS24407.1"
FT                   /translation="MPRFLGVDAGAETLKVVELAGEPGGLVWRRRARVEHHKTPGAALG
FT                   ELLREWGWDGLRGAVATGRLGRQLALSRVPGKQARLAGHRFLRGDGPAVIVDIGAHGFS
FT                   VLEVNGGEDAEYRENPRCSQGTGNFLRQLVERFGLAPEEADVLAAPVEEPAHLSGRCPV
FT                   ILKTDMTHLANQGEDRARILAGLFDAICDNVQVLLRSRAGAVSPAVVLAGGVGRSRRVR
FT                   ERFRRRLAERGMTLAEEHGEDALYLDALGCAVLAARGDGPLPRPEDLVSPPAHAPVELR
FT                   PPLSDAMGSVHRLPRRAPPPVSEGDAFLLGLDIGSTGSKVVALHVPSGAPLWESYTRTA
FT                   GDPVGAAQELVRRAAGGPAGAAVAGFGVTGSGREIVGSLLTTCFGGDRVHVLNEIAAHA
FT                   EGARACDPRVDTIFEIGGQDAKYIRLAAGRVVDAAMNEACSAGTGSFIEEQGVRLGNLD
FT                   VEALARVAVGADACAALGQHCAVFMAEILDEAAAAGVTRPRLVAGLYDSVVQNYLNRVK
FT                   GNRSVGEVVFCQGMPFAADALAAAVARQTGAEVIVPPNPGTVGAWGIALLAREALASGA
FT                   PLELARFLDARVERKDTFVCRSSTGCGGSGNACRIERIRTRVQGERRAFSWGGGCSLHD
FT                   GGTRARKLPDGAPDPFRERAELVEAVLRPLAAPTGAPRVALAEAFQLKGLFPFFARFFR
FT                   ALDFDLVVAQGGGREALRRGAEGANVPFCAPMQQYHGLVAALAQAPAERVFLPMLRDLP
FT                   PVKDEESHWLCPIVAGSADVLRLDLRPLLAGRRVLSPAIKLGPGFLDAPAFLDTCRSIA
FT                   EDLGVRDEETWRAAHAAAREEQARFDAALIGIGRSALERCRAGGLLPVVVLGRTYTIHD
FT                   PVLSANIPALLREQGAVAIPTDCYPTDPATPMVPGAFWGYTQRILRAAHEVRRTPGVYS
FT                   LFASNYGCGPDSFTLHAYARLMEGKPFAVIETDGHAGDAGTKTRVEAFLHCVREDLRSG
FT                   GSAAASAAPLLALASQSLPEIARRGSRVLVPPMGAEAHSLAAALRGYGVPAEVLPAASA
FT                   EAIRQARRHTSGKECLPMIVTLGSLLQRLERADPGERLSFFMPGSNGPCRFGYYRQLHQ
FT                   MILERLGHGARVGIWSPPDSDYFAGVPAGFGALVFAGIAAFGLLEDALRDVRPVERERG
FT                   AAARVHAAASGELTRLLERAAGADLSARRVLLEAASGGNYGVTALLERTGRALRALKTA
FT                   RPHPTVMLVGEIYLRSDPGANGGVGDALEERGVRVRLEPVAEYLEYSDHVQVRRGLRGA
FT                   PQDRLKGWIRRRILRTCRRAMARAMGWPDHPRLDEALAAAAPYLRDDLEHEAVLAVGLP
FT                   LVQWRRGEIDGAVCVGPLECMPDKLTEAQLVHAREREGLLSLTLSLNGDPIDPEILDAF
FT                   AYEVKERFRRRA"
FT   gene            225006..225635
FT                   /locus_tag="Anae109_0190"
FT   CDS_pept        225006..225635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0190"
FT                   /product="mucin-associated surface protein (MASP),
FT                   putative"
FT                   /note="KEGG: ade:Adeh_3425 mucin-associated surface protein
FT                   (MASP), putative"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24408"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R2"
FT                   /protein_id="ABS24408.1"
FT                   /translation="MTTKFAFTLAMAALFGFAAPARAQLPGAAQKLGKAKAATAEAGTT
FT                   AEAKTTAAAAKAETKASDAATKADAKADADTAKAERKADAGAKKAEEKAAAASPVAGEQ
FT                   VGQANALGHEKADAGKAKAKKGKAKGLEKANAGRAKGQATAAEAKAKAVDAHEQGHAAA
FT                   AEADAKGQATAAQARQQGESKATAAQQRLHPVVPAPAPAPAAPAAK"
FT   sig_peptide     225006..225077
FT                   /locus_tag="Anae109_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            225766..226755
FT                   /locus_tag="Anae109_0191"
FT   CDS_pept        225766..226755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0191"
FT                   /product="TGS domain protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; TGS domain
FT                   protein; KEGG: ade:Adeh_2114 GTP-binding protein,
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24409"
FT                   /db_xref="GOA:A7H6R3"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R3"
FT                   /protein_id="ABS24409.1"
FT                   /translation="MPANLTTQYKDAELRFRQATDHDAKREALREMLALLPKHKGTEKL
FT                   HADLKKRLAKLEEEAGHAARGGHRADPGHVRREGAGQWILVGPPNAGKSSLLAALTHAH
FT                   PEIGEYPFTTRAPLPGMAAVEDVQVQLVDTPPVAAGHTEPYLPNLVQGADGVIVVLDPT
FT                   ADDVAQAFAAVLEVLSRGHVWPRGRAPPQGASPLLVARPVLVVATRRDLDDGGTFAALA
FT                   RDAAGAELPFFAVSATRGDGLDALRPELFRALGRIRVYTKEPGKKPDLGKPFVLPAGAT
FT                   VHDLAALVHHDVAAHLKFARIWGHARFEGQQVDRHHVLADRDVVELHA"
FT   gene            complement(226786..228678)
FT                   /locus_tag="Anae109_0192"
FT   CDS_pept        complement(226786..228678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0192"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: ade:Adeh_0174 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24410"
FT                   /db_xref="GOA:A7H6R4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R4"
FT                   /protein_id="ABS24410.1"
FT                   /translation="MSRALHIGAGATRGGSGYRFPALVWSLLHVPLFLALYASSIAAAV
FT                   GNSPAAYRLPLWPIFLPQAGLLALAAFVVALPFSLKPGAYRVAAPAVLGLATSVLALDS
FT                   RIYGAVGFHMNGFFVRVMFQPYALKETGISPADVALFLGIGIAFVALDVALGAWFIRRF
FT                   ATPRRTWGIALALLLAAGAERVYGAGLVYFGGPAMFAASGVLPLQVPLRMNSVYSRVFG
FT                   KRAVDQFAGQESLRLPAGVAPEEIRFTRAPDVLFILAESLPAAHLAPEVMPNLWRRAEA
FT                   GTRFTRHYAGSVATHYTLFSLLYGIQAQKLEATLGAGRRPVLFPALRHNGYAVKALSAS
FT                   CLDWMDLRETVFAGVSSEDLRNRCDGEGWGDRDPQLLADARAMAAAVPPGQPLFMFLFL
FT                   YGTHFNYFHPPGAEPFRPAWDGSGGLQATTAAPETIRNRAKNAAYALDGTLEEFLSWFE
FT                   QARGRRPLVIFTGDHGEEFKEKGHLGHGSAVTDEQIHVPLVVLGDGIPAATRDAPTSHV
FT                   DVVPTLFSLLGDTHAPSLHSDGLSMFEAPEDRFVLSTVGWEPRYAVIGKDLKVTVYAGL
FT                   AGAEVTDPQDRPLPDASARLAASAGRILRAMRGEEVAPAHVPRPLPAAATVGDR"
FT   gene            228890..229486
FT                   /locus_tag="Anae109_0193"
FT   CDS_pept        228890..229486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0193"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   thiopurine S-methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: rha:RHA1_ro00217
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24411"
FT                   /db_xref="GOA:A7H6R5"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R5"
FT                   /protein_id="ABS24411.1"
FT                   /translation="MADGPRRDFESAYLAGSPPWDIGRPQPEIVKLADEGEVKGTVLDV
FT                   GCGTGENALHLASLGKRVVGVDGSRAAIARAREKAAERGLPVAFHVADALQLRRLHLRV
FT                   ETVVDCGLFHVFSDEERRPYAESLTEVLSPGGTLHVLCFSDEEPPGPGPRRVAEYDLRA
FT                   TFRSLFAMVRIRPARFESLVHPGGAKAWLATLVRI"
FT   gene            complement(229572..230408)
FT                   /locus_tag="Anae109_0194"
FT   CDS_pept        complement(229572..230408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24412"
FT                   /db_xref="GOA:A7H6R6"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R6"
FT                   /protein_id="ABS24412.1"
FT                   /translation="MTSNPRFLALLAVLALAAAPASAQQAGGARATAAAAEPPFQAFSS
FT                   TNVQLLQGYNFDDPLYYTDGRMTTVTLNHFSTWEYGDNFAFADFYAGHFRNGFSPSHED
FT                   AGEYKLYAEWHPRLFLNRVLGQKEPLFGFIKNWGLAGELNQSEGFGAYLAGVGFDLTLP
FT                   GFAVAGLNLYYRYDSVLDSIDEGNQWQVSPFWTVPFSIGKVPFLFTGFVDVNGTHDFAA
FT                   DESFVEIWAQPQLLVDALAPFGGKPNRLWVGTEWFYHRHPVETASAPQIMVQWTVY"
FT   sig_peptide     complement(230337..230408)
FT                   /locus_tag="Anae109_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.915 at
FT                   residue 24"
FT   gene            complement(230507..231532)
FT                   /locus_tag="Anae109_0195"
FT   CDS_pept        complement(230507..231532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0195"
FT                   /product="Arginine N-succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="PFAM: arginine N-succinyltransferase beta subunit;
FT                   KEGG: ade:Adeh_0178 arginine N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24413"
FT                   /db_xref="GOA:A7H6R7"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R7"
FT                   /protein_id="ABS24413.1"
FT                   /translation="MLLLRDAQKSDLPSLSRLAKVLNTVNLPYDERALARIIEQSVRSF
FT                   AGRIRDPLQRAYVFVAEEPRSGRIIGTSMVIAQHGTRESPCTFFDVSEREHYSSTIDRH
FT                   FKHEVLSIGYHFDGPTEIGGLVVDPEERGGEERAGKQLAYVRFLYLAMFRERFREKVLA
FT                   ELMPPLTKDGRSAFWEAFGKRFTDLDYQTADKKSRENKEFIQQLFPPVDVYATLFPEQV
FT                   QRNLGKVGPETEPVRRMLERIGFHYVNRIDPFDGGPHYEARLEDVTLVRAYRRAKLAPE
FT                   PLERDGEERLVGRYRTGGKIRFRAVRTPARLDGEVLRIPAKARAILEASPGERLHLVPF
FT                   E"
FT   gene            231669..232130
FT                   /locus_tag="Anae109_0196"
FT   CDS_pept        231669..232130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0196"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   ade:Adeh_0179 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24414"
FT                   /db_xref="GOA:A7H6R8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R8"
FT                   /protein_id="ABS24414.1"
FT                   /translation="MERSVRAVVQRVSRAEVRVEGRVSGAILRGLLVLLGVAREDGPSD
FT                   ADLLADKLAGLRIFEDDAGKMNLSVGEVGGGLLVVSQFTLLGDARKGNRPSFVDAANPE
FT                   LANALYERVCGRLREKGLAVATGVFRAHMDVELVNDGPVTILLDSRRLF"
FT   gene            232200..232544
FT                   /locus_tag="Anae109_0197"
FT   CDS_pept        232200..232544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0197"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   ade:Adeh_0180 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24415"
FT                   /db_xref="GOA:A7H6R9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R9"
FT                   /protein_id="ABS24415.1"
FT                   /translation="MSDCLFCKIVAKTLPAKIVHEDADTVAFEDLNPQAPTHVLIVPRK
FT                   HVATMVDLAPEDDALVGKLFRAGAAIAKARGIDGPGYRVVMNHNRDAGQSVFHIHLHVL
FT                   GGRRMGWPPG"
FT   gene            complement(232548..233459)
FT                   /locus_tag="Anae109_0198"
FT   CDS_pept        complement(232548..233459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0198"
FT                   /product="membrane protein involved in colicin uptake-like
FT                   protein"
FT                   /note="KEGG: pin:Ping_0445 membrane protein involved in
FT                   colicin uptake-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24416"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S0"
FT                   /protein_id="ABS24416.1"
FT                   /translation="MTYAAAVVAALLSSQAQAQASPRTPPPREAVQTIAIPERQAGAEE
FT                   PGQQGAAATEARAPDERAASAPSPTGAPAPPAAAPEAGPTAAADPATPGAAGIARPEAS
FT                   SPGGEESLEADRQEAIREEQIRLDAQALADAQSAARAEQLQLEIEALRDEVDAQRARAE
FT                   ALEERLQAREAEEARRAAEAAESTLARAESTAAALGDLDTAMRALEAGDSRGLDAALAS
FT                   QADALEATRGEAQRHGALAEAAGTGASAAHLAEAREALARGDLFTARLALVRATLAARG
FT                   AHALAREGAGAAAATTGTGAGY"
FT   sig_peptide     complement(233403..233459)
FT                   /locus_tag="Anae109_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 19"
FT   gene            233584..234453
FT                   /locus_tag="Anae109_0199"
FT   CDS_pept        233584..234453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0199"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ade:Adeh_0181
FT                   citryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24417"
FT                   /db_xref="GOA:A7H6S1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S1"
FT                   /protein_id="ABS24417.1"
FT                   /translation="MNLVRPRRSVLYVPGAHARALEKARSLEADGLILDLEDAVAPAAK
FT                   GDARARVVEALRAGGFGQREVAVRVNGLATPWGPDDLAAAARARPDAIVLPKVESAAQV
FT                   HAADAALAAAGASERLALWCMIETPRGVLAAAEIAAASRRLACLVAGTSDLVKDLGARH
FT                   TPARTEVLTSLGLIVLAARAFGLAALDGVHLELDDDAGLEASCRQGRDLGFDGKTLIHP
FT                   RTIAAANRAFAPDPAELEEARRVIAAHASAEAAGQGVVVVDGRLVEALHVEAARRRVAL
FT                   AEAIGARR"
FT   gene            234534..234788
FT                   /locus_tag="Anae109_0200"
FT   CDS_pept        234534..234788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24418"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S2"
FT                   /protein_id="ABS24418.1"
FT                   /translation="MRSFDSPRRRRYRLLKMRSSRNLEEGDASAPHACEDVRCGCGCLL
FT                   ARVIDGAVELKCRRCKHVWRLPVEGAPRPLARPDRVDAG"
FT   gene            234877..235230
FT                   /locus_tag="Anae109_0201"
FT   CDS_pept        234877..235230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0201"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase
FT                   of the AroH class; KEGG: ade:Adeh_0182 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24419"
FT                   /db_xref="GOA:A7H6S3"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S3"
FT                   /protein_id="ABS24419.1"
FT                   /translation="MRGIRGATQVAANTVPAMEEAVVELCREIERRNEIGPADVVWAIF
FT                   TVTHDLDADFPARAARVAGWTQVPMICSQEIPVPGSMPRVVRVLLHVDSAGPRSHVYLR
FT                   GAQALRPDLHRQP"
FT   gene            235260..236138
FT                   /locus_tag="Anae109_0202"
FT   CDS_pept        235260..236138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0202"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA; KEGG: tte:TTE1013
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24420"
FT                   /db_xref="GOA:A7H6S4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S4"
FT                   /protein_id="ABS24420.1"
FT                   /translation="MVPIEKSASEAEIEGVPEPYALASLELHPGRTVVTVGRGTGAVTF
FT                   GGARVPVVAGPCAVESWEQLEAVARAARAAGARLLRGGAFKPRSSPYTFQGLGEEGLKL
FT                   LARARELTGLPVVTEVMSPDAVGLVAEYADCLQIGARNMQNYDLLRAVGRASKPVLLKR
FT                   ALSGTIEELLMAAEYVLAAGNPEVILCERGIRTFERATRNTLDLSAVPVLKELTHLPVL
FT                   VDPSHGTGKRSLVPAMALAAVAAGADGLLLEVHPDPARARSDGPQSLTPADLEALVPRL
FT                   AAVASAVGREL"
FT   gene            236141..236998
FT                   /locus_tag="Anae109_0203"
FT   CDS_pept        236141..236998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0203"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: ade:Adeh_0183
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24421"
FT                   /db_xref="GOA:A7H6S5"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S5"
FT                   /protein_id="ABS24421.1"
FT                   /translation="MAASPFPRTVGVVGLGLMGASLARAVRAADPGVRLVAVEPREDVR
FT                   AQALADGVADEARAAPDVALEACELAVLCTPVAAIEALLGPVSRLLPDGAVLTDVGGAK
FT                   AHVVAAARASVRPGVAFVGAHPMFGGHGGYAGASAEKWKGGTVAVCTDAAPAEAPDAVE
FT                   RVVALHLALGARVERCTAAEHDAAVAMVSHLPYLVASALAVAAREAGPLAVRLAGPGLK
FT                   DMTRLAAFPFDIQGEVARRNAGLPEAAARLERHLARLLAAIAESPEAARSALEAARAAR
FT                   EEIF"
FT   sig_peptide     236141..236227
FT                   /locus_tag="Anae109_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.967 at
FT                   residue 29"
FT   gene            236995..238287
FT                   /locus_tag="Anae109_0204"
FT   CDS_pept        236995..238287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0204"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   ade:Adeh_0184 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24422"
FT                   /db_xref="GOA:A7H6S6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6S6"
FT                   /protein_id="ABS24422.1"
FT                   /translation="MTGSLTCRRKGPLRGSIEVPGDKSISHRALLFGALSTGETRVRGL
FT                   LDAEDVHATRRAVEALGATVRAEGEELVVVPPPALREPGDVVDCGNSGTSLRLLTGVLS
FT                   GVPGLSILTGDASLRRRPVRRVIEPLRRMGADLSARDGDRLPPVVVRGRPLRGARHVLE
FT                   VASAQVKSACLLAGLFAEGETTVVEPERSRDHTERMLAGMGVPVRVDGLEVTVAPARPR
FT                   GGRVDVPGDISSAAFFLCAAAALPGSEVTVRNLGVNPTRTGLLDVLGAMGAALSRANER
FT                   EVAGEPRADVTVRAAALHGTEIGGAIIPRLIDELPVVMVMATQARGRTVIRDAKELRVK
FT                   ESDRLASMGEALARAGAKIELFEDGCAIEGPTPLRGVAVQTRLDHRIAMSMAVAQLLAG
FT                   GEEVVLDDVACVATSFPSFFALLDGLCEGGA"
FT   gene            238284..239123
FT                   /locus_tag="Anae109_0205"
FT   CDS_pept        238284..239123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0205"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: ade:Adeh_0185
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24423"
FT                   /db_xref="GOA:A7H6S7"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6S7"
FT                   /protein_id="ABS24423.1"
FT                   /translation="MITGRTALYGVLGNPVRHSRSPQMQAAAFEHLGLDATYVALPVEP
FT                   ERLPAAVAGAHALGFQGLNVTVPHKRAVVALCEAVDPVAREVGAVNTLRRTERGWEGFN
FT                   TDAAACLMLLREEGLRPGAPALLAGAGGAARAAAWALVRAGAVLRIAARRQDAAERLAA
FT                   ELGPLAGPGTPAPVAVPWGALEAEADAAEAVVNGTTVGLHPEDAPLPLRVRAGQLVADF
FT                   VYGDTPLARAARDAGARLVSGERILVRQGALSFALWTGRAAPEALMAAAIAAPGRAT"
FT   gene            239120..240265
FT                   /locus_tag="Anae109_0206"
FT   CDS_pept        239120..240265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0206"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: ade:Adeh_0186
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24424"
FT                   /db_xref="GOA:A7H6S8"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6S8"
FT                   /protein_id="ABS24424.1"
FT                   /translation="MTIRYLTAGESHGPGLVAIAEGFPAGLAVDFDEVNRDLRRRQKGY
FT                   GRGGRQKIEKDEAEFLAGLRGGVTLGAPIALVVWNKDHESWKDLVSPYARGGRPFTQVR
FT                   PGHADLAGALKYALTDARDVLERASARSTAVTVALGSLAKQLLARFGVRVSSRVVAIGP
FT                   RLRHVEEPPTDAERDAIEASDLHVEDEAVAAEWRALIDAEKARGGSIGGAFDVHATGLP
FT                   IGLGSHVHPDRRLDARLAGALCGVQAIRAAEIGDGTQVGRSGPEFHDAIQHDPARGFHR
FT                   PSNRAGGLEGGMTDGMPLRVRAYMKPIPTMLTPLATVDLATREATQARYERSDVCAVPA
FT                   AAIVGEAVVAWELANAFLEKFGGDALVDVEKAVEAYAARIR"
FT   gene            240246..240737
FT                   /locus_tag="Anae109_0207"
FT   CDS_pept        240246..240737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0207"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: ade:Adeh_0187
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24425"
FT                   /db_xref="GOA:A7H6S9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S9"
FT                   /protein_id="ABS24425.1"
FT                   /translation="MPLASAETLALAGMMGSGKSTVARHLGRLLGRRVVHLDEEIVRAA
FT                   GKPIPAIFAEDGEPRFRALEREAVAALPAGVVADLGGGAFCDPASAARLLAAGRVVFLD
FT                   VSAAEAARRLGAGDAGRPLAERWPELLGRRLPLYRRAHLTVAVDGLTAEAVARRILESL
FT                   "
FT   gene            240734..241909
FT                   /locus_tag="Anae109_0208"
FT   CDS_pept        240734..241909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0208"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: ade:Adeh_0188
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24426"
FT                   /db_xref="GOA:A7H6T0"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T0"
FT                   /protein_id="ABS24426.1"
FT                   /translation="MTDVVEVIPARQGEHEYPVRVGAGAAELVGALADEHDRVMLVSCA
FT                   RVLRTPFGRAVRARLEREAPLALVHVLPDGERGKTLRELERAAVAMLRAGATRGSLVVA
FT                   LGGGAVTDAAGFLAATYMRGVRWAAVPTTLLGMVDAAIGGKTAVNLPGAKNAVGAFHPP
FT                   EAVLADPAALETLPARELRSGKGEVLKYAALQPALLGAFGQQLAGDEVDPLVIATCARM
FT                   KVDVVEADPTEQGPRKLLNLGHTFGHGVEAAGDFSRYAHGEAVAIGLAFAFRLAARLGR
FT                   VGADAVAAVEERIAQAGLPARVPRADARAAAKLMAFDKKRGEGGLRWVLPLATENGGWT
FT                   VEWDVAAEPAAIEATVAELEAPAPSRASTPARGRARLARGRGAAGKAKATR"
FT   gene            241906..242373
FT                   /locus_tag="Anae109_0209"
FT   CDS_pept        241906..242373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0209"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II; KEGG: ade:Adeh_0189
FT                   3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24427"
FT                   /db_xref="GOA:A7H6T1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T1"
FT                   /protein_id="ABS24427.1"
FT                   /translation="MILLVNGPNLNLLGEREPDVYGRTTLAEVEALVRDACAAWNVEVK
FT                   AFQSNHEGALVDFLHEHRKVARGIVLNPGALTHTSYVLHDCLKSIPHVPVIEVHLSNIH
FT                   AREAFRRTSVVAPACRGQITGLGMRGYLLAAEWLCAEIGAVPVEREGAVRG"
FT   gene            242411..243415
FT                   /locus_tag="Anae109_0210"
FT   CDS_pept        242411..243415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0210"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ade:Adeh_0190 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24428"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T2"
FT                   /protein_id="ABS24428.1"
FT                   /translation="MPRVAVLMPARDAAATVRAAAVSILRQTERDLALVCVDDGSRDAT
FT                   GEVLERLAARDRRVVVVRGPGEGIARALNRGLTRCDAELVARMDADDVAHPQRLALQRE
FT                   ALGADPTLAVLGARVRLFPGPLVRPGMRRYVGWLNGLTTPGELRRDLFVEAPLVHPSTT
FT                   LRRATLEAVGGWRDGDFPEDYDLWLRVDAAGGRLANHPRTLLAWREAPTRATRTDPRYA
FT                   LARHVALKCRYLAAGPLAGRREVALWGAGETGKAFADALAREGIGVAMFVEVDRNKIGR
FT                   QVRGAPVVGYQDVGRVRGLPLLVAVGAPGARGLIREELAKGGFEEVRDFRCVA"
FT   gene            243522..244613
FT                   /locus_tag="Anae109_0211"
FT   CDS_pept        243522..244613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24429"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T3"
FT                   /protein_id="ABS24429.1"
FT                   /translation="MVLMRSPSSVGSGPAPSFDLAAFRRALTDRTAAAVKALRAQIGSE
FT                   TLYAFALYTSAESGYAWVEASANTEEGLARAATSRAADDPRFRGEAGRRLLRWSVEDWA
FT                   HHDFDAAVRAVPLPDPLERRESLDRALLTAMVGALRTLDRAGLFGRGADRAFLTVNVLC
FT                   PHPSRAFFVRNLRALNPVPTVERHLRETDPAPFVRAVNRAPRRERMRIWLALYEDLYME
FT                   WKTPIAEEARARGMSPWEVEVELARFGPKVVPKLVDLLAHYGFAPPFDSARELETREVW
FT                   LAGSALFLVRRIGLVPESQIRRLQALVGAFEERDRRLKIASTLAENTARVLHELRPRKF
FT                   PESVMDPQTYKLLNPEPFLPRRP"
FT   gene            complement(244636..245532)
FT                   /locus_tag="Anae109_0212"
FT   CDS_pept        complement(244636..245532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0212"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: ade:Adeh_0195 pseudouridine synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24430"
FT                   /db_xref="GOA:A7H6T4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T4"
FT                   /protein_id="ABS24430.1"
FT                   /translation="MKRLSLVVASADGGERLDRFIAARGGVSRGAARRALDSGGVFLDG
FT                   RRCKVSGRLLQAGQKVVVNLEEAGRAAPARSALERARLLYADQDLVAVDKPAGVPSQPT
FT                   LTTDRGTLPELVSDLLGAPVTLVHRLDRETSGVTVLARTAAAAAALAEAFRTGTPEKTY
FT                   LALCARPPAPPDGRIDAPLGKDPARAGLRRVDPRGDAAATRYRTLRAGPLAALVEARPE
FT                   TGRTHQIRVHLAHLGAPLLGDPRYGGPRRVGEVAIPRVMLHARRLEIDHPATGARLLLE
FT                   APVPEDLRAAEGALLPQ"
FT   gene            complement(245543..245839)
FT                   /locus_tag="Anae109_0213"
FT   CDS_pept        complement(245543..245839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0213"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   KEGG: ade:Adeh_0196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24431"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T5"
FT                   /protein_id="ABS24431.1"
FT                   /translation="MPIYEYECPKCGRFDHLQKMSSPALEVHDVCGSKVTKLMSASAFA
FT                   FKGSGFYITDYNGRNSAAITGKGDKAESKPEPKVESKPDACATCPAKQGAGAC"
FT   gene            245984..247354
FT                   /locus_tag="Anae109_0214"
FT   CDS_pept        245984..247354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24432"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T6"
FT                   /protein_id="ABS24432.1"
FT                   /translation="MDALEMDLLGAEVDRLAAAVDEERFRHVAGLEREPSLAPLFAASS
FT                   RAAHRETVQALRERGEEPLAGRVAALRAERAQAEAEEAWRAEEAQATARGPDGTAPLAA
FT                   LEAALVREPDRARRLGLARAAAEALAPVASLRERAVEARARARAEVGLAPDWRLVVEGD
FT                   QALAASDDAFRDVLAFAARRELGLGPQPGGELARADLLHLVEAPRYDGLFRPGMLPIAL
FT                   KLTLEPLALDLGRVRIDDAARAGKWPGAHALGARVSFRPRGGAGDWHDLLAAVARALPA
FT                   AVAAARRADPVLGEALSWVLGGLLLEPRWLHDRAGVDRRQAPDVVRALALRRLLALRAD
FT                   AAALRVATEVERGLSGAAWREAHREALTAATGAAWDVGRASRDADAGRLGAALSGAAAG
FT                   EALRRALVERYDEDWWRNPRTAAHLAGLLAAGRLPEAAEPPAPAEAARRLVGKLEGR"
FT   gene            complement(247368..247808)
FT                   /locus_tag="Anae109_0215"
FT   CDS_pept        complement(247368..247808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24433"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T7"
FT                   /protein_id="ABS24433.1"
FT                   /translation="MRYRGLAPTSLRRPSGSRKMDRGRCPPTMTFMETKKKPGVAVVTE
FT                   GTAQAALRRSAAKELAPAEEKVLRMRLGATPPRAAPLEKAGAGLSDLEIELLAYEIEAH
FT                   LKWKAHKAAQESGRESARAAPALTPVPSRTKEKIIRALRKKT"
FT   gene            247919..248365
FT                   /locus_tag="Anae109_0216"
FT   CDS_pept        247919..248365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0216"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   ade:Adeh_0199 CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24434"
FT                   /db_xref="GOA:A7H6T8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T8"
FT                   /protein_id="ABS24434.1"
FT                   /translation="MADWRANILDDDAALRPLLRSTRRVAVLGMKTEAQASQAAFYVPQ
FT                   YLAGQGVEVVPVPVYYPEVQEILGRRVYRSLAAVPGDIDLVDVFRRPRDVPGHLDDLLA
FT                   KRPRAVWLQLGIRHDAVAEQLARAGIQVVQDRCLMVDWRRLVSG"
FT   gene            complement(248368..249423)
FT                   /locus_tag="Anae109_0217"
FT   CDS_pept        complement(248368..249423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24435"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T9"
FT                   /protein_id="ABS24435.1"
FT                   /translation="MTRTLALTLAALLAACSGGPEPEGKQRLEGGADTARAGQAATVDP
FT                   SKPREALALTADEVAARLGSFEWSAAIDWTVAREGDDPAPPPPPATAPAVDGKPAPFVP
FT                   PPPPPPRVHALERHRLRQSATGEFHVEADVDPGLGPGSDTGKEIIYAGGMTYARARYAP
FT                   FRERPTDRGRDARRFRDDSFRVAHALAALYGEALALEPAGEATVAGRSARRFRLSLAPG
FT                   APQAAAKPRVLPTGAPDPDSAARFAFLDARVPESAEGELLLDAETGAPLRVRLAGSFTV
FT                   KDAPGVRARVELLAQVTALGETAAPIAAPSAALPDVRKPPGVAGALEAAGLKKKAADAE
FT                   AGASEPADDEP"
FT   sig_peptide     complement(249367..249423)
FT                   /locus_tag="Anae109_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.735 at
FT                   residue 19"
FT   gene            complement(249473..251272)
FT                   /locus_tag="Anae109_0218"
FT   CDS_pept        complement(249473..251272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0218"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   ade:Adeh_0203 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24436"
FT                   /db_xref="GOA:A7H6U0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U0"
FT                   /protein_id="ABS24436.1"
FT                   /translation="MQDVLGNTLGLKPSQLHALRRTYRRRVDAASIVSPELARHLSEVS
FT                   RETNRQIGVLLDRKGDVHSVIVGDARKLELPDVGRGRAGESRLRGLRLVHTHLNGEPLT
FT                   RDDHTDLALLRLDLVAAIEVREDGLPGKVHFAHLVPENAQGAMWKDEAAASVHDLAYDA
FT                   LSGALALEEEFARARAVRRTGGRERAILVGFGGKGRSRADAESSLEELKELARTAGVEV
FT                   IDATVQLRRDPDPRYLIGKGKLEDVVLRSMQLMATVIVFDAELSPSQARHIAEATSLKI
FT                   LDRTQLILDIFAQRAQSADGKLQVELAQLKYLYPRLVGRDDSLSRLAGGIGGRGPGETK
FT                   LEIDRRRVRDRITALERRIEALGSSRQLRRKQRNGRGLPVLSIVGYTNAGKSTLLNALT
FT                   DSAVLAEDKLFATLDPTSRRLRFPRDREVIITDTVGFIRDLPPDLVNAFRATLEELSDA
FT                   DLLLHVVDASDPRHPEQIEAVETILASLGLEQKQRLLVFNKADRLPPGEGAALAHRAEG
FT                   IAVSALSRDGLAELLHLCDRLLWEDRRVAFADVAASAPPPPATPEPGEEGAARAAATDR
FT                   AAPEPTPPSPAARLLPSRIARVS"
FT   gene            complement(251386..251691)
FT                   /locus_tag="Anae109_0219"
FT   CDS_pept        complement(251386..251691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24437"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U1"
FT                   /protein_id="ABS24437.1"
FT                   /translation="MNGRPIPRAARLLKLEGVFDVSAAQRVARALAEGDADEPVHLDLT
FT                   HVREFHDFGVAFLAQVLAVRPRHVAVRGLRQHHLRLLRYLHIDTAGVDLGPESGAA"
FT   gene            251903..252619
FT                   /locus_tag="Anae109_0220"
FT   CDS_pept        251903..252619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0220"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: nha:Nham_3915 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24438"
FT                   /db_xref="GOA:A7H6U2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U2"
FT                   /protein_id="ABS24438.1"
FT                   /translation="MQRVPHGRAAPTLQDMARPEAVLLDVDGTMVDSVDLHARAWQEAL
FT                   RRFGRDVPLPEVRRQIGKGGDQLVPVFLPPEQLAREGEALERFRAELWRREYMAQVRPF
FT                   PGARALLRRAREAGLRVALASSGSEEEVAHNRRLLDVDALLEGSTTSDDAARSKPHPDI
FT                   FEAALARVRAPPERAIAVGDSPWDALAAGRAGVRTVGLLSGGFEERELREAGCVAIYAG
FT                   PADLLARFDESPLARG"
FT   gene            252794..254053
FT                   /locus_tag="Anae109_0221"
FT   CDS_pept        252794..254053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0221"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ade:Adeh_0206 major
FT                   facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24439"
FT                   /db_xref="GOA:A7H6U3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U3"
FT                   /protein_id="ABS24439.1"
FT                   /translation="MATLVSPEAGAPAGARSVLNAAVIVAALGYFVDIYDLILVSIVRK
FT                   PSLTALGVAPELLLTEGFSILNWQMIGMLLGGIVFGVVGDKLGRLQILFGSITLYSLAT
FT                   LANGFVTDLSTYKVLRFVAGLGLAGELGAGVTLVSEILPARLRGYGTMIVASVGVSGAV
FT                   AGNLVAKWLDWRWAYFVGGGLGLVLLVLRIKVHESGMFRKVARQAGISRGDFFSLFTDR
FT                   ERFTRYLASILIAVPIWFANAILVLGAPEFAQALGVTGPVSAGDAVMFFYGGLVVGDVA
FT                   SGSLSQLLRSRRRVVLLFLSLLAAAIAAYFLAGRGASPGLFLALCGLLGVTSGYWAIFV
FT                   TIAAEQFGTNIRATVATTVPNFVRGLVVVVTSTFVWLRPQVGLVGGALAVGAIWFALAL
FT                   GSALRLRETFGIDLDYVERD"
FT   gene            254063..254581
FT                   /locus_tag="Anae109_0222"
FT   CDS_pept        254063..254581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24440"
FT                   /db_xref="GOA:A7H6U4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U4"
FT                   /protein_id="ABS24440.1"
FT                   /translation="MSLYVVDVEADGPIPGKYSMVSLGAVLVEPGLGRTFYGRTRPIAD
FT                   AFLPDALAVSATTREEHLRFDEPGEVMAAFERWIQETTRGKPVFFSDNLAFDWQFVNWY
FT                   FHTYLGRNPFGWSGRRIGDLYCGMVKDAYAQWKHLRKTGHDHHPVNDAKGNAEALLAMI
FT                   DMGLKLTAR"
FT   gene            254879..255286
FT                   /locus_tag="Anae109_0223"
FT   CDS_pept        254879..255286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_1246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24441"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U5"
FT                   /protein_id="ABS24441.1"
FT                   /translation="MNAERAEYLLVGGYALAVHAAPRFTKDLDVWVAPTTANAVRVRAA
FT                   LERFGAPLADLRESDLATPGIVFQIGVPPNRIDVLTAIDGVTFTEAWPERIETTYGGEP
FT                   VPVIGRLQLIANKRASGRPQDLLDAEMLERG"
FT   gene            255348..255965
FT                   /locus_tag="Anae109_0224"
FT   CDS_pept        255348..255965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0224"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ade:Adeh_0208 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24442"
FT                   /db_xref="GOA:A7H6U6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U6"
FT                   /protein_id="ABS24442.1"
FT                   /translation="MISPAALTLFLTGATLGLSAAAQPGPYQAYLLAQSLRNGAARTLP
FT                   VALVPFVSDPAVIAVVLVVLAQVPAGFLRVLQIVGGAVVLWLAVATLRAARAGGPVEGR
FT                   APPRGFVRAAVVNLTNPNAWMFWSLVGGPVLAEAWRDAPVRALAFLAGFYLFLTGGNFA
FT                   LVGLASAASRLGPRFTRALGLVSGAALLAFGAWQIGRGLAGA"
FT   sig_peptide     255348..255416
FT                   /locus_tag="Anae109_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.924 at
FT                   residue 23"
FT   gene            256046..256546
FT                   /locus_tag="Anae109_0225"
FT   CDS_pept        256046..256546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24443"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U7"
FT                   /protein_id="ABS24443.1"
FT                   /translation="MPRLALVAALLLSLAPSARAGTPAPAGRAAAAVELARFALPRATW
FT                   DQTLAAVLGQIEQQAASGGSALPAGFSEALREELGQLFSYEEILDLQAGLLAKHYTEAE
FT                   MQQLVAFYRTPLGQKTIRIMPEVAADAMGQVQVLMGQRVPAMMERLQRRFGPEAAKAKA
FT                   GAK"
FT   sig_peptide     256046..256108
FT                   /locus_tag="Anae109_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            256593..257726
FT                   /locus_tag="Anae109_0226"
FT   CDS_pept        256593..257726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0226"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: ade:Adeh_0211 glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24444"
FT                   /db_xref="GOA:A7H6U8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U8"
FT                   /protein_id="ABS24444.1"
FT                   /translation="MRSALSRTKRLVVKVGTGTLTDPSGRFDRANCARLGAELAELARR
FT                   RRVVLVSSGAVALGAERLGLARSRGKPWDIPTKQACAAVGQPHLMAAWGDALGAHGVTV
FT                   AQVLLTADDLASRKRFLNARRTFDKLLEAGVVPVVNENDTVAVDEIKVGDNDTLAGLVA
FT                   GCVEAELVAMLTDVEGLYDRNPSEPGASLLHDVPRVTGEIERIAGGAGSERSVGGMATK
FT                   VKAARRLGAQGVTTALLSGRRPRALAALLAGDRVGTVFARGAARLTSRKGWLAAAAKGK
FT                   GVIVVDPGARRALTEQGRSLLPSGVRAVEGHFGVGDPVDIAVDPARPFARGLAGYGADE
FT                   VRRIAGLKTGEIERALGYKYLDEIVHRDDLVVLEARE"
FT   gene            257732..259018
FT                   /locus_tag="Anae109_0227"
FT   CDS_pept        257732..259018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0227"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   ade:Adeh_0212 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24445"
FT                   /db_xref="GOA:A7H6U9"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6U9"
FT                   /protein_id="ABS24445.1"
FT                   /translation="MRQPASEGLAAEMRRLAEASSDASRALSRAQPRAKDEALRAAADA
FT                   IGRRAKEILAASAEDVAAARAAGQSAAYLDRLALDPKRLDGIAAALREVAALPDPVGEV
FT                   TATWRRPNGLSVKKVRIPLGVVLMVYEARPNVTVDAAALCVKSGNAAILRPGSDALRSS
FT                   LALAAAFAEGLAAAGLPAASAQVVPTSDREATFELLQLDDLIDLAIPRGGPSLIRAVAE
FT                   RSRVPVVKHYQGVCHLFLDQSAPLQQAIDLALNGKVQRPAVCNALECLLVHREAAGRLL
FT                   PAVGRALVDAGVELRSCPTSTTILARAGVPAVTAAPDDYGKEFSDLILAVRVVHDLDGA
FT                   LDHIARYGSLHTEAILTRDLASARRFEREVTASAVMVNASTRFNDGGELGLGAEIGIST
FT                   TKLHAFGPMGLAELTTQKFVVEGDGQVRS"
FT   gene            259027..259602
FT                   /locus_tag="Anae109_0228"
FT   CDS_pept        259027..259602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0228"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: ade:Adeh_0213 iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24446"
FT                   /db_xref="GOA:A7H6V0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V0"
FT                   /protein_id="ABS24446.1"
FT                   /translation="MAIKKKATAKKTAKKTKPLKKTARSRQAPARGGKELARRRGPAPV
FT                   SQALKRVPRAAKKPAASAGGPVSAAPAAAPQPDHARPTALAIAHAGLDKKAEEVTVLDV
FT                   RGLTSYADYFVVMTADSDRQASAIADHVEQTMKAQGVSKVGVEGYETGRWILVDYGDVV
FT                   AHVMNRESRGFYDLEGLWADAPRFAVEG"
FT   gene            complement(259643..260938)
FT                   /locus_tag="Anae109_0229"
FT   CDS_pept        complement(259643..260938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0229"
FT                   /product="cytochrome C family protein"
FT                   /note="TIGRFAM: cytochrome C family protein; KEGG:
FT                   ade:Adeh_0215 multihaem cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24447"
FT                   /db_xref="InterPro:IPR010176"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V1"
FT                   /protein_id="ABS24447.1"
FT                   /translation="MARITLGVALRAAAVTLLVAAACESRAPLPRRQRVEAGPCDTCHA
FT                   APPATGAHLAHVAPAALDGLAYGDLRVLEDVATGGTRYAFGCGHCHPVDEAAHEADLGD
FT                   DGLPDVVLTPPVPLVAGDVIKARNTPQAGWDSASGSCSGVYCHSSGQGHPEAQLEYRAT
FT                   PAWTAAPGTLGCGGCHGNPPGYASSGPGATSAAPNSHIQLAEDGSLAWEWGHYAGMPGP
FT                   YHYPLHGSPTAGFAAAPITCQTCHFETVDPAHTTPGGFYYLDTSGDYALDGGDPARLSH
FT                   PSWARTQCVTCHGEGLRAPAAGGAVLPLRHVNGRPDVAFDRRSALPDGYVTGLPALATT
FT                   APIAPYYVSPFNVSMIGWELPPGSEIRLTETGKEVLTVSLEQASYDPATRTCSNVGCHL
FT                   GRQSMVNAGYPPLQWGEPYVRSVSCDRCHSMF"
FT   sig_peptide     complement(260870..260938)
FT                   /locus_tag="Anae109_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.829 at
FT                   residue 23"
FT   gene            complement(261067..261966)
FT                   /locus_tag="Anae109_0230"
FT   CDS_pept        complement(261067..261966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0230"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ade:Adeh_0216 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24448"
FT                   /db_xref="GOA:A7H6V2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V2"
FT                   /protein_id="ABS24448.1"
FT                   /translation="MRARIVLVYVAIAFLWGSTWAVIRIGLEHLPPLRFAGIRMALAAA
FT                   ILAPFALRGGAWRVLAGEVGPRVAVVGLFQIAIPYGLMFVAQQWVPSGLAALLFASFPV
FT                   WISLLARVFLPGERLTPAKLASAALGVAGIAVLQWPHLGSLEGSGELALGSALIVSASI
FT                   VVAIANVLVRRHLVAVTPLAMTAGQTFVGAVVLLVAALVFESGRPAAYVPAALAALAYL
FT                   AVFGTALTYIGLYWLVPRVPIAAIGALPLLDTTVAVSLGALLLGESLGWHLALGGAMVL
FT                   AAAALATRDAPRTSDGGA"
FT   sig_peptide     complement(261901..261966)
FT                   /locus_tag="Anae109_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.781) with cleavage site probability 0.777 at
FT                   residue 22"
FT   gene            262098..262796
FT                   /locus_tag="Anae109_0231"
FT   CDS_pept        262098..262796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24449"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V3"
FT                   /protein_id="ABS24449.1"
FT                   /translation="MTRALSLSLAVVAVAASACATSSKENQFRPVAQEDVGRLSAQQMA
FT                   PISAARQDLARANDELARAKLRMAEASRDRGLSEAEKTAVQADQQRAAALSKEADASRE
FT                   PAKLAAARQAAAAAQLRQRASEAHQDYTAKIIAAREAEVRAAEARVAEMQARLDQAQLA
FT                   ALQQAGIPAATKYDPASFQRRVAEAAGASQRAQTELARAMGAAQQSENQWRALSEQLRV
FT                   PQQGTATGGR"
FT   sig_peptide     262098..262160
FT                   /locus_tag="Anae109_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.551 at
FT                   residue 21"
FT   gene            262950..264332
FT                   /locus_tag="Anae109_0232"
FT   CDS_pept        262950..264332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24450"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V4"
FT                   /protein_id="ABS24450.1"
FT                   /translation="MPLSVFVALALSAGAPSAPGACGCPDPETAPTGLLWRGAGPLPPG
FT                   ELARLAAPIVWFSRDEPLVVPGATPPPDPHPCDAEAPRDSPVVYWSLDRVQLRGTDQLA
FT                   RPVEEDARLMERAVSAVFRFFFYYREDVGVGHHPNDIELVDVTVNLVRESGCWEARVRS
FT                   VTGFAHGVDWYSNELAVQPDTRLPITILVEEGKHASCPDRNADGIYTPGYDVNRRINDA
FT                   WGVRDVIGSGFLLSSGYAASMTKPRTPIERVLPPEPGPPCATGRRSSVRDPDAALGRYV
FT                   LRPAREVPICLQAPEPRALEASMRRNHFGLDHEAPQRWFELGDALEQPINGTESLVPSI
FT                   ALRWDGGLGFAALFRGLDLRELYLVPRLSFVGVADALELLVTNSAARFASGYASAGVAR
FT                   EESEWRFVSEAGLKLRVTAKGWQRVLSLGYQFAGLRVGVRSSGFDPLEDLRFVAELGAG
FT                   VW"
FT   sig_peptide     262950..263021
FT                   /locus_tag="Anae109_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.878 at
FT                   residue 24"
FT   gene            264326..264682
FT                   /locus_tag="Anae109_0233"
FT   CDS_pept        264326..264682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0233"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   cya:CYA_0899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24451"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V5"
FT                   /protein_id="ABS24451.1"
FT                   /translation="MVSPMSARDDRVRLKHMLDASRVVEAFAAGRTREDLDRDLQLTFA
FT                   LARAVEIVAEAAKDVSEERRMHHPGVPWRAIAATHHRLVHDPLALDLDRLWHIVSVDVP
FT                   VLIPHLRDALGETP"
FT   gene            264722..265276
FT                   /locus_tag="Anae109_0234"
FT   CDS_pept        264722..265276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24452"
FT                   /db_xref="GOA:A7H6V6"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V6"
FT                   /protein_id="ABS24452.1"
FT                   /translation="MREPARDAGSSCERWGKGITLGRSRARCGDTFAMSRLATSKWVTT
FT                   KRSGRFLDLIVGLFTALLFLIALALGPGVGCDPCVNSVMSEASSPSGDHRAVVFLRNCG
FT                   ATTSYSVELSILRGDERLPTWKGNAFSADAGYSDAPLKLEVHWDSDQALTVRHDPRLRL
FT                   FQNEAKVGPIGLRYVAAESAP"
FT   gene            complement(265748..266806)
FT                   /locus_tag="Anae109_0235"
FT   CDS_pept        complement(265748..266806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0235"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; tyrosine protein kinase;
FT                   SMART: serine/threonine protein kinase; KEGG: ade:Adeh_0217
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24453"
FT                   /db_xref="GOA:A7H6V7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V7"
FT                   /protein_id="ABS24453.1"
FT                   /translation="MVRKVGTSRIVREIGRGGMGVVYEAYQDGLERTVAVKSLDTKLAR
FT                   SKEIVERFRREGRAYARLRHEAIVGVHDLVEKDDGLYLVTDLVDGADLARVLATGGALP
FT                   ADCVAVIGARIADALDYVHFNGLLHRDVKPANVMVSRDGEVKLMDFGIAKGADDLSLTK
FT                   AGMLVGSPSYMAPEVLAGEEEGPGADVWALGVTLYELATGEKPFRGKNAEELFAAIARG
FT                   RFRKVRALAPDCPRRLAHAIERCLSRTPAARIASAGALARVLDATAARLVGREVHPRAR
FT                   LVALLANRGYATEEVALSKLDLSTLRATRIADVRGSATAAEFPIRRRAPFRIGLALILA
FT                   LAAGVAAWVVRI"
FT   gene            267079..270690
FT                   /locus_tag="Anae109_0236"
FT   CDS_pept        267079..270690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0236"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: ade:Adeh_0218 pyruvate-ferredoxin
FT                   (flavodoxin) oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24454"
FT                   /db_xref="GOA:A7H6V8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V8"
FT                   /protein_id="ABS24454.1"
FT                   /translation="MASRRMVTMDGNEAVASVAHRINEVIAIYPITPSSNMGEWADEWS
FT                   AKGQKNIWGTVPSVSEMQSEGGAAGAVHGALQAGALTTTFTASQGLLLMIPNMYKIAGE
FT                   LTAFCMHVSARSVATHALSIFGDHSDVMAVRQTGFGLLSSASVQEAHDFAAIAQRASML
FT                   SRVPFLHFFDGFRTSHEVAKMEELTDDDLRQMIPEELVAAHRSRALTPDKPTVRGTAQN
FT                   PDAFFQAREACNPFYAEAADHVQEAMDHFAKITGRRYKLFEYVGHPQAERVIVAMGSGC
FT                   DTIQETVEHLVAKGEKVGLVKVRLFRPFDLGAFMTAFPRTVHHIAVLDRTKEPGSLGEP
FT                   LYQDVVTALREAEQAHIDRFHHQLTVIGGRYGLSSKEFTPAMVKAVYDELSKARPKRHF
FT                   TVGINDDIGHTSLKYDPAFDTEPADVVRALFYGLGADGTVGANKNSIKIIGEDTPNFAQ
FT                   GYFVYDSKKSGSVTISHLRFGPRPIRSAYLISNANFVACHQFGFLEKYDMVEQAVPGST
FT                   FLLNSPYGPDEVWQHLPAEVQDQILQKKLKLYVIDAYKVARETGMGVRINTIMQTCFFA
FT                   ISGVLPKDEAIGHIKKTIEKTYARKGPEVVQKNFAAVDHTLAHLFEVSTAGRQVSGKPR
FT                   PPAVAEVAPDFVKRVTALMLAGKGDQLPVSAFPVDGTWPTGTSKWEKRSIALELPVWEP
FT                   SLCIQCNKCALICPHAAIRPKFFAPEALAAAPQGFVTMDFKSPDVKGNKYALQVSPDDC
FT                   TGCTLCVEICPAESKTEKGHKAINMKDAMPLKEKERTNWAFFLSIPEADRTRVKLDVKG
FT                   TQFLQPLFEFSGACTGCGETPYLKLLTQLYGDRAIIANATGCSSIFGANLPTTPYTQDE
FT                   AGRGPAWANSLFEDNAEFGFGMRLAIDKQAEHAKELLAKMGTVVGDGLVEEILKAEQGD
FT                   EAAIERQRARVKLLKQKLAAVDTFEARWLYKIADYLVRKSVWIVGGDGWAYDIGYGGLD
FT                   HVIAQGRDVNILVLDTEVYSNTGGQASKATPMGAAAKFATAGKSLPKKDLAMLAMTYGH
FT                   PYVARVALGAKDAQTVNAFKEADSYTGTSVIVAYAHCIAHGYEMSDALGQQEKAVESGY
FT                   WPLFRYDPRRVANGESPLKLDSPAPKIDLARFVENETRFRQVEASNPQGFAKMLEQAQK
FT                   DVRERYALYEQLARAMNPANLVPGAAAADGKPPKARA"
FT   gene            270910..272103
FT                   /locus_tag="Anae109_0237"
FT   CDS_pept        270910..272103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0237"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_0225 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24455"
FT                   /db_xref="GOA:A7H6V9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V9"
FT                   /protein_id="ABS24455.1"
FT                   /translation="MAGRSHRISALVAASTLALGACKGGGGEQAAAQPEPVTLAPENVT
FT                   TVTERTLQSGPDISGTLRARRAAALRAEVGGTVLEVLAEAGERVKPGQLLARVDDTALR
FT                   DALIAARSGVSAAKNTLQVAEANAKRARTLAEAGAFAAQQAEQAEAAHEGARAQLADAR
FT                   ARLVQAEQQVSKARVRAPFSGVVSERQVSVGDVVAPGAPLFTVIDPTRLQFEASVPAAQ
FT                   VGLVRPGARVDFTVTGFDRVFEGAIERVNPAVDPATGQVRVYVDVKNENGQLISGLYAH
FT                   GRVAAESSTGPSAPAAAVDDTSKPPTVMRVSGGKVERVEVQISVHDDVTGAVGFRAGVK
FT                   PGDVLVLGSARATLAEGAPVQVAPAGADQGSRAQPAPESGAPAETGGGAQASDGGGR"
FT   sig_peptide     270910..271002
FT                   /locus_tag="Anae109_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.268 at
FT                   residue 31"
FT   gene            272104..275307
FT                   /locus_tag="Anae109_0238"
FT   CDS_pept        272104..275307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0238"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   ade:Adeh_0226 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24456"
FT                   /db_xref="GOA:A7H6W0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W0"
FT                   /protein_id="ABS24456.1"
FT                   /translation="MLISDFAIKKPIVTVTVMLALVIFGLIALVALKTDEFPDVQPPVV
FT                   AVTIVYPGASPETVERELIDPIEDAIFSISGIDGEQTTASATDGLAQFIVFFDFEKDLQ
FT                   EATQDIRDAISEKRADLPLEMEEPIITRFDPADEPIVSLTLTSGSIDVPSLTRLADEVV
FT                   SRELRAVQGVADVRLVGGRKRELTVELNPQAMAAAGVSASDVVGALQAQNLAAPVGRVN
FT                   TPLGEQSIRLSGRLQTPDEFAAIAVATRGGQVVRLGQLGSVKDGAEEPRTLALYDTSEA
FT                   VGLEVLKTKGYSTTAVADEIKARAKALEPRLPKAAKLQVVQDAGERVRRSVNEVQTTLV
FT                   EGALLTVLVVFFFLNSWRSTVITGLALPVSVLAAFISVWMFGFTLNTMSLLGLSLAIGI
FT                   LIDDAIVVRENIVRHIELGEDHTTASFKGTDEIGLAVAATTFSIVSVFVPVAFMYGVAG
FT                   QWFKPFALTIAAAVLVSLFVSFSLDPMMSAYWPDPQIEKGQARGPVGRALGAFNAWFDR
FT                   QADRYKGVVAWALDHRWTMIALAGLSFFGAIFLQGAFGGAGFVPISDRSEVNLIVQTPP
FT                   GSSLDYTRAKVEEANAIVRSHPEVKYVYSSIGTPIPLQAPGVDQALVYVRLVPKADRAR
FT                   SQEELGTTLRRELKRVAGAEISVFTSGFGGAFKSIQLELRGPDSRVLAQYAEKVKAVAQ
FT                   AVPGAVDVGLSTRGQKPELEVAVNRGLAGNLGVTVGQVAQSLRIAFAGLDSGDWVDPTG
FT                   ETRDVMVRLAPEARERAVDLRQLPLVLHPQNGGNPQVVPLGQVATVREGLGPAQIAHLD
FT                   RERVINIQGNVAGRSLTEVVQDIERRLGAEVKLPPGYTIRQGGESRDQQEVFMRVGLAL
FT                   LLAVLLMYLILVLQFGSFLDPLAILLSLPLSLIGVVGALLLTGDTLNIMSLIGVILLFG
FT                   IVAKNAILLIDFAKWAREERGISIRDALVEAGRIRLRPIMMTSVAIIAGMIPVALGAGE
FT                   GGDFRAPLGRAVIGGVITSTLLTLLVIPTVYEIMDSFRERALRGFRRLLGGGRGGGNGT
FT                   SEPAPAPHARAGGVRRELE"
FT   sig_peptide     272104..272196
FT                   /locus_tag="Anae109_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.580 at
FT                   residue 31"
FT   gene            complement(275386..276903)
FT                   /locus_tag="Anae109_0239"
FT   CDS_pept        complement(275386..276903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0239"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ade:Adeh_0229 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24457"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W1"
FT                   /protein_id="ABS24457.1"
FT                   /translation="MPPSGSLRRAPFRAPPARALAAAGRRRYDQPVSAPDAIVVGAGPN
FT                   GLAAAVALATAGLRVRVVERNAQVGGGARTLSLTLPGFHHDHCSAIHPLAAGSPFLRRL
FT                   PLGAHGVTWVEPPIAVAHPFDDGTAALLSRSFEATGGSLDRGDARAWRALFAPLAERFP
FT                   ELMDELLGGLVRVPRRPLLLARFALPALVPASALARARFRGPRARALLAGLAAHAQLPL
FT                   ERAPSAAFALVLGAAAHAEGWPFPAGGAQAIPHALAALLRASGGEIVTGEEVRSLAALP
FT                   RTRATLLDLTPRQVLRVAGDRLPRRYARALARFRYGPGAFKVDYALDGPIPWLAAECAR
FT                   AGTVHLGGTLEEIAASEAAVWRGELAVRPYVLVAQHTLFDPPRAPPGKHTAWAYCHVPS
FT                   GFGGDALGALEAQLERFAPGFRERVLTRAVRGPAALEADDPNLVGGDVGAGANTLGQTL
FT                   FRPAARLVPWSTPVPGLYLCSASTPPGGGVHGMCGYHAAQTALRRLW"
FT   gene            277063..279021
FT                   /locus_tag="Anae109_0240"
FT   CDS_pept        277063..279021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0240"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ade:Adeh_2406 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24458"
FT                   /db_xref="GOA:A7H6W2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W2"
FT                   /protein_id="ABS24458.1"
FT                   /translation="MAIRARVPELEDWKAQVKCQAGCPVATDAGRYVQLVAARRYEDGY
FT                   LVARAPNPFASVCGRVCAAPCEDACRRGSIDAPITIRALKRTLSERFGVESVHPDTQDR
FT                   LLEALLPEGNRYVGHLPVAPFSARGPEARRKVAVIGAGPAGLSAAHDLALLGYAVTVLE
FT                   ASDEPGGMMRFGIPEYRLPRGVIRAEIEKILSFGVTLRTGTPLTPSFGLEALRRDGFEA
FT                   VFLSVGVQKGRDLELPGVDLDGVVKAVDYLLNANRGYRVDLGRKVVVIGGGFVAFDAAR
FT                   MALRLGREEAPEIGARLGEEVDARMKEAFDAAREAVRGGATEVTIVSLESFAEMPVLRT
FT                   SQGHEEFEEAKREGIRFEPRRGPRRFLGEKRLEAVELRRVISVFDEAGRFSPRYDDADV
FT                   LAIPADACVLAIGQRAELSFLKPEDGVEVTPGGTIKVDRATLATSAPGVFAGGDVAFGP
FT                   RNLIEAIANGKRAARSIHEYLSREAARVEALLEIEKIPTREYRMIAGFEVLDRRPPPTL
FT                   DLGRRTGVAEVEIAFSEEEAIAQGARCLVCHVQTIYDPEKCVLCGRCVDVCPEYCLSLV
FT                   PIEELELPEEERRALVALARADGLPLSAMLKDEEKCIRCGLCAIRCPTDAMTMEHFQIT
FT                   ERYGAAGERAAPRERSS"
FT   gene            279018..279524
FT                   /locus_tag="Anae109_0241"
FT   CDS_pept        279018..279524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0241"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ade:Adeh_2405 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24459"
FT                   /db_xref="GOA:A7H6W3"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W3"
FT                   /protein_id="ABS24459.1"
FT                   /translation="MTERKDRREFLKGLGIGAGVVALGGQSVAALRSLVPNVSYDAPTT
FT                   VKIGAPGEFPDGMKFLPEQRLFVFREGKVFHAISAVCTHLGCTVRAEALPRAETKTVEG
FT                   QPLKLTHRFLCPCHGSRYEGDGQNVAGPAPRPLDWYHLELALDDGQLVVDLAKPVDRDF
FT                   RLTIA"
FT   sig_peptide     279018..279107
FT                   /locus_tag="Anae109_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.844) with cleavage site probability 0.794 at
FT                   residue 30"
FT   gene            279535..280881
FT                   /locus_tag="Anae109_0242"
FT   CDS_pept        279535..280881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0242"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: ade:Adeh_2404
FT                   cytochrome b/b6-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24460"
FT                   /db_xref="GOA:A7H6W4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W4"
FT                   /protein_id="ABS24460.1"
FT                   /translation="MATAPRTGTSPPAAPGVHPRRLWSLRPASDRQAGDAIVANFLLHW
FT                   FPAKALRASLDWRYSLWLGTVSAALLLLLVVSGLPLLFLHVPSVERAYGSVKDIEYVVT
FT                   FGSWIRSVHRIAAHLMVAAVFLHLVRVFLTGAYKNGTGRGQHREWNWVLGVVMFLVTLF
FT                   LSFTGYLLPWDQLAYWAVTVGTNIASAVPLVGAEVRELLLGGRNIDQPTLIRFYVLHVI
FT                   VLPGALGALFAYHMWRIRKDGGLACADRAAALPAPAPDAPGATKTYSLLGIARGTGPTI
FT                   RATSVEAPLTTVNSVPDLTRRAAIVVLGTIAVVSILAVLIRSPLEEAANPLVTPNPAKA
FT                   PWYFLWLQELVTDTTFRIGSFTVNGALVGGIILPGILVTVMAIWPWLDRSPPEAAGRWM
FT                   PRTRRTQNAVFLVIVLLVLLLTYVGLFVRGPYWNLYWPWEAWPDMPGRI"
FT   gene            280884..282113
FT                   /locus_tag="Anae109_0243"
FT   CDS_pept        280884..282113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24461"
FT                   /db_xref="GOA:A7H6W5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W5"
FT                   /protein_id="ABS24461.1"
FT                   /translation="MEQRSPSPYRSRDRLVLALVGVLLVVSTALFAWKDWVHDWRYYQW
FT                   EFKRRVAGQLGEDKASAIPSGMLQVWVPALQRADRCVMCHQATAWKGFEGAEEPFRTHP
FT                   PAILASHPVERFGCTACHGGQGYAVDVEEAHGPVQHWEEPVLGEFLGEGYSLAGDRGAL
FT                   LQMNCNVCHRYDRATKGADAINLAKRLVGEKGCRACHVINGRGGNIGPDLTFVGDKAPE
FT                   QFDYTRLLGQRTMFAWHVAHFREPKALVPDTVMPNFNFSTEQVQALSMLVMSWRNEPVP
FT                   AAYLAGAPRTDPQTPQEIEEERRMLTGPGAWFVKTGCFVCHNVSSLGVKSPAQIGPDLS
FT                   NAVEDVQARFGRTVDDFLRAPTGTMSVVLSRQIVLTPAELEVAIGKVREAYAAWLEQQK
FT                   AKGEPAPARR"
FT   sig_peptide     280884..280982
FT                   /locus_tag="Anae109_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.884 at
FT                   residue 33"
FT   gene            282133..284076
FT                   /locus_tag="Anae109_0244"
FT   CDS_pept        282133..284076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0244"
FT                   /product="Nitrous-oxide reductase"
FT                   /EC_number="1.7.2.4"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   ade:Adeh_2402 nitrous-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24462"
FT                   /db_xref="GOA:A7H6W6"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026468"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W6"
FT                   /protein_id="ABS24462.1"
FT                   /translation="MSSSKSVSKPLAIAAVLVAAAAVAVRCAPREPKGARREAAKSDVS
FT                   VAAQKTYVAPGDLDEYYMFSSGGHSGQVFIYGLPSMRHLATIPVFAPYPATGYGFDDET
FT                   KEMLGKLTWGDVHHPALSETKGDYDGRWLFVNEMNGRIARIDLRDFKTRQIIGPVPNVS
FT                   GNHGSAFVTPNTEYAMMSSRFSIPIPKGTAVSIDKYASEYKGIVAGIKIDPESGKMSLG
FT                   WQVALPPFDWDLGDAGKLVSDGWMFLTCYNSERGTGKLEVTASQRDRDYIAAINWREAE
FT                   KAAAEGKGDLIGGVKVLDPRKVPGLVYLMPCGKSPHGVDVSPDGKYIIGSGKLQGVTTA
FT                   FNFEKVLTAIKNKDFTGEEDGIPVLKYESIKDAEVPVGLGPLHTQFGPDGWAYTSLFVD
FT                   SALAKWKLGTWEVVDKVPMSYSTGHLSAAEGDTVSPDGKWLVGLNKLSHGRHLSVGPSQ
FT                   PESSQLVDISEDKMKLVYDAFTEPEPHYAQIIKADKVKPIEVYKKEENKNPLAVWDVKD
FT                   TGASRKGNEVVVKMTAVRSTFTPQLIEVNQGDTVKVAVTNIEQTTDELHGFGLLDYNIN
FT                   LVVDPGETKVVTFKADKPGVFPYYCTNFCSALHQEMQGYLVVRPARAAAPAEGDEGGGA
FT                   RAGREETRRGPR"
FT   sig_peptide     282133..282207
FT                   /locus_tag="Anae109_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.643 at
FT                   residue 25"
FT   gene            284073..284759
FT                   /locus_tag="Anae109_0245"
FT   CDS_pept        284073..284759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24463"
FT                   /db_xref="GOA:A7H6W7"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W7"
FT                   /protein_id="ABS24463.1"
FT                   /translation="MTRLLESSHRALSSPVGGTPRALVLAAALLLLPTYFLPLWNLTMF
FT                   APQYQGGLRLDIYSYKLEGGNEGQDLKEINLLNHYIGMRDLREDDFREFQWMPFVIGVL
FT                   ALLFLRAIVMGRLLDLVDSTVLFAWFAGFSGWSFAYKLYRYGHDLAPTAPVKVDPFMPP
FT                   LFGGTQLANFEVYSYPAAGSYALLAAGLALVAALLLAARAALREARAARGGTSPAGASS
FT                   ARTAAR"
FT   gene            284756..286135
FT                   /locus_tag="Anae109_0246"
FT   CDS_pept        284756..286135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0246"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   ade:Adeh_2400 periplasmic copper-binding, NosD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24464"
FT                   /db_xref="GOA:A7H6W8"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W8"
FT                   /protein_id="ABS24464.1"
FT                   /translation="MIAAALLLAVAAGQGDMPAIPAGDVEGRPPRGEASPLQARIDAAP
FT                   PGARVEVGPGEYAGDLFLDRPIHLAGRGRPRLVGAGKGSVVRIRAPGVVIEGFDIDGRE
FT                   GGDLGRDSAGVHVAAPGAVVRDCRIERALFGVYLREAHGARVEGNTVHGIPGKEPGEKG
FT                   SGVHVWNTEGFTLERNVVWHARDGFYIQSSPHGVIRGNVARELRYGLHYMFSDDNVFEE
FT                   NTFEANAAGAVLMYSRRIEFRRNRFLHNRGFASVGLLFKACDDAIAEDNLFADNARGIF
FT                   LEGSYRNVFRRNVVAESDAAIVLYDSCGETRFEGNAFIGNLTSLDLVGRRTDTSFDGNY
FT                   WSDNDQPDLDGDGRSDRPYVLGSLFDHLRGNLAAADLLAQSLAAAALAAAERSFPVLAP
FT                   IQAVDRAPLARAPRLPAVPTVRSAGRRVSAPGLAGSAAAIVLGLAVLGGGRRSGRAEEE
FT                   R"
FT   gene            286132..287031
FT                   /locus_tag="Anae109_0247"
FT   CDS_pept        286132..287031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0247"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_2399 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24465"
FT                   /db_xref="GOA:A7H6W9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W9"
FT                   /protein_id="ABS24465.1"
FT                   /translation="MIRFEALSKRYGPNRAVEGLTLTVGAGEVVALLGPNGSGKTTSLK
FT                   AAAGLVRPTSGRVLVGDPGVSAAEPRARRALSFLPQKVSFPDALTGAEVVEFYRRLRGG
FT                   APGAAREVLRTVALNGAASRAIGTYSGGMVQRLGLAVAALPDARSYLLDEPTSSLDPDG
FT                   LCAFYGLAERWRRAGRSVLFSSHQLGDVERLADRVAVLVEGRLVAQLGQRELQDRLVGR
FT                   GLLRVRLDRCPPALEGKLARLAPGARWTGEEVIVPGTPAVRAAAVEAIRAEGLELRGLS
FT                   AEEGRLDALYRELVEGTA"
FT   gene            287028..287471
FT                   /locus_tag="Anae109_0248"
FT   CDS_pept        287028..287471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24466"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X0"
FT                   /protein_id="ABS24466.1"
FT                   /translation="MRNASAVLLVALSCSRGPPAPAPLDTRNDACAQCRMAVSDPRFAA
FT                   QLVAAREEPRFFDDIGCLRDFLRAHASLPDGAVAYVADHRTRAWVRAAAARYTRDDALA
FT                   TPMSSHLVAHADDASRAADPEAARGVRITVAEVFGPGGVPDAR"
FT   gene            287468..288313
FT                   /locus_tag="Anae109_0249"
FT   CDS_pept        287468..288313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24467"
FT                   /db_xref="GOA:A7H6X1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X1"
FT                   /protein_id="ABS24467.1"
FT                   /translation="MTPPLPSPLLLVARQELLLAARSRWTQIFAAVFAVLALGVAFSGY
FT                   VLSGGSGFQDFARTSASLVQLVALVVPLASLLMGVLSLAPERGTVELLFAQPVARRTIL
FT                   AGKLLGLLAALAAAQAVGFGLAGLVIFSQAGEAGGAGYALLVLGSMVLTAVFLAVAALV
FT                   ASGAVGRKRARAMAVAIVVWFAAVVLFDLAALAIASVLPSGTASRLLAVSVIVNPVGAV
FT                   RTGALLAIEGTAAFGAASLAFLRFTGGEPGAAAALCASLLLWIAVPALLAAWRLGRIDL
FT                   "
FT   sig_peptide     287468..287614
FT                   /locus_tag="Anae109_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.683) with cleavage site probability 0.674 at
FT                   residue 49"
FT   gene            288437..289045
FT                   /locus_tag="Anae109_0250"
FT   CDS_pept        288437..289045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0250"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: ade:Adeh_0230 sigma-24
FT                   (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24468"
FT                   /db_xref="GOA:A7H6X2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X2"
FT                   /protein_id="ABS24468.1"
FT                   /translation="MAADESDERLMLRFQAGDARAFEALVGRHRTPVFSFLVRLTADRA
FT                   RAEDLCQEVFLKVVKASRTWEERARFRTWLYAIARNLAVDEARRAAFRRAEPLDAPGLA
FT                   GAAAYPAGDPAPDAAAEAALLRPKLEAALAALPDEQREVFLLREYAGLRFAEIADVTGT
FT                   PENTVKSRMRYALEGLREALAALGVGPEVPVSAAGGASP"
FT   gene            289042..290241
FT                   /locus_tag="Anae109_0251"
FT   CDS_pept        289042..290241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0251"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="KEGG: ade:Adeh_0231 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24469"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X3"
FT                   /protein_id="ABS24469.1"
FT                   /translation="MSHERFSERILDLAYGELSPREAGEVEAHAATCAGCGAELARIRA
FT                   TRRLMAALPDERAPDRGEGVLLAAAREEVRGRAPARSWSRWRWSTSVVAALLLAVGAVS
FT                   YRLLEMRPAAERGGEELLGRGRYAEAPPSPEPSGEGVAKAEAPDEALNDMRAEPPSVAQ
FT                   APRPEGAARPRAELAAPTRREVRSAPTPDAQGKHAASAPAREEEAAPAARRAYAEAPAD
FT                   PSRAEDAEVASAAAGAAEEAAGFAAPPERAPEAPSRSAVAAARPRSAGAPAAAPAAAPE
FT                   PDGAAEAASSADALERYATLRAHGALAGEIRTFVGCEGEAWRKVERDRQGRVVKYVREG
FT                   RIGGARVRVEHLFDADGRLAAVRATDVERGAAVEPGALGLTLPRHAGEAGADAPPRCER
FT                   "
FT   gene            complement(290307..291689)
FT                   /locus_tag="Anae109_0252"
FT   CDS_pept        complement(290307..291689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0252"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: dde:Dde_2418
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24470"
FT                   /db_xref="GOA:A7H6X4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X4"
FT                   /protein_id="ABS24470.1"
FT                   /translation="MDAPHPSERTRASGRSAILRPLLALAWPMVVSRATQVVVGIADAV
FT                   MVAHLGEAALAATTTGATNAFSIVILPMGIVFVVQSFASQLFGRGDLAGARRFGWYGLA
FT                   VAAGAQVLGVLGTLATPRALEAFAYAPDVRALMSGYLQIRLLSAGAVVGLEALSNYYGG
FT                   LGDTRLPMRANLAAMVLNVAGNWLLIDGRLGLPALGVTGAAVASTLSTALAFAGLLAVF
FT                   VREGRRTGTGTLRARELGRLLRFGVPSGVNWFFEVLAFVFFVNVVFVELGTTSLAALMA
FT                   ILQVNTVAFMPAWALASAGAILVGQAIGASHADRVPRLVAVTFAVSAAWQLFVGALYVL
FT                   APEAILAPFATGAGPGSAFVAIGRRVLLLAAAWQLFDAAAMSLGEALRAAGDTAFVMWM
FT                   RVTLGWAVFVPGTWISVRELGAGEVVAVGWLVLWLALLALALLLRFRSGAWRRIELVPE
FT                   AP"
FT   gene            291797..292897
FT                   /locus_tag="Anae109_0253"
FT   CDS_pept        291797..292897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0253"
FT                   /product="teichoic acid biosynthesis related protein"
FT                   /note="KEGG: ade:Adeh_0232 teichoic acid biosynthesis
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24471"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X5"
FT                   /protein_id="ABS24471.1"
FT                   /translation="MARILYGVAGEGMGHAIRSRVVIDHLSRSHDVQVVVSGRAHGYLK
FT                   ALERERLGVNRIWGLSIVYEDNEVRNFRTVLANVAGAALGGWPRNVKAYFDLALAFRPD
FT                   VVVSDFESWSHLFARMHGLRCLSVDNNQIVNRADHPPEITAGHEAEYLVAKAVVKAKLP
FT                   GCFHYLVATFFQPEAVKRRTTLHPPVLRPEILAARPEPGDHLLVYQTSTSNEALPDVLR
FT                   RSGRECRIYGLRRDLTSDERDGNLLWRPFDEPAFIEDLRTARAVVSGGSFTLMSEAVYL
FT                   HKPMLAVPVKRQFEQLLNARYLERLGYGAAAELIDDAVLAAFLGRLPELERRLAAYRQD
FT                   GNRDLLAKLGETIARALVPGDVGPLP"
FT   gene            292906..293367
FT                   /locus_tag="Anae109_0254"
FT   CDS_pept        292906..293367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0254"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   ade:Adeh_0233 protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24472"
FT                   /db_xref="GOA:A7H6X6"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6X6"
FT                   /protein_id="ABS24472.1"
FT                   /translation="MRLRVVAVGRDRSGLYAPAIEEYAKRLGRYVKFELVEVPEARKHA
FT                   GTAQARDEEAEALLAKLGPRERVIALDERGAEWTSVAFAERVRRWTEGGRDVALVIGGS
FT                   DGLSRAVLDRAEETLALSRMTLAHRLARLVLVEQLYRAMTILRGEPYHK"
FT   gene            293485..293886
FT                   /locus_tag="Anae109_0255"
FT   CDS_pept        293485..293886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24473"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X7"
FT                   /protein_id="ABS24473.1"
FT                   /translation="MRLAFVGAVALVLTACEIDDDCRTAREQHQPVQPIGVACTRGSYG
FT                   DCAEDYDDCAEGTCRHSDAAGGLICTVPCDAGCERHGLFCGTQGICEPAARCGLACSII
FT                   GYCCCTAGAPGLPTECGVLYCGWGLSSCG"
FT   gene            293951..294682
FT                   /locus_tag="Anae109_0256"
FT   CDS_pept        293951..294682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_1717 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24474"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X8"
FT                   /protein_id="ABS24474.1"
FT                   /translation="MSPWNVAQVATGRYLCHRARRGDQGSQEQAERVRPSRLAGGDGPH
FT                   RRSRPRRGGARPGRSAPERDGVRRGARRPRPPRRRDARAHAAGRPSRGASQDGAPRGAP
FT                   RGAGRRSRGPMIYLDTSVALAELFAEDRRAPDALWAEALVSSRLLEYELWTRIHARGAA
FT                   RTHDGPAREVLARVSFVELARPVLARALEPFPAPVRTLDALHLATVHYLAEAGQRVAVA
FT                   TFDARMAEAARRMSYPLAFAP"
FT   gene            294821..296371
FT                   /locus_tag="Anae109_0257"
FT   CDS_pept        294821..296371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0257"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein; KEGG:
FT                   ade:Adeh_0235 phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24475"
FT                   /db_xref="GOA:A7H6X9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X9"
FT                   /protein_id="ABS24475.1"
FT                   /translation="MAKPKPVLLVVLDGWGLRAEREANAIAVAGTPNMDALVREFPHTA
FT                   IETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVEDGSFFKNDALLMACRR
FT                   AKESGGALHLMGLLSDGGVHSHEEHLFALAELARREGVPRTFVHAFMDGRDTPPKSGLE
FT                   YMAKLEKVLRDKGHGKVATVSGRYYAMDRDKRWDRVEVAYRALVKGEGQRAPGGVAAME
FT                   AAYGRDETDEFVKPTVVVNGDGKPVGPVRDGDAVLFFNFRADRAREITRALTDEGFKDF
FT                   DRGPAPRLSAYVCMTEYDKTFPHPVAYAPQDLTEIFPEIVARAGLKQLRCAETEKYAHV
FT                   TFFFNGGRETVFPGEDRILVPSPRDVKTYDQKPEMSAREVTDKLVQAIGTGQHGFVLVN
FT                   FANPDMVGHTGLLDAAVKAVKVVDECVGRLWQAAKAQRMAMLVTADHGNCEMMTDPQTG
FT                   QPHTAHTLNPVPFILADPDFRGAKLRAKGVLADVAPTALQVMGLPQPKEMKGLGLLQR"
FT   gene            296368..297105
FT                   /locus_tag="Anae109_0258"
FT   CDS_pept        296368..297105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0258"
FT                   /product="phosphoribosyltransferase"
FT                   /note="KEGG: ade:Adeh_0236 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24476"
FT                   /db_xref="GOA:A7H6Y0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y0"
FT                   /protein_id="ABS24476.1"
FT                   /translation="MTPTGSTPPDRPLAAALRAVAAALLDLVYPPRCAACREGVASEPF
FT                   CPTCAEAVDPLPAGCARCGMPGPDPLCGACRADPPAFDAIRAGGLFGGPLADAIHAFKY
FT                   GGRPALARPLGAWLARTAPLPPGALLVSVPLARRRRIDRGYDQAALLADALARAAGARD
FT                   RRLRGALVRTRETPPQVGRTRAERSRNVAGAFRAVRTRDLQGKDVVLVDDVVTTGATAD
FT                   AAARALKDAGVRSVIVVALARAD"
FT   gene            297168..300929
FT                   /locus_tag="Anae109_0259"
FT   CDS_pept        297168..300929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0259"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ade:Adeh_0237 tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24477"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y1"
FT                   /protein_id="ABS24477.1"
FT                   /translation="MSRPLAALLALAVVAPLPVARAAGGAPGARGADPEAALRAEAIAA
FT                   LARDRRGPRGIVALAELGELEAEAPELAPLAAAYAAAVEDRAAHPEVRALARHRLAALE
FT                   RSRGNFQRSAAQVRRLGFVTRWHVVGPFDDEGKRGLDTAYAPEQGIDLAARHDGKVGEV
FT                   AWRPLPDEAVVHGFVDLGAALRPASEGVAYAVAFVEAARDERVALWLGASGAAKVWVNG
FT                   AVVVADAGYHPARLDQRGAVVTLRRGTNRILVKLCHQLGRMGFFLRLADERGDGRARAA
FT                   GSPDAPAPEPGPAASPIDGAVARLEAQARGARTRAEEAAARRDLAIVLAERQSADFEER
FT                   RPAAEARRAAELAPRSAELQLLAASMEEDHGRRRRYVEAALAARPEEPRALAALAREEL
FT                   DQGRPHAALRLLDRAVAAAPRWAAPRVARVEALDRAGLEVRAVRAAAEAADAFPTTPGA
FT                   VRAAARAAGRLNRVEEAVARLRTLLALRLDDAEARGTLAHLLVERGEVATAAALLAEAL
FT                   RLDPAAGEQRLRLADLLAANGRGEEAEAAYEAALRIAPADADALERRGRARLAAGRPRD
FT                   ALQDLHAALDLRPQSPELKELVRSLEPARERFEAPYVLDARALAANAPAPRADDDAIVL
FT                   GELKVTRVFPSGLSATFHQQVVKIVSARGAEAFRRHVIGWTPDRQDVRVERVRIVKPDG
FT                   SSVETHDAAERSASEPWYRLYYDTRTRTLSFPSLGAGDVLEVAWRIEDSARENLLSDYF
FT                   GDLTFLDDTTRKARVDYVLLVPEARPIYSSVPEGVRHETRKLSGGLVEHRFAARELARI
FT                   RPEPGMPGWSEVARYVHVSTYGDWDQVARFYWGLVKDQLRPTDELRATSARIVEAAVGA
FT                   TRLQPVAARAGGAAPAAQGGWTLDQKRAIARGVYDFVVSQTRYVGLEFGIHGYKPYRVD
FT                   QVLARRFGDCKDKASLVHALLASAGIDSRLVLLRMRRLGRMPEAPASLAVFNHAIVYVP
FT                   ELDLWLDGTAAHSGSGDLPSEDRGATVLVVNPGGKARFGTVPQARPEDNRLESRFEVTL
FT                   GADGRARVRGSSRVRGSQAPQYRRAYLAEHERRAQLERAFGRTFPGAEVTGLSVSDLTR
FT                   IEEDVAMEFTLDVPRYALADGGGLRFTPFGDVAGYAQSYAALSARRYDLVVGDPGITRF
FT                   TYRYVLPAGWAPVEVPEPAAADTPHGAFEVRYRREGDALVAEGHVTFKAARVAAAEYPA
FT                   FRDLAARIDRAFARKVRIAPAAAGEGSR"
FT   sig_peptide     297168..297236
FT                   /locus_tag="Anae109_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.873 at
FT                   residue 23"
FT   gene            300926..304651
FT                   /locus_tag="Anae109_0260"
FT   CDS_pept        300926..304651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24478"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y2"
FT                   /protein_id="ABS24478.1"
FT                   /translation="MTARLRRPCALAAAVLLAALGCAGPRAGSPGPGASGNARPAEALV
FT                   LRNDAAAAQAGTSRALARRGEDPWAHLGAALLARRALDAAAEGRHLLAVAAAAPADPAA
FT                   LVALRRLSELAEESPARAGEVEAGLAPLLEAGRFTGLAAYRARIARVTAAEVRGDHARA
FT                   VALRRANGAVTAWSLAGPFGRYQALDLDARFPPDEGVLPEAAPAPAGLPPRPTRALPAP
FT                   DGTVTLEGEPPDADVFYLASDVTLARGGRYLLTVGTGLSARVSIDGGPVHERRAFAGTP
FT                   ASLAHLPLELAPGPHRVLVKLTRGPSSRSGLHVALTREDGAPSDAAFTPAAPGAAPRAP
FT                   VPPRAGPPVGAPDGLASALEPAGGYALAQLLAARDAAQVDREGAKALLARAVARLPSSA
FT                   ALRVARATVVQDDDTLDSQAGRARAEADLREALARDPGHAEARVLLAELLRRSERLDDA
FT                   DALLAGLSPAAAGRGAALEARARAAEARGLGVRAEQLAAEALSESGRCGAADLAYALAG
FT                   RRLAIAEEDARIRAVAACRDGAARLAEHLRRRGDARGAVEALASTVAARPWAIEPALTR
FT                   AGALVAAGDAAGAVEALGALQAVWPRSPRVAKKLADVRELAGDLPGARALRERALLLDG
FT                   ADLALRRALALEDGREVLDAGAQDGRAAIRAYERARPRGATSAAMVLDAAAIELHPGGS
FT                   ATERTHQVIHVLDQQGVEEFGEISVPHGADVLQLHTVKPDGRALEPERAGASKGSVSLA
FT                   GLEPGDYVEVEHVRAVRGLGGAYVSDPFYFQVAGVPLFHSSYLVVAPEGLGLAVDAHGM
FT                   PAPEVRREGGRDVVRGLRTEVPAFVPEPGAVPPQEYLPFVQVGAGADRADVQRALGDAV
FT                   LERTRPTEELRAFARALRAEAGRDASPEALARAAYARVARDILGTGSALGEDASVVLSR
FT                   GRGSRLVVLKAVLSELGLRTRIALARPFSADAVAYRFPNPAEFTHPLLRVQAGAETFWL
FT                   DPALRLAPFGAVPSSVLDVDAMVLPEPGDAMEVARTPARAQVEERREVAVHIALRPDGA
FT                   GEVQGSDRYFGAMAAAAKEGLEKLDATERRQAVEAMLSRTFGGVTVQEVTIGGEDEPAA
FT                   PLEIRWRGTVPDLARASGGGMVMDASLFPARLASRYVQIAQRRTPLLLPTPEVGVSKIE
FT                   IAVPEGLAIRASPARKVETPFGTFTRTERAEGRTLVREDRLAVTRGRVPPERYGEFAAF
FT                   AAAVDAIQDDPAVFHR"
FT   sig_peptide     300926..301009
FT                   /locus_tag="Anae109_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.650 at
FT                   residue 28"
FT   gene            complement(305306..305920)
FT                   /locus_tag="Anae109_0261"
FT   CDS_pept        complement(305306..305920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24479"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y3"
FT                   /protein_id="ABS24479.1"
FT                   /translation="MRRLLGLAVLGLSLGAGLAVMFRVLPSDRPMPAPPAVATQIREVA
FT                   RLETLEVRLYKKVSFAPEPTPAGSFWGDVAGWLRHAVSAPQGKAIVFADAYLTLDLERL
FT                   NANSVQVEGRRVDVVLPPIRTTVALRPGETEVLGSNLDSADTARLLELAKAAFEREVDA
FT                   DAALQARARASAERHIRALLLSLGFEDVRFVDVLPPARSQT"
FT   sig_peptide     complement(305861..305920)
FT                   /locus_tag="Anae109_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.806 at
FT                   residue 20"
FT   gene            complement(305930..306352)
FT                   /locus_tag="Anae109_0262"
FT   CDS_pept        complement(305930..306352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0262"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: ade:Adeh_0240
FT                   TfoX-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24480"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y4"
FT                   /protein_id="ABS24480.1"
FT                   /translation="MANSEAFVEHVLDLLALAGPVEARRMFGGHGLYAGGAMFGLLDDD
FT                   ELFLKTDAVTRARFVDAGCRPWFYARRDGTTERTSYFRPPDDAHEEPEAMLPWARLAME
FT                   AALRAAAAKAARVRAKPTAAPRRRRAAPRARPGRTR"
FT   gene            complement(306363..307502)
FT                   /locus_tag="Anae109_0263"
FT   CDS_pept        complement(306363..307502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0263"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: ade:Adeh_0241 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: putative
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24481"
FT                   /db_xref="GOA:A7H6Y5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y5"
FT                   /protein_id="ABS24481.1"
FT                   /translation="MARRFGIYVHFPYCAHRCPYCDFAVTTERPPEGRRYLAALLAELE
FT                   LRAGAFDGLAPVSVYLGGGTPSLWDPDEVAALLAALRARLALPAGAEVTIEANPESTDR
FT                   ARLRAWRAAGVNRVSVGVQSFDAGVLAKLGRRHGPDAAERAIREAAEELGNVSVDLIYG
FT                   ARRSTVEIARADAARAAASGAAHVSAYALTLDPGIMAEEVPLARMRREGRLPLPSDDEV
FT                   AAQAAAIRAALRRAGLRRYEISNFARPGLESAHNRLYWTAESYLGLGAGAYGCARGEAG
FT                   SYRYGNLRDARAYLDAALGRRSPTAEEDRIAPAAERNERMMLGLRTLEGVPLATLSPIQ
FT                   SREADRLVRRRLAVRRRGALVLTSRGMDLHTSIAERLLE"
FT   gene            307625..309745
FT                   /locus_tag="Anae109_0264"
FT   CDS_pept        307625..309745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0264"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   oligopeptide transporter, OPT family; PFAM: Oligopeptide
FT                   transporter OPT superfamily protein; KEGG: ade:Adeh_0243
FT                   oligopeptide transporter OPT"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24482"
FT                   /db_xref="GOA:A7H6Y6"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y6"
FT                   /protein_id="ABS24482.1"
FT                   /translation="MTPRNRTVSRGPRMAELATPPPKDFKPYIADETTVPEFTLKAIVA
FT                   GALAGILFGAATVYLALKAGLTVSASIPIAVIAISLGRKFLKTSILENNIIQTAGSAGE
FT                   SIAAGVVFTLPGFLFLSVDPSTKVSVGAGYFDYVTLFALSLVGGILGVLMMIPLRRSLI
FT                   VKEHATLQYPEGTACASVLIAGDKGGEFAKTAFQGVGLALGYAVLQKVFHVIAETPAWV
FT                   TRQTNKWLPNATVNGEITPEYLGVGYIIGPRIAGVLVAGGVLAWLALIPLLSVLVPADV
FT                   IAGQLVKLGDLKDVATAGGAGGWDPATHAFSNLPNAVYRAYIRQIGAGAVAAGGFITLL
FT                   KTLPTIWTSLRDSIASLGDKAAQAGVRRTERDLSFLTVIIGSVGLVLLLVMLPQVPGES
FT                   VLQKLLVALLVIVFGFIFVTVSSRIVGIIGSSSNPISGMTIATLMATAMVFVGVGWTGS
FT                   AYEPLALVVGGMVCIAAANAGATSQDLKTGYLVGATPRYQQIALFVGAIFSAFVIGLTV
FT                   KVLDTPTADLAAQGVQHMIGTEKFPAPQATLMATLIKGLLSLNLDWHFVLAGAFFAVTM
FT                   ELCGVKSLSFAVGLYLPLSTTLPIFVGGALKGVVDWLAARRGEHAEESELGGGSLFATG
FT                   LVAGGALTGVIVALLNVNDGVNRFIGTTLNMEPRIAGIIGHGGYQVLGVLFFAGLAFAL
FT                   YRAARRSKPPVI"
FT   gene            complement(309813..310169)
FT                   /locus_tag="Anae109_0265"
FT   CDS_pept        complement(309813..310169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0265"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ade:Adeh_2901 cupin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24483"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y7"
FT                   /protein_id="ABS24483.1"
FT                   /translation="MARLVTTPFVVPAAGNPPKLIEELFGRVATGSAGVSVARMTSPPG
FT                   WAEPGQTPEFDEYTVVLEGALRVETREGVLEVGAGQAVHAPSGEWVRYSTPAGARYLAV
FT                   CVPAFSLDTVHRDG"
FT   gene            complement(310327..312882)
FT                   /locus_tag="Anae109_0266"
FT   CDS_pept        complement(310327..312882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0266"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_2705 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24484"
FT                   /db_xref="GOA:A7H6Y8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y8"
FT                   /protein_id="ABS24484.1"
FT                   /translation="MSLNVLLVEPDAALADEIRRAFGPAGLEVTSLQAGEPAVERCRQA
FT                   APDLILLAAELPDMSGFSVCNRLKRAVQAVPLLLYTGDATDAAIEAHRATRTRADDYLR
FT                   KPFDMAELLGRAAALLHGDGAAPRPSAPRDAPPAPPAPPRPDGRRSAPEGDAPPLLTRV
FT                   DSGQIAARGLAAALAAAAPPAAPPPRPAPASAAPAAPPAPPPIGARPPAAIGRVRVGGG
FT                   RADPADVFADWPRDPAPPKGTPEEKLEYFRDRLRARDAFVARVRDAFGELKGQAAELAG
FT                   ERDGLERDLAAARERADELEHALVDARAAATEHEARAADALRRLEESEATRQSISDVLS
FT                   QAMQDHEAAAQDWSARIGEADAERARLEAELAERAEAHARAVAGLEAERADERARLEAS
FT                   RAEADEAHARAQAELEAARTAERDEAGAQQAEAEARLAALTGERDSLAAELRRVVAELA
FT                   AKLEQAAEARREGDAEIEALRTRLDEAHGRAQAVAAELAEATGRIGALEADAAAQAEAH
FT                   AGLEEALGQAQAEARAYDEKAVAAEHAFEAKAAELAAAEQRIRDLGAALEEGRASVAGT
FT                   KGELSRIETARADAERRAAQAASERDQLAKAIEAARRGAEGDRERAKRLEAEIGRLAKL
FT                   EPVAEEAARLRKEVATLKEMVQQRSAAAESASRAAQAAAAERARAEERLAVEAGKLQGA
FT                   TSRLESELGAARRKLEELERERSARSDESRKTHEKGEQRARALAADASEAEKRHQAEVA
FT                   RLRAAMVELEKHLETRARAELTLKKRVQELEKASAKPPPAPAPKADPAELATLKARVAK
FT                   LGEELEELRGENDFLNGEVARYQQRNRQLQTQIDSLKES"
FT   gene            312990..313850
FT                   /locus_tag="Anae109_0267"
FT   CDS_pept        312990..313850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0267"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   ade:Adeh_0246 ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24485"
FT                   /db_xref="GOA:A7H6Y9"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y9"
FT                   /protein_id="ABS24485.1"
FT                   /translation="MRPMPTFSLTLDAARERAEDLSAELFDAGASGVEVRDGEGTPMPG
FT                   IAQPAPGRALLVAFFSDRADAEEARAAHGGELAEVADEDWGETWKKGLGPLAVGRAFVR
FT                   PSWVDAPVPPGMAEIVLDPGMAFGTGTHPTTGLCLAALSELLAARPGASVLDVGTGSGL
FT                   LAIAAAKLGAGRVAANDNDPVAVAVARENADRNGAALELTGAAVGEIAGTFDLVVANIL
FT                   ANTLVELAPDVAARVAPGGTVLLAGILTPQEDEVRAAYVAQGLRPALERRDAEWSLLTL
FT                   ERPRA"
FT   gene            313847..314587
FT                   /locus_tag="Anae109_0268"
FT   CDS_pept        313847..314587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0268"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   ade:Adeh_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24486"
FT                   /db_xref="GOA:A7H6Z0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z0"
FT                   /protein_id="ABS24486.1"
FT                   /translation="MTLRRVHLPPQRFEGERAALTPEARHYLRDVLRLGPGAEVEVFDG
FT                   RGGAWAARVDAAYEALLLGERRAQGGAAAEIWLVAALAKGEKMDLVVQKATELGAAGVA
FT                   PFAAERSVVRLEPDKGEERARRWRRIAEEAARQCGRADVPEVRAPAPLAGVLAALPPGA
FT                   LAIALQPGGPPVLALEPVAARAYAAIVGPEGGLTDVELAACDAAGARRAALGPRVLRAE
FT                   TAAIVAVALLQARFGDLGAPVPVP"
FT   gene            314619..315572
FT                   /locus_tag="Anae109_0269"
FT   CDS_pept        314619..315572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0269"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   ade:Adeh_0248 RDD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24487"
FT                   /db_xref="GOA:A7H6Z1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z1"
FT                   /protein_id="ABS24487.1"
FT                   /translation="MLCPRCARETDERAAFCGACAAPLTLRDEPALRTLDVTLDLDRRR
FT                   SRTPPSLSSPSPTPPAAPARGAPPPEPAFVAPPAPAPASRSHWDLGRMVEEALRDAGVA
FT                   AEASAPAGAPAPAAQLAAPAAESAPFAWSDAAPQRWPDAAPEVIDADEAEVLGVAEVAV
FT                   RPAEVHLRRPATWRRAGAWAIDAGPLLAGVVYLGASLLAPTGSGAVAGLDGLLDLLARE
FT                   KDVVLSLVALLALALAVYATLAHALAGATLGKWMLGLRVVGPGGRRPSLARSAARSGLA
FT                   AASFALLGLGFLLALFTRSGRALHDLLARTWVVEAP"
FT   gene            315604..317637
FT                   /locus_tag="Anae109_0270"
FT   CDS_pept        315604..317637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0270"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: General secretory system II protein E domain
FT                   protein; KEGG: ade:Adeh_0249 PBS lyase heat-like repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24488"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z2"
FT                   /protein_id="ABS24488.1"
FT                   /translation="MPKDLAALLVEEGVVTADVMERALARRDEAGGALDTALLELGALP
FT                   EDALAIALAGAADVPPAPPEAFAGGDARARRVFPARVADRHGLAPFALDGRELSVVSVF
FT                   PVDAGLLDEIGFMLSLHLTAYVAPEWRVRLLVHQLYGTPIAPRFAAMAVAAGALAREDS
FT                   PGEADAAPGTEEREEGEAAPVGFGGDDEGPLEPLAAALAQALEEVDPGLVREALAPAGG
FT                   DAAAIRDAAPGAEEDVHAAPPDRSAPPGWTLEHARAALAAARTRDEVVLVALRYARDFF
FT                   AFAAMFAVTRDAVAGHDALGVEPEARELARGVAIYADDPGTFRTVIETKSPYLGPVSRE
FT                   PAGNAAILAGLDRGTPRTALVAPVLLRDRPVCVLFADNGGAPVSARRLGDLLLLVSTLG
FT                   AAFERIIRERKRRRAPARTLPPRAAQLAAEPAAAPPASDPWTAAAPGATPAPPAPAAAP
FT                   ADPWTATEPARPALAPAAAPAIPDELDALEIDVDESVVAPNTPPALLADRALDADPAVA
FT                   AAACAALAARRREPAAREASERLRRALLSGIEARARRAARALGALRDVDAIPLLVQVLE
FT                   TSAPEPARAAADALADITLQRLGTDARAWLGWWKQNRGRGRAEWLFSGLTSQERETRVA
FT                   AAVELSGVAPPPVAYSADLPPAERESAARAWAGWWSRSGNVL"
FT   gene            317740..319302
FT                   /locus_tag="Anae109_0271"
FT   CDS_pept        317740..319302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0271"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: ade:Adeh_0250
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24489"
FT                   /db_xref="GOA:A7H6Z3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z3"
FT                   /protein_id="ABS24489.1"
FT                   /translation="MHKPVDPDPRRALLDQLDAEAERGGGEERIAKQHRAGKLTARERI
FT                   ELFLDPGSFVELDKFKTHRCADFGMERQKVLGDGVVTGYGLVEGRQVFVFAQDFTVFGG
FT                   SLSGAFAEKICKVMDRAMEVGCPVVGLDDSGGARIQEGVVSLAGYADIFLRNTLASGVI
FT                   PQISVILGPCAGGAVYSPAITDFIFMVKDTAYMFITGPDVIASVTHEQVTKEDLGGARA
FT                   HATRSGVAHFAIDSEEATLGAVRELLSFLPLNNADDPPAQPCSDDVLRRDELLKTVVPE
FT                   SPSKPYDMREVVKATVDDRHFFEVAELFAANIVVGFARLNGRPVGIVANQPAVLAGALD
FT                   IDASVKAARFVRFCDAFNIPLLTFVDVPGFLPGVDQEWRGIITHGAKLLYAFAEATVPK
FT                   VTVITRKAYGGAYDVMASKHLRSDVNFAYPSAEIAVMSPEGAVGIVFRKELQAAKDPVA
FT                   ERARLVQEYRDKFANPYKAAELGYVDEVIRPEDTRPKVIRAFEMLRTKRQENPPKKHGN
FT                   IPL"
FT   gene            complement(319324..319941)
FT                   /locus_tag="Anae109_0272"
FT   CDS_pept        complement(319324..319941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24490"
FT                   /db_xref="GOA:A7H6Z4"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z4"
FT                   /protein_id="ABS24490.1"
FT                   /translation="MTMRTHELHPSLVHAPLVLLPAAALVDLAAALRPRDRRLDRLGRN
FT                   LWWGAASAGLAAGLTGMAASQEIELRSTHAREMMFAHGIGNLCIVLAAAGVSGWRARNH
FT                   ANLTSALSGLLAAGAAGYTAYLGGELVYTHGAGVTALGGAAAESPPLFSAHGMARLGRD
FT                   AGRGLGWLLQRAYRAVTSRERVQRSALGPIAEAGTGAEPEIH"
FT   gene            complement(320122..320325)
FT                   /locus_tag="Anae109_0273"
FT   CDS_pept        complement(320122..320325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0273"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ade:Adeh_0252 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24491"
FT                   /db_xref="GOA:A7H6Z5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z5"
FT                   /protein_id="ABS24491.1"
FT                   /translation="MATGTVKWFNDAKGFGFITQDNGGEDVFCHYSAIQGDGFKSLAEG
FT                   QKVEFDVVKGPKGLQAANVRKT"
FT   gene            complement(320492..321664)
FT                   /locus_tag="Anae109_0274"
FT   CDS_pept        complement(320492..321664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0274"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   ade:Adeh_0253 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24492"
FT                   /db_xref="GOA:A7H6Z6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z6"
FT                   /protein_id="ABS24492.1"
FT                   /translation="MPVTDPAPLHAEETSAPLARLDRAAIEAIVRSGRRLLVQGGMGIH
FT                   ASDGVSGKVAAHRGARLVGVGTISAVLKTPEQLRAEIRRARREAPGGFVGVNLMAAINK
FT                   ADFELLARLSIEERVSFIVQGAGISREIVRWCKEGGVPFAGIVSSGRLAAMYEKWGADF
FT                   VVAEGSEAGGHIGDIGHSLPTLTREVLSATSLPVVAAGGVDGSDVARFFRGGAAGVQLA
FT                   TRFLACADGDVHPAFKAMHLGKGEDDVAIITSCVKGMKARAVRNAFTEKLARGEAVPPR
FT                   SKAWWFGKDGYLGRKKACIECLGEGLCVCRTSGFKESFCITDALLAAAVKGDEENGLFY
FT                   TGQSLVRIGERDVTTLPTAAELLAQLEARLATDDGAFEAAPALAAAAAGA"
FT   gene            321842..323203
FT                   /locus_tag="Anae109_0275"
FT   CDS_pept        321842..323203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24493"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z7"
FT                   /protein_id="ABS24493.1"
FT                   /translation="MRYARPARAMTSRSLEPKPLVVAVEMGYGHMRAAMPLADALGTEV
FT                   LQVDKAPLVAPGEERLWQRVRRTYEGVSRLSQVPWAGAPLRRALEAVTDIPRLYPYRDL
FT                   SAPTRGVHALDRLVRGRELGRGLVAELRRTGAPLLTTFYSPAIVADAAGVERVFCVATD
FT                   SDLNRIWAPVEPGRTHIRYLVPTRRAARRLRSYGVPEDRITFTGFPLPDALVGGTALGA
FT                   LKRNLAARIVRLDPSGEFRRSIPEELAHFLGALPAEEEGRPPLLAFAVGGAGAQAGMAA
FT                   ELLPGFRPALEGGALRICLVAGVRAEVAARFAEIVRRAGMEPLLGGPLEILLAPGFREY
FT                   YARFNALLARTDVLWTKPSELTFYGALGIPLVLAPPVGVHERYNLRWARESGAGLKQRD
FT                   ARFASEWLADGLADGVLAAAAWAGYMRLPKFGLQRILETVGAAPEARIAAPRGG"
FT   gene            323279..324052
FT                   /locus_tag="Anae109_0276"
FT   CDS_pept        323279..324052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0276"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; KEGG: ade:Adeh_0255
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24494"
FT                   /db_xref="GOA:A7H6Z8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z8"
FT                   /protein_id="ABS24494.1"
FT                   /translation="MLRAFSVVYWVFFVATLPILFLGAALVFLVTVPFDRRRVAVHLYS
FT                   CAWATFYVLANPLWSTSIHGRERLPWKGAAVLVANHLSLLDILVVYGLFRPFKWVSKAE
FT                   IFRVPFVGWNLWLNDYVAVKRGDRESIREMMDRCRAHLARGSPVMLFPEGTRSRDGRLG
FT                   PFKDGAFRLAIEAGCPVIPLVVSGTGDALPKHGLVLRQRMRARVEVLEPLHPEDFPACD
FT                   ALRDAARAAIAAALPEANRPAGPLRSAPPGLPQVR"
FT   gene            324134..324610
FT                   /locus_tag="Anae109_0277"
FT   CDS_pept        324134..324610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24495"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z9"
FT                   /protein_id="ABS24495.1"
FT                   /translation="MAGEYQVTGGYGDAVPGTVGPDAIDGRVEWVDVAGQSLAERLEAR
FT                   LGSEVDLRKVLLGVLVPLAGALHGEPTRAIAARLPYPLARELLDADDGVARVPAGVETY
FT                   LRDVAELVQHPVPSAALYARAVLDTVREALPAEAASEVERRLPAALAALWRAAR"
FT   gene            complement(324621..326036)
FT                   /locus_tag="Anae109_0278"
FT   CDS_pept        complement(324621..326036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0278"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0256
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24496"
FT                   /db_xref="GOA:A7H700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H700"
FT                   /protein_id="ABS24496.1"
FT                   /translation="MRGARERATIPARARARKASPTSTPRVRNVRGADWQGAAERVTGG
FT                   SRRTAARPRCPAMPEDVVRREPEGDEASERTRVPLAGGLERLLAVEPEEHALRRLLGAL
FT                   AEVVPAIDSVALLVREADRLELVAAVGLDEGAPAAIAAGLAAEVADSGTLRTTGRPGSP
FT                   FPPGTRHGAGAPLLACAAPGALLAGTRGEEPLDADALLLLRVAAERAARTIDRARFARA
FT                   QEDARETLRRAEGDLENRRRTVDFILGVVGHDLRNPLGAIHMSAALLHRKGALEGWQAR
FT                   AIERMRSSAGRMGRIIQDLLSYTRTRLGNGIPINPCPASFDAIARKVVDELRAVNSDRA
FT                   IEIAVHGDPAGEWDPDRLEQVASNLVSNAIDHGDPAVPVRVEVDGDDAERLLLHVRNGG
FT                   PGIPAEVLSHLFEPFARGPDEKSRKASGLGLGLYISRQIVRGHGGEVEASSHDGETIVT
FT                   VHLPRRCVARPTA"
FT   gene            326084..327616
FT                   /locus_tag="Anae109_0279"
FT   CDS_pept        326084..327616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0279"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: ade:Adeh_0257
FT                   carbamoyl-phosphate synthase L chain, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24497"
FT                   /db_xref="GOA:A7H701"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A7H701"
FT                   /protein_id="ABS24497.1"
FT                   /translation="MSPKKPIRKVLVANRGEIAVRVMRTCREMAIATVAVYSDADRGAL
FT                   HVRKADEAVHIGASPARDSYLVVEKVVDAAKKAGADAIHPGYGFLSEKAELARACEAAG
FT                   ITFVGPSAASMDAMGVKTTARRNMNAAGVPTVPGSEGPIADEQEAKAFADAIGYPVMIK
FT                   AAAGGGGKGMKKVEREADFLSLWASARRESAAAFGDDRLYLEKFLDRPRHVEIQVFADE
FT                   HGNVIHLGERECSIQRRQQKVVEESPSCVLDERMREAMGQVAVRAAKAVGYRGAGTVEF
FT                   LVDAQRDFYFLEMNTRLQVEHPVTEMLTGLDLVRMQLEVARGERILAQDQVVRRGHAIE
FT                   ARVYAEDPARRFLPSPGKITYLRVPGGPGVRDDSGVYTGWVVPQFYDPMISKLVAWAPT
FT                   REQAIERLIRALGEYTVHGIATNVAYLAAVLDHPAFRSGDYDTGFCVAYERDLVRPPDP
FT                   AFEGVALIAAAVEAFRRDRDAAETFAARAGAAATRSGWARLGRARALRGGGR"
FT   gene            327613..328125
FT                   /locus_tag="Anae109_0280"
FT   CDS_pept        327613..328125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0280"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: ade:Adeh_0258 biotin/lipoyl attachment
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24498"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A7H702"
FT                   /protein_id="ABS24498.1"
FT                   /translation="MSTYVALLDGGRREESIEVRQTGAGTFEVRLRGEVHVVDAYKHDY
FT                   GTLSLIVDTASYTATLDRRDAHVRVRVRDSVYPIEILDEKKLRIRRATARFTVDGRQIL
FT                   TAPMPGRIVRVLAKAGDAVKAGQGLVVVEALQMENEMKSPKDGKVLEVLVAEGQAVEAN
FT                   AKLCVVE"
FT   gene            328189..329838
FT                   /locus_tag="Anae109_0281"
FT   CDS_pept        328189..329838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0281"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; KEGG: ade:Adeh_0259
FT                   methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24499"
FT                   /db_xref="GOA:A7H703"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:A7H703"
FT                   /protein_id="ABS24499.1"
FT                   /translation="MADEKKQRWIEGTYGKAVKKGPERRARFETTSGVPQQPVYVPSDV
FT                   KPALEERLGLPGEYPFTRGVQPTMYRGRFWTMRQYAGFGSAEESNKRYHYLLKSGQTGL
FT                   SVAFDLPTQMGRDSDHPRARGEVGKVGVAIDSIRDMETLLDGIPLGEVSTSMTINSTAG
FT                   ILLALYQAVGEKQGVAPGDLQGTIQNDILKEYAARGTYIYPPEPSLRVITDIFAYTAKV
FT                   MPKWNPISISGYHIREAGSTAVQEVAFTLADGIAYVDAAVKAGLDVDAFAGRLSFFFNA
FT                   HNDLLEEVAKFRAARRLWSRLMRDRFKAKDPRSMMLRFHTQTAGSMLTAQQPDNNIVRV
FT                   TIQALAAVLGGTQSLHTNSRDEALGLPTEESARIALRTQQIVANESGVADIIDPLGGSW
FT                   AIEAMTDEIEGRAEEYLRKIDEMGGMVHAISKGYVQREIQEAAYAWQRKVEAKEQVVVG
FT                   VNAFRSDDPAVTVMKVDPAVEERQVARLQSFRRERNGTAAKQAVEAVRAAAKGTDNLMP
FT                   PILAAVKAQATLGEISDALREVFGEYRETVVL"
FT   gene            329846..331729
FT                   /locus_tag="Anae109_0282"
FT   CDS_pept        329846..331729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0282"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   ade:Adeh_0260 DnaJ like heat shock protein with
FT                   tetratricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24500"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A7H704"
FT                   /protein_id="ABS24500.1"
FT                   /translation="MSDGNGQGKAAGAQQPADEAPPRLDRVPPGYRPPPVRAATPPPRV
FT                   APEASARAAPPVPPRASYGLAEREVTAAAAIAAGLAREGSLRAEGALHLFLLAAANQAH
FT                   GRLALASGPVRYALTFRRGTVEHVASAAPEDGLGRFLVRRGALTPEQLVRADGACAPGG
FT                   DLVATLVAERLLAPSDVAALLGEHGASLVARALAVEDGSWSWEPGAAPPPSGFPLGNPY
FT                   GMAAAAVRAVDAAGAERRLGDRAGRAASRVVGRVRLEDLRLAPQEARLTGLFDGRSALE
FT                   LAAAHPADAATILRVALLLAEAELLAFGAARASPPRAVPGASASASSAAAAQPTSTPTA
FT                   PRNPEAGHPSAASGRDAQDRPRVASSAAARAPTSTPTAGARTAAHPERSAAAAAAERAR
FT                   GTPPVPVDPATLRALLQRLAAADHFEVLGVKRDAAPAQVKVAYFRLAKSYHPDAVPASV
FT                   SAEVRGLCADVFAKVSAAWAVLGDDAQRAKYLDELASGGAADVDVMRILQAENVFQAGT
FT                   VLVRARRYAEALEKFRDAAVLNEDEPEFAIWLAWCEFLVAKEPRAQHAASAAAIEDGLR
FT                   RNARCAPGYLFLAQMAKIVGDLSLAERHLRRGLAVAPEHVDLVRELRYLRK"
FT   gene            331737..332243
FT                   /locus_tag="Anae109_0283"
FT   CDS_pept        331737..332243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0283"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   ade:Adeh_0261 protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24501"
FT                   /db_xref="GOA:A7H705"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A7H705"
FT                   /protein_id="ABS24501.1"
FT                   /translation="MPAPTNPKKRALMPSTRLRKTLRAAGHHLSPVVQVGKEGVTEAVL
FT                   RQLDEALSAHELVKVKIGTETPEDRFEAADRLGADSGAQVAQILGRTILVYRRHPEKPR
FT                   YEAPTARPALKELESPAPRTRGKARRSPARGAKGPARGAKPGRGAKGAARGAKPARGAA
FT                   RTRSR"
FT   gene            complement(332457..332759)
FT                   /locus_tag="Anae109_0284"
FT   CDS_pept        complement(332457..332759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24502"
FT                   /db_xref="UniProtKB/TrEMBL:A7H706"
FT                   /protein_id="ABS24502.1"
FT                   /translation="MPLLLWIAVVVLATAVLRFARRERELAGEVGDLGERVKELGLRLE
FT                   AAEAEVAQAVTQAEIAENVLLEKGVADEDDIEAVRRRFVADATSGYDRARDGELN"
FT   gene            332804..333487
FT                   /locus_tag="Anae109_0285"
FT   CDS_pept        332804..333487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24503"
FT                   /db_xref="UniProtKB/TrEMBL:A7H707"
FT                   /protein_id="ABS24503.1"
FT                   /translation="MRPSATACDLVRRAPVGHPEPRVARLNVTLAVKRLVRDVAARVPE
FT                   LAHVRSSRVLVVAGEARRASRATIRPAHFKRPRAPGTGGRQKPLIRVRGRKILYVITLR
FT                   PLWFRASTPEQRIGTILHELYHASNRFDGTLHRGRRHSRLPRARYNRKIRRLLERYLAV
FT                   APPEIVAPFSASGIVRARMWLERPGGSFPEEGFTGRRLYTERQLFCGLVRMVTPRRRKT
FT                   RRAAG"
FT   gene            complement(333547..334140)
FT                   /pseudo
FT                   /locus_tag="Anae109_0286"
FT   gene            334420..335355
FT                   /locus_tag="Anae109_0287"
FT   CDS_pept        334420..335355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0287"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: ade:Adeh_0265 pseudouridine
FT                   synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24504"
FT                   /db_xref="GOA:A7H708"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A7H708"
FT                   /protein_id="ABS24504.1"
FT                   /translation="MRREIRLPLTASGRLDRALADALGLGRASVKRAFLLGEVRVRGRR
FT                   ARASDPAEPGALVELDVEEPAGAPEPEPEAPLAVLVETPRLVVVDKPAGVAVHPLAPGE
FT                   GGTLANAVVARFPECAGASPEPREGGAVQRLDLETSGCVTFARDPEAWQELHARLSARE
FT                   VEKIYLALVAGRMATVGVSSVPLAQRGGRAIPVPDPETEERLRAKGLRPRPAETHWDVA
FT                   RRFETHTLLRVRIVTGVMHQIRAHLAHLGHPVAGDALYGGDAAALPGLRRQFLHATRLA
FT                   LEGPDGERVEAESPLPPELEAVLARLGAGR"
FT   gene            complement(335563..336018)
FT                   /locus_tag="Anae109_0288"
FT   CDS_pept        complement(335563..336018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0288"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_0266 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24505"
FT                   /db_xref="GOA:A7H709"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H709"
FT                   /protein_id="ABS24505.1"
FT                   /translation="MGMALGTKKPASDINVTPLIDVVLVLLIIFMVLTPLAEKQKFMRV
FT                   PDYQPEMQPVPPDSVPPDQTILTALRNGNVLLNKQELSVADAMQRLGPAYEGRPSKVLF
FT                   FNAEDNVKYDQVVYVLDQAHGAGVNTIGMMTDPPLTAQAAPAEAAPQ"
FT   gene            complement(336021..336434)
FT                   /locus_tag="Anae109_0289"
FT   CDS_pept        complement(336021..336434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0289"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_0267 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24506"
FT                   /db_xref="GOA:A7H710"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H710"
FT                   /protein_id="ABS24506.1"
FT                   /translation="MSMDVGSKSVKSDINVTPLVDVVLVLLIIFMVITPMLQRGKPVQL
FT                   PDAKHVSALKGGGDPVLLSITADGKAWIDKAEVPLDQLSTELTVAMQMSPGSPVMIKGD
FT                   KSLDYKKVREIILEVSKTHLLGVSLAASEIKEK"
FT   gene            complement(336473..337240)
FT                   /locus_tag="Anae109_0290"
FT   CDS_pept        complement(336473..337240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0290"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   ade:Adeh_0268 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24507"
FT                   /db_xref="GOA:A7H711"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A7H711"
FT                   /protein_id="ABS24507.1"
FT                   /translation="MFQPLDAVHNLALAQAHGAGAAPGTFDLVNMIKSIEGFGIVVAVI
FT                   LGIMSIYSLGVMAERLVTYSRANKASRQYAASLRDLLPGGKFGDAVELSRKLKRGHLPK
FT                   VLGLAIEEYSRGVEALHTRGPKDVGDFDVIAAVNRAVERSSLRTVNDLRRGLGSLATIG
FT                   STAPFVGLLGTVWGIIKAFQNMAATGSGGLGTVSGAIAEALINTAFGLLVAIPAVMMFN
FT                   YLTNRVEDMQVDITDSATELVDFFMKEGRGEAR"
FT   gene            complement(337308..338051)
FT                   /locus_tag="Anae109_0291"
FT   CDS_pept        complement(337308..338051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24508"
FT                   /db_xref="GOA:A7H712"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A7H712"
FT                   /protein_id="ABS24508.1"
FT                   /translation="MFDEVTKKEGGKAAARRAGYVFGSTVFQGILIAAVIFASAAIKAK
FT                   VIDEPVVDVKFVKTAPPPPPPPPPPAPPAARKRPPESKPRTDLPKPPPPQALIQPQEIQ
FT                   PEMKAPDPNEAPEPEYDYGDVGEGEGVVGGVVGAQAANDIEDAPAYATAGYRKPQMKEP
FT                   GCVQRSVRIPQQLAGYISGPITVKFAIRPDGVPSRFEVMGTVPDQRISTSIWQAVQSCK
FT                   WVPGADAQGRPVAIWVILPIRFTSG"
FT   gene            338542..341871
FT                   /locus_tag="Anae109_0292"
FT   CDS_pept        338542..341871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24509"
FT                   /db_xref="GOA:A7H713"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A7H713"
FT                   /protein_id="ABS24509.1"
FT                   /translation="MRKKLLRFLRLAPLALLFASTASAQTTGTILGVVTDASTGKPVAG
FT                   AVIIATSPSLQGEQTAVTDNNGSFRLPQLPPGDYKLAVQLDGYKPAERSDITVRLDKTI
FT                   RANLAVVPEAVQMEEQVVRTGAAPVINIGAAESGAVISREFVASVPVGRTVEAVSATVP
FT                   TASVDQYGVGFAGSQSPENAYILDGMNVTDPVYGTFGGNPTAQNPQTTLITNFIQEVDV
FT                   KTGGFMPEYGRATGGVLNMVAKSGSNEFHGSVFGNLTPRFLFQPTGRTAGAAGEAVAWR
FT                   FKPDEGSYDLDLGFEIGGPIQKDKLWFYAGFAPVITKRNTERFLRSNVLGDVGTGNCAV
FT                   EDPLELGRCIDSNGNFVQNTIPGTSEIIESGRSTYQFTGKLTYLLNENNNFTLSGFGLP
FT                   STEKRYAMNGAEQRRTIESTDNIFDVIGRYSGKFLDKRLITEVVAGWHGSTSVDDPSSF
FT                   QASNSAIEWYDNLPLSGFEGDRPGVDAACNTADPLASCTVFGYLTGGSGFLNDSAANRL
FT                   AGRVNATYLFDAFGSHATKGGLDVERSTYGITKRYGGGAYFRAVPNATGTDASLRVFRG
FT                   YGVVNNGTPSDTFGVIAEPGALIGPDGINQFESIETNSQTTSTALYLQDSWQLPIQNVT
FT                   LNYGLRWEMQDMSNRDNPEDNGFTISNNWAPRVQAIWDFTGNGRGKLAGSWGRFYYMMP
FT                   LDMGDRAFGLEDNLRYRLTASTCGNWAQSGAVGNYAAFDATQVGLGRSTCEIETRTAAG
FT                   ETFDAFQSGGFTPVDPNLDATYVDQFGGQLEYEVLSDLSLGLEYQGRRQGATIEDMSSD
FT                   DGVHYYIGNPGTGSPFTIDGVTYDPVNVTTFDVMTGREVNVKFPEPERSYDAITVFGRK
FT                   NFSQNWQAFASYTYSYLRGNLAGPYREEDGQIDPGITSEYDLASLMANKHGRLPGDRPH
FT                   QVKLYGSYTFNFGPRFNLTTGAGYTGTSGNPVNALGADGGAGDYGEGQAFILPRGMAGR
FT                   SPFLHNVDLKGSLSYVITPPYALQFSVDVFNVFNTEEVRLTDENYTFDAVQPIVGLNCD
FT                   TSAGGSSNPVAKLQADCSDVRYLKTVDGRPVSVNPNWGKAAPGVNSFQAPLSLRFGVAL
FT                   SF"
FT   sig_peptide     338542..338616
FT                   /locus_tag="Anae109_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 25"
FT   gene            341894..343552
FT                   /locus_tag="Anae109_0293"
FT   CDS_pept        341894..343552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24510"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A7H714"
FT                   /protein_id="ABS24510.1"
FT                   /translation="MNSIRKLWWVGAVAIIAACDPYDDENKGPPSILSAFASNADEAAE
FT                   GELVDGFWTIRSSSVCEGAHLAPRGVVPRGASAEASTIADIPVVYVKTNKLLDGASIQA
FT                   DPLSCDPAVRDGAPWLKVTRVVGATETDDSANWLSCYNPSSPTSSEGASIIIYRGEDVS
FT                   GGVAGDGWFAVSEVEGDAAEVATYRIEGTVFDRQGNALPVNVAFELEPDAGPIKSFRAT
FT                   ELAGSGDAVTANFEFTPGACGSATEYVVQKVTGKDADGDPIWTALEGATFTVADPPATT
FT                   YSFTDTVTAGEVYDYRIRATVPGVGEEFTETAGEYTLTALEIPAGAPTAAFLPAEGTGT
FT                   AAKPNRISVNTSATALPAGASAFVVLRATEDESIATEDLPGAFSVVAPEVGLAGSTTEA
FT                   KFPFEDTKLSGCQQYFYALAVTDADGNVGPYGDPSPGVKSPVAKVAAPTLEAVTAGGVK
FT                   VTWKILRGALTYDVQRAPDAAGVPGTYETIAANVAQPANPVDPTAKAVTTANVTDATAA
FT                   AGTKYHYRVNVATSDSTLCSDVVTTSTGTAASITR"
FT   gene            complement(343799..344458)
FT                   /locus_tag="Anae109_0294"
FT   CDS_pept        complement(343799..344458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0294"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   ade:Adeh_0272 translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24511"
FT                   /db_xref="GOA:A7H715"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H715"
FT                   /protein_id="ABS24511.1"
FT                   /translation="MAEVNANMVKELREKTGAGMMDCKKALAEAGGDFAKAEEVLRKKG
FT                   LAAAAKKSSRAATEGQVASYIHMGGKIGVLVEVNCETDFVARTDGFQALVKDIAMQIAA
FT                   AAPQWVRRDEVPADVVAKELEIAKAQMRDQKKPEAILEKIAQGKLEKFYEQFCLLDQPF
FT                   VKEDKKKMSEVLTDAVAKIGENIQVRRFARFVLGEGLEKKQENLAEEVAKAAGLQK"
FT   gene            complement(344541..345488)
FT                   /locus_tag="Anae109_0295"
FT   CDS_pept        complement(344541..345488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0295"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: ade:Adeh_0273
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24512"
FT                   /db_xref="GOA:A7H716"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H716"
FT                   /protein_id="ABS24512.1"
FT                   /translation="MASALTTQGTAITMKQLLEAGVHFGHQTKRWNPKMKPYIFGARNG
FT                   IYIIDLQKTVGLARGALRFVSDAVAKGGMVLFVGTKKQAQDAIREEASRSGQYHVTNRW
FT                   LGGTLTNFKTVKQGIDRLKTIEKMAADGTYERLPKKEVAQLEREREKLEKNLGGIKEMS
FT                   RLPAAIFVIDTKKEHIAVHEANRLGIPVVAVVDTNCDPEGIEYVIPGNDDAIRSIRLFT
FT                   GKIAEACIEGRARYSTWAAQHGEERRPGEEDRDAASERGQKDRRDRRDRRGGGRDRERR
FT                   EPREDRAAASANVEVVRKGEVTPAQPAPGSDANR"
FT   gene            complement(345901..346944)
FT                   /locus_tag="Anae109_0296"
FT   CDS_pept        complement(345901..346944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24513"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:A7H717"
FT                   /protein_id="ABS24513.1"
FT                   /translation="MRRRSKPRHGPPASVPRARRAPPGKPETAPTAPGERPTAARAAGD
FT                   VLLAWARDRDGRKVHAVRLDANDRRARAPFTCLGCGEELVPHLGKVRAPHFAHRAGSAC
FT                   PLTAPETALHLDAKERLLALCEDAFTGRRRVTLLTRCPACRRAAPREVAREGDRAVTEG
FT                   AIGALRADVLVLAGERPALAIEVVVTHAVDAAKEVALATAGVPAVEIDARDEWEREGAD
FT                   GVELACARSLGFPPCPTCAAHARADEDRARGGEGAEIAELEAYRARGFFSARPAGLPAP
FT                   VAPHDAPLSREERAALADRFRCPDCGLTRLDLGERLARHACPGGTARPVAWRGYDGAVV
FT                   TLSWWQR"
FT   gene            347072..347527
FT                   /pseudo
FT                   /locus_tag="Anae109_0297"
FT   gene            347568..348881
FT                   /locus_tag="Anae109_0298"
FT   CDS_pept        347568..348881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0298"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: ade:Adeh_0276
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24514"
FT                   /db_xref="GOA:A7H718"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H718"
FT                   /protein_id="ABS24514.1"
FT                   /translation="MPRKPLRPRPNRNDLVDPLVLEVHGLVRDQGWLADRALERALRRE
FT                   PKPWASERRAVAESVYGLIRWQGLLDFLLGGKPDLATRYAAWLVRFEGVPVADAARRLA
FT                   VPPAALAGLASAEARLAAVTEPVERLSLEASLPSWIAERFVRELGEVEARTLAAAMNAR
FT                   APLTVRANLLKIDREELRGKLGSEGMASEPTRFSPWGLVLDGHQNAFALGSFRDGLFEI
FT                   QDEGSQLIALACGARPGKTVVDACAGAGGKSLALAMEMRNKGSLHALDTDEGRLDDAKK
FT                   RARRAGVHNLRARVIAAGAEAEAQLADLAGQADVVLVDAPCSGLGTLRRKPDARWRLTP
FT                   EDPERFAGIQRTLVRRFAALLRPGGRLVYATCSVGKTENGDIADYAEREVGLAPVPLAP
FT                   LLGEERAKALGVDGARLELFPHRHGTDGFFVAAFEKRK"
FT   gene            348884..349714
FT                   /locus_tag="Anae109_0299"
FT   CDS_pept        348884..349714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0299"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase; zinc finger Fpg domain
FT                   protein; KEGG: ade:Adeh_0277 DNA-formamidopyrimidine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24515"
FT                   /db_xref="GOA:A7H719"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A7H719"
FT                   /protein_id="ABS24515.1"
FT                   /translation="MPELPEVEIAARNLRRWTMGRRIERIEPDPKARYVFRPATPTAFA
FT                   RGLEGARFGPIRRIGKHLLVSMKKDGAPVGLLAHLGMTGKWLRREGDAAPSRFSRARFH
FT                   LDDGAVLHFDDMRLFGRLRVVPGARFEEVREIAELGPDPLEQGIDLDRLAEALGRSRLA
FT                   VKVRIMDQALLPGVGNIVASESLFLAKIDPRRQARSLTPAEVRKLADGILATVKETIAR
FT                   EDSPEISYVEEPGSENPFLVYAREGERCPRCRRAEIVRVVQAQRSTYYCPRCQR"
FT   gene            349883..351298
FT                   /locus_tag="Anae109_0300"
FT   CDS_pept        349883..351298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24516"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A7H720"
FT                   /protein_id="ABS24516.1"
FT                   /translation="MALPFARESSPEARAAPEAALAAAPDGQPRRFDGWPGGAGLSVSA
FT                   VCAALVALTVHADVDAEWRLHARKWVDADKVLCGIGETSDDVPAHLGRREEAGKELRAA
FT                   RPSNRDVEAALRGSSRPDRLLASAAIAVIGDASDAQVDGLTRQVQDPDPYARLLAVRAL
FT                   RSASAEQVGKRATALVAALVREQNGAVLLEAIPLLEGMDSSDATPVFGHMFELPDDGLH
FT                   AYAYAMLERLGRPSLESVERYVEQRGSAPARDALRGSDWLRAANQYVDSYRSYYLGGHN
FT                   GMDDFGALKSAGERLARRVPRESVLREALFHHDALKRAAALAALSVARSTNGDLVPRLI
FT                   HLMRHERDPVMRGFAADALRAAPEDVVRKNARGVIEALSDESDVHVVVAESFLAMRLDP
FT                   EAAVEAIAMLSIRGDNTLRRVLHAQLHNIGGPPAVERAAQMLGRLGKTEAAAELREIEK
FT                   EREERDRAKRRGD"
FT   gene            351376..351579
FT                   /locus_tag="Anae109_0301"
FT   CDS_pept        351376..351579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24517"
FT                   /db_xref="UniProtKB/TrEMBL:A7H721"
FT                   /protein_id="ABS24517.1"
FT                   /translation="MPRCCKRQSRPRVSVVRSCFGEVGLLLEAPRPRGPDQFLDALVAR
FT                   AINASLGRWEAFWAPNSYSAVA"
FT   gene            351831..352847
FT                   /locus_tag="Anae109_0302"
FT   CDS_pept        351831..352847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0302"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: ade:Adeh_0278
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24518"
FT                   /db_xref="GOA:A7H722"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H722"
FT                   /protein_id="ABS24518.1"
FT                   /translation="MARSTGQLPTVPAPPPGGVHSASMRPEDLARMSVAELRERFLDRN
FT                   RALSPECEAALTTDPRAGAREVLRLILKRRHANRAEGQRLRHLLRYEGELWDGGVTLVA
FT                   GVDEAGMAPLAGPVVAGACILPRDYRPRGIDDSKQLDRRERERLAEDIKANAVCWAVAR
FT                   AEVEEIDRLNIYRAGLLALTRAVQALTPAPGHVLVDARKLPELRLPQTPIIHGDALSLT
FT                   IAAASILAKTTRDELMGELDALYPGYGFCNHKGYPTAEHFQALERLGACPIHRRSFQPV
FT                   REALGLAPLQGELFAPPPESAAEPGGEGAIAGIAPGSAPCDVAEPLPARTPASARGI"
FT   gene            352963..354609
FT                   /locus_tag="Anae109_0303"
FT   CDS_pept        352963..354609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0303"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="TIGRFAM: poly(A) polymerase; PFAM: Polynucleotide
FT                   adenylyltransferase region; KEGG: ade:Adeh_0279
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24519"
FT                   /db_xref="GOA:A7H723"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A7H723"
FT                   /protein_id="ABS24519.1"
FT                   /translation="MHDRSPTDLLPASHEEELEESRPHRPPPGLALDPPEEPPPEHPPE
FT                   IPLDRLDADAVRVIARLRHMRHRAYFVGGCVRDLLLGAKPKDFDVATDAHPGEVRAIFR
FT                   NCRLIGRRFRLAHVYFRGGKVIEVATFRKNPVDVGEDVPDTDDLLITRDNVFGTAEEDA
FT                   VRRDFTVNGLFYDVATGEVIDYVGGREDLEARRIATIGDPEIRMREDPVRLLRAVRFAA
FT                   RLGFIIAPDTFEAMRRHASELARCAPARVLEEIFKILRCGGSARAFELLRASGALPVIL
FT                   PALAAALESWDTTGRRAFFAHLAALDRLVRSGEEVSDAVLLGAIVMHLGGPAAGPSPLE
FT                   PASVDATPEEGAPAHGGHDAAAALLDSLVQSARLPRKIAERTRLALHALRMFRDPPKKR
FT                   RRRGRGVAGQSYYEDALQLLQISVAATGEGQEVLERWRATSGAHPAPAPAREQPEPRRR
FT                   GPERTREPRRAHAPAAAASVEIPVQAQETATEEIPFVEVAAGGEAPETPRPGTEATSAA
FT                   AGDGARRRRRRRGGRRRRRRGAGEGAPAEQP"
FT   gene            354714..355463
FT                   /locus_tag="Anae109_0304"
FT   CDS_pept        354714..355463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0304"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0280
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24520"
FT                   /db_xref="GOA:A7H724"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H724"
FT                   /protein_id="ABS24520.1"
FT                   /translation="MPSDRAATPKPSYKRILLKLSGEALMGDGKYGISPKTLSAIAGDV
FT                   KDCVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINAMALQDALEKIGV
FT                   NTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIIVF
FT                   DSTLRGNVRRVVLGEQIGTTVGRLEEK"
FT   gene            355481..356044
FT                   /locus_tag="Anae109_0305"
FT   CDS_pept        355481..356044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0305"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: ade:Adeh_0281
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24521"
FT                   /db_xref="GOA:A7H725"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H725"
FT                   /protein_id="ABS24521.1"
FT                   /translation="MSVADDILNDLHGGIANTLDDLRRELASVRTGRASLHLLDGVRVD
FT                   YYGTSTPLNQVATLSVPEARLIMVKPWEKNLIPVIEKAIRDANLGVNPQSDKDLVRVPI
FT                   PPLTEERRKEIVKQVKHKGEDHKVAIRNQRRDAKELIEVAEKDGDIAADDAKKALDKMQ
FT                   KETDEGVKKVDEIVAAKEKEVMQV"
FT   gene            356041..356238
FT                   /locus_tag="Anae109_0306"
FT   CDS_pept        356041..356238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24522"
FT                   /db_xref="GOA:A7H726"
FT                   /db_xref="UniProtKB/TrEMBL:A7H726"
FT                   /protein_id="ABS24522.1"
FT                   /translation="MRLPALLLLLGPLFVIGFGAGALRAWSHRPGVSDRTRRALQAVWV
FT                   LLLLGGTPLWLFLAATLGIF"
FT   sig_peptide     356041..356124
FT                   /locus_tag="Anae109_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.403 at
FT                   residue 28"
FT   gene            complement(356266..356475)
FT                   /locus_tag="Anae109_0307"
FT   CDS_pept        complement(356266..356475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0307"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   bja:bll5352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24523"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A7H727"
FT                   /protein_id="ABS24523.1"
FT                   /translation="MPNSIYKVIEVVGSSPESWEKAAQAAVEAASKSLRDLRVAEVSAL
FT                   DIHLDGGKIAAYRTKLKLSFKFEE"
FT   gene            complement(356701..357138)
FT                   /locus_tag="Anae109_0308"
FT   CDS_pept        complement(356701..357138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24524"
FT                   /db_xref="GOA:A7H728"
FT                   /db_xref="UniProtKB/TrEMBL:A7H728"
FT                   /protein_id="ABS24524.1"
FT                   /translation="MNDLLRFLHILSASAWLGATLWVAGDVRRTLAAGRPFPAGLAARV
FT                   NPAIGLDVAMAVATILTGLLVLAFQGVHPRTGIMVGFALSIVRVVVVLAGLRPAWRAVA
FT                   TRLAAGQDVPPTDSPVKRMAMWSGMAHTLWLIALATMVFPV"
FT   gene            complement(357135..358061)
FT                   /locus_tag="Anae109_0309"
FT   CDS_pept        complement(357135..358061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0309"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   mxa:MXAN_2651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24525"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H729"
FT                   /protein_id="ABS24525.1"
FT                   /translation="MTAAFGVACHAPSETPVAKTPEPPAVSLMRDEPLPALALSSGGRR
FT                   APPAAMPARRPRTADAALSYPVFAPGTLSLDDVDLSVKVDEDRYEQVIVDLQRRAYALQ
FT                   VRNFLDEGRAIVVFEGWDAAGKGGCIKRLTTLMDPRGYKVWPIGAPNEEERSYHWLWRF
FT                   WTRLPRRGELAVFDRSWYGRVLVERVEKLATGEEWRRAYDEINAFERTLTADGIRLLKF
FT                   FLHIDRKTQLERFRDREADPVKRYKLGPEDWRNRKAAPAYRRAIEDMLARTHRPDAPWL
FT                   LVAANDKKHARLEVLRATIRLLEGKTP"
FT   gene            complement(358058..358393)
FT                   /locus_tag="Anae109_0310"
FT   CDS_pept        complement(358058..358393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24526"
FT                   /db_xref="UniProtKB/TrEMBL:A7H730"
FT                   /protein_id="ABS24526.1"
FT                   /translation="MIVVAVRDLLFRSKITSAAERLAVPILLAPRDRPLGDVVRETAGA
FT                   SVLADLNQPGMVEELAALKRDTGARVVGFLGHLQADLIEAAEAAGVDEVMTRGQLTGRL
FT                   DEVLRRG"
FT   gene            complement(358610..360313)
FT                   /locus_tag="Anae109_0311"
FT   CDS_pept        complement(358610..360313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0311"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; NAD
FT                   synthase; KEGG: ade:Adeh_0285 NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24527"
FT                   /db_xref="GOA:A7H731"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A7H731"
FT                   /protein_id="ABS24527.1"
FT                   /translation="MAPTGRIALAQVNTTVGDFAGNAAKIRAVTERARAEGATLVVFPE
FT                   LALCGYPPRDFLDLPEFLERAARTLAELAAPAEWSRDVAIVVGFPEGVAGAPPPGVYNA
FT                   AALIADGRVAAVGRKSLLPTYDVFDETRYFLPSDSSTAADAGGVGLRLGLSVCEDVWND
FT                   KRFWVHPRYARDPIAELVRGGAGLVVNISASPYAMGKPGLRERMLSASAAGHGAPIAYV
FT                   NQVGGNDALVFDGGSMLVGSDGAILARAPLFEEVLLVAELATGAASAVPLGRDGVAVAP
FT                   GAPDPEADEVYSALVLGVRDYVRKCGFRSAIVGLSGGIDSALTACLAADALGAANVLGV
FT                   AMPSRYSSGHSREDAAALADHLGIPFKEISIEPMHAAFLGQIEAAEGKPLGDLAEQNVQ
FT                   ARIRGQLLMALSNDTGGLVLSTGNKSELAVGYCTLYGDMAGGLAVIGDVPKTLVYRVSR
FT                   AANARAGRTLIPERTFTKPPSAELKPGQVDQDSLPPYDVLDDILEAYVEERLPLDAIVA
FT                   RGHPEATVRRVLRMVVASEYKRRQAAPVLKVSEKAFGEGRRFPIAHGYRY"
FT   gene            360393..361358
FT                   /locus_tag="Anae109_0312"
FT   CDS_pept        360393..361358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0312"
FT                   /product="ABC-type Fe3+ transporter, periplasmic ligand
FT                   binding protein"
FT                   /note="KEGG: ade:Adeh_0287 ABC-type Fe3+ transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24528"
FT                   /db_xref="UniProtKB/TrEMBL:A7H732"
FT                   /protein_id="ABS24528.1"
FT                   /translation="MTASPRRRVLAVLPLALALACSRPARTLPEVKVHVASDLPAEVLA
FT                   DVAARFGVAKVVPVAAAADAELAWVGDPAQALALGERLVAGSAPAAEDVPARWRDPKRR
FT                   FAPLGARARVLLVSPAARLPFSPSNLRDLADPRARGRISVVPFGRGAGPVTIAALVLAY
FT                   GGESAGRFLSLVARNEPQLADADAEVRARVASGQATFGLAGSLEGAAAAASATPLEVVY
FT                   PDQLGSGAVALPTAVALLGGASDAARALAAWLAGPDAERVLVARIPGLLPLRAEVPVPV
FT                   GVEPAGNIVSLPFDWDALAAETGKQRARLERWPEGFTERK"
FT   sig_peptide     360393..360476
FT                   /locus_tag="Anae109_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.941 at
FT                   residue 28"
FT   gene            361524..362924
FT                   /locus_tag="Anae109_0313"
FT   CDS_pept        361524..362924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2795 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24529"
FT                   /db_xref="GOA:A7H733"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A7H733"
FT                   /protein_id="ABS24529.1"
FT                   /translation="MQVRAARALLSLALGGLAVAGPAPVAARGARGAECVGRYADTLSA
FT                   MKAAAREREARPAADYVYCLRATAVYEHLSYGRGGKLRRQYYTKTRHGTGFAYGARGGE
FT                   SLVATNHHVVDFPEVTGEDTELEGVPAGSRRVREEVRIVSSEAEPEAPGQHALSAVVSD
FT                   EALDVAVLSTPTKLRTLPYRTGSARDLRVGDAVLVRGFPLGAFPAANAGRVIAVGQRDL
FT                   DRGWDHEDFAVDALLNLGSSGSPVLAVSCTTGEPELVGIYHAGYKGAQGLNVVVGIDQV
FT                   RGLLEGLRASPREVAARDPGVDRASARAVLAKGPVVMPFGGRVVRAELSGGGVRFSLLD
FT                   ASYPLSTRVELAVLDTGPRSGPGGDELSEALWEQLGLVLHYRRVEEERESASASSARAR
FT                   VEEHIRDREEEQADLIAAAEAGADGLALIGGAVRDPATGTAAPDARTPRGAPPPPARTR
FT                   GLRQTVAP"
FT   sig_peptide     361524..361586
FT                   /locus_tag="Anae109_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.561 at
FT                   residue 21"
FT   gene            363182..363523
FT                   /locus_tag="Anae109_0314"
FT   CDS_pept        363182..363523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0314"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: ade:Adeh_0288
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24530"
FT                   /db_xref="GOA:A7H734"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7H734"
FT                   /protein_id="ABS24530.1"
FT                   /translation="MAQIDIEILTPFAAKFMEGTTLTPAERAEVLRIAQGFACKDSAAA
FT                   AGVSPETIRARRKRIYRKLDVPGSGELLASLLALSLKMLAKGERIEPRPVTPAQPQPTT
FT                   TVSSAVVAR"
FT   gene            complement(363617..365614)
FT                   /locus_tag="Anae109_0315"
FT   CDS_pept        complement(363617..365614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0315"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: ade:Adeh_0289
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24531"
FT                   /db_xref="GOA:A7H735"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:A7H735"
FT                   /protein_id="ABS24531.1"
FT                   /translation="MPSASRDLVEKAVNTIRMLSADAVQQANSGHPGMPMGAADMAFVL
FT                   WTRHLRFDPRQPRWIGRDRFVLSAGHGSMLLYSLLHLAGFDCTVEDLKKFRQLHSRTPG
FT                   HPEFGYLPGVEVTSGPLGQGFANGVGFALGQAMLSAKLGPGNPLEDHFVYAIVSDGDLM
FT                   EGVAAEAASFAGHNALGRLVYLYDDNEITIDGHTSIAFTGEDVTERFEGYGWHVQEVDG
FT                   RDHDGIDRAIQAAKAELGKPSLIRVRTTIGFGSPGKAGKSSAHGAPLGEAELAATKKNL
FT                   GWPEEPRFLVPDDVRALWREVQAEKAKQVEAWREKERAWRQANGEKAALLDVHVDRWVP
FT                   ERILERVLDGAAGAEATRKLSAATIQKIAPLVPCLVGGSADLAESNLTDIKGGGSFSPS
FT                   TPAGRNVHYGIREHAMGAIANGLAYDGLHIPFTGTFLQFADYMRPTVRLAALSGLQNVF
FT                   VWTHDSIFLGEDGPTHQPVEHLTALRAIPNLHVCRPCDGDEVAVAWAHALTRRNGPTAL
FT                   ILSRQKIAPVKRDGDFDPEAALRGAYVVAAPEGARFSILATGSEVALAQAALEVLAQKG
FT                   LRGRLVSVPCLACFEAQPKAWQDQVLPPGLPAVALEAARGLEWWKHVGKDGLVLGIDRF
FT                   GASAPEKALAEEYGFTPAQIAGRIESWLAR"
FT   gene            complement(365909..366358)
FT                   /locus_tag="Anae109_0316"
FT   CDS_pept        complement(365909..366358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0316"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: ade:Adeh_0292
FT                   putative phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24532"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A7H736"
FT                   /protein_id="ABS24532.1"
FT                   /translation="MTVAGRVYLVRHADAEPRTTTDEARRLTPPGRARFEVHARALSPS
FT                   LALVAIRTSPFVRAAETAALLAAATGASSAEDPALASGASSGGDLLSLARRAPAGTALV
FT                   GHNPELAQAVALAAGRDLPVPPGTVAALDVAADGTVALAWIRPPP"
FT   gene            complement(366355..369396)
FT                   /locus_tag="Anae109_0317"
FT   CDS_pept        complement(366355..369396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0317"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /note="TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: ade:Adeh_0293
FT                   malto-oligosyltrehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24533"
FT                   /db_xref="GOA:A7H737"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A7H737"
FT                   /protein_id="ABS24533.1"
FT                   /translation="MASAAETAATERVALAAELVEALAQEAARGEGSTRRPASTYRLQL
FT                   HGGFGFEDAARVVPYLHALGVSDLYVSPILEAAPGSTHGYDVVNHGRLNPELGGEEGFL
FT                   RLAGACAQRGMGILVDFVPNHMGIGPRNAWWMDVLENGPSSVHARAFDVEWRPLKAELG
FT                   HKVLVPLLGDQFGKVLERGELQLAREGGALVVRYWDHVFPVAPRSVPQLLRHRLDELRG
FT                   ELGPGDVHYQELESICVSLEKLAPRTDTSPQAVADRAREKEVAKRRLASLCEASPRVRA
FT                   FVDENIRIFNGRKSERRSFDLLEKLLEGQAYRLAFWRVAGEEINYRRFFDVNALAAIRM
FT                   EEPRVFQEAHRLVLGLLRDGRISGLRIDHPDGLYAPPAYFRRLQASYLVERARALAARR
FT                   GTPLEPDTEALVLERVFEALEAGRLPPRPLYVVVEKILIAPERMPDGWDVDGTTGYEFL
FT                   AAVNGLFVEPEAERAFDGMWARLSGRREQFADVVADKKRLVMSSSMAGEVNMLAHRLNR
FT                   ISEMNRRTRDFTLNELTRALVEFVALFPVYRTYVTRRGEVDDRDRALVERTIARARRRS
FT                   PVVDPSIYDFLRDVVLQRYPEELTEDERREWLELTLKLQQITGPVTAKAVEDTAFYTYV
FT                   RLVSLNEVGGEPRHFGTTPEEVHGLLSERQARFPGSLSSTSTHDTKRSEDVRVRIDALS
FT                   EIPTEWRAAVLRWHRMNRAHVGGEGGGAPDRADELLLYQTLVGALPDGGVTPGTRAHAD
FT                   FVGRIQGYMEKALREAKVHTSWTSPNEDYEAGVRTFVERILASPAFLADLGAFSARVAA
FT                   VGRLSSLAQVAVKCAAPGVPDVYQGCELWDLSLVDPDNRRPVDYALRAQTLEALRADLA
FT                   RGPAARRDLARSVSAPETLADGRAKLLLLHAALHARREQRELFLAGDYRPAHAEGPHAR
FT                   SVFAFARAHAGNGGRAALCVVPRLVLGLLEAGGGRIRWEGALEVPHGLPRRWRDVVTGA
FT                   RREGDALPLAELFEDFPVAVLVSE"
FT   gene            complement(369380..370960)
FT                   /locus_tag="Anae109_0318"
FT   CDS_pept        complement(369380..370960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0318"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77; KEGG: ade:Adeh_0294
FT                   4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24534"
FT                   /db_xref="GOA:A7H738"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A7H738"
FT                   /protein_id="ABS24534.1"
FT                   /translation="MPRQAGVLLPLFSLRSARDWGVGEIPDLVPFGRWCAGAGFSIVQV
FT                   LPVNEASRGQHSPYAALSAFAIDPVYLALGGLEDFEAAGGEEALSSEDRERLARVRAAP
FT                   SVRWNEVRALKRRALELAFARFERDEWSRGTARARALEAFARAEAAWLDDYALFVAIHD
FT                   DALGGRAWMDWPEQLRERAPEALAEARARHSRTILFYTWLQWQLEEQWHAARRAANEAG
FT                   VELAGDLPFMVATDSADVWARRGDFRLDARVGVPPDAFSATGQDWGLPVYRWDAMEREG
FT                   YPWLRERARRMADLYGLYRVDHVVGLYRTYFFPNDGSPPAFVPEGEEAQTKNGERVLGL
FT                   FSAGARVTAEDLGTVPDFVRESLRRIEVPGYCVLRWERHWHVPDQPFRDPRTWPALSVA
FT                   TTGTHDTDSLADWWDGMPDDERAALLALPGLAGLRAREKAFYDDAVRDALLELVYAAGS
FT                   ELLLLPFQDAFGLRDRVNVPGTVTAENWTYRMPRHLGALAADLGARDRLRDLAARSGRL
FT                   VGSTGGERG"
FT   gene            371115..372128
FT                   /locus_tag="Anae109_0319"
FT   CDS_pept        371115..372128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0319"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: glutamyl-tRNA synthetase class Ic; KEGG:
FT                   ade:Adeh_0295 glutamate--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24535"
FT                   /db_xref="GOA:A7H739"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:A7H739"
FT                   /protein_id="ABS24535.1"
FT                   /translation="MTLEAGREALTHTPLRRGRFAPSPTGPLHLGNARTALLSWLAARA
FT                   LGGRYALRVEDLDAPRVRPGMEPRILDELRWLGLDWDEGPDVGGPAGPYRQSERLERYA
FT                   AALERLRAAGHVYPCFCSRAEIAASAQAPHGPSDDGPRYPGTCRALSAAERAERARTRA
FT                   PSWRFRVPHGPVAFDDGVHGPRTADVLATVGDFVVARADGVPAYQLAVVVDDAAMEVTE
FT                   VVRGDDLLPSTARQLLLYRALALAPPRFAHVPLVVGEDGERLAKRHGALSLGELREGGA
FT                   APDAVTGLLAELSGLTPPGVRCRPSDLVAGFSLARLPRAPAALAAARVAALLDGEA"
FT   gene            complement(372129..372668)
FT                   /locus_tag="Anae109_0320"
FT   CDS_pept        complement(372129..372668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24536"
FT                   /db_xref="UniProtKB/TrEMBL:A7H740"
FT                   /protein_id="ABS24536.1"
FT                   /translation="MHVRTVVVVVAMATLARAGTARAAVSLGLEATLGAEQLGVQRAPG
FT                   SNEPLAQMGQLGGTVLLRVGSLAVGAAAGGYFDGSRLERYDASGLAGLAFDVLPLLRLE
FT                   LLGELGAASLRSREDLGAAVAGEWSTFYGARPGVSLKIPAFPLRLGVWGLARWGLPGTP
FT                   SGEPALGMLGRVGVEF"
FT   sig_peptide     complement(372597..372668)
FT                   /locus_tag="Anae109_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.977 at
FT                   residue 24"
FT   gene            372789..373352
FT                   /locus_tag="Anae109_0321"
FT   CDS_pept        372789..373352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0321"
FT                   /product="tRNA--hydroxylase"
FT                   /note="PFAM: tRNA--hydroxylase; KEGG: ade:Adeh_0296
FT                   tRNA-(MS(2)IO(6)A)-hydroxylase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24537"
FT                   /db_xref="GOA:A7H741"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A7H741"
FT                   /protein_id="ABS24537.1"
FT                   /translation="MILRSATDPRWLPVALAELRATLADHAHCEKKAAASALKLVADHA
FT                   DRPDLVHSLARLAQEELQHFLAVLAEMARLGVPLPSDEGDPYAQALLRRVRGGPGRLAD
FT                   RLLVAALIEARSCERLGLLAAALEDPRLRELYARLAQSEAGHERLFVELARRHGAGDVE
FT                   ARLAELAADEAHIVAGLPLLPRIH"
FT   gene            373546..374589
FT                   /locus_tag="Anae109_0322"
FT   CDS_pept        373546..374589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0322"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   nha:Nham_1928 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24538"
FT                   /db_xref="GOA:A7H742"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H742"
FT                   /protein_id="ABS24538.1"
FT                   /translation="MKALVYHGPGKKAWEEKPKPTIKGPTDAIVKVLKTTICGTDLHIL
FT                   KGDVPAVTDGRILGHEGVGVIEEAGPAVTNFKKGDRVLISCITSDGKCEACKKGMYSHC
FT                   ANGGWILGHLIDGTQAEYVRVPYADTSLYAVPRGADEGALVMLSDILPTGFEVGVRNGA
FT                   VKPGDSVAIVGAGPIGLAALVTAQFYSPAELIMVDLDDNRLEVAKRLGATRAVNSGDGK
FT                   AVEKVMALTGGKGVDVAIEAVGIPATFDVCQDIVAAGGHVANVGVHGKSVSLKLEKLWI
FT                   HNVTITTGLVDTNTTPMLLKTVVAGRLAPRELITHEFALDDVMKAYETFGNAAKERALK
FT                   VLIQAAG"
FT   gene            complement(374650..375693)
FT                   /locus_tag="Anae109_0323"
FT   CDS_pept        complement(374650..375693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0323"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ade:Adeh_4103 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24539"
FT                   /db_xref="GOA:A7H743"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7H743"
FT                   /protein_id="ABS24539.1"
FT                   /translation="MNAFKPHLAAVADYPYAKVDARVKLDQNESPEDFPPELKARALAR
FT                   LAALSWNRYPELHAEDVRAALSRHEEWPEEGIVVAPGSNLLVLALAQGARSVLDTVPAF
FT                   PYYKGGAVAAATPYRSVPLGEDFALPADALLAAMDGPPGVLFLPNPHAPTGRLFESGDV
FT                   ERLAARARERDWLLVVDEAYHAFAGTDARPLARANPNVAILRTFSKSWCLGGIRAGYLL
FT                   GAPRVASIVRALVPPFCIPAHTGAILLTALEAPAAFAPIHQRIRAERARLFSGLSAHPT
FT                   WRPYPSAANYLLVRTPDAKAAFDGLVARGILVRRQDHYPGLEGCIRISVGTPAENDALL
FT                   AAAAGTR"
FT   gene            375884..376198
FT                   /locus_tag="Anae109_0324"
FT   CDS_pept        375884..376198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24540"
FT                   /db_xref="GOA:A7H744"
FT                   /db_xref="UniProtKB/TrEMBL:A7H744"
FT                   /protein_id="ABS24540.1"
FT                   /translation="MTKNSKVPALVGAGVGLALFLAVALLPALLYGGYAGVMLAGGIFG
FT                   TPVSASFAARALIIFGMVLGVTAVGSLFAVAGAAAGAAVGALIGLAPAEAKKAAEKAKA
FT                   "
FT   sig_peptide     375884..375958
FT                   /locus_tag="Anae109_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.503 at
FT                   residue 25"
FT   gene            376391..377433
FT                   /pseudo
FT                   /locus_tag="Anae109_0325"
FT   gene            377638..378036
FT                   /locus_tag="Anae109_0326"
FT   CDS_pept        377638..378036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0326"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   reu:Reut_A0176 protein of unknown function DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24541"
FT                   /db_xref="GOA:A7H745"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A7H745"
FT                   /protein_id="ABS24541.1"
FT                   /translation="MVPVQAGVNATLARHAGRPEWAAFVSFAVGLAGLAAYVVVLRVRP
FT                   PPLAALAAAPPWSWTGGLLGAFYVTAIVILTPRIGFTLALALTLAGQMIAALALDHAGA
FT                   LGLATRPVTAPRLVGAALLFAGVLLMRR"
FT   gene            complement(378112..379215)
FT                   /locus_tag="Anae109_0327"
FT   CDS_pept        complement(378112..379215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0327"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   ade:Adeh_4101 arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24542"
FT                   /db_xref="GOA:A7H746"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A7H746"
FT                   /protein_id="ABS24542.1"
FT                   /translation="MNAIDALGRLLRPAGGGVHLVSTGKAEQLALQRRLYGAADDAIVR
FT                   ARWREELARAAGARAVLLGIPSDAGGGFQRGANLGPSAIRARLLEEDPGWPARARAAGL
FT                   VDLGDVFVVPQLLEDEMLSDAQRAATARALYPDLEPAERAAWPVSPLSIAERALSLVLA
FT                   ANPAARVFALGGDHSAAWPVVKALASVRAGIGIVQVDAHTDLLPERLGIRTCFATWSYH
FT                   ANDLLGRGGRLVQVGTRASGHDRAHWESTLGVRQFWAEEVRADPAAALEAIVAHVRATG
FT                   VSAVYFSNDIDGTDASFADATGTPEPGGLAPEFVSALVARLGREVGLAGGDVMEVAPYV
FT                   ARSAGGGPRTVALAARYLRETVDAALG"
FT   gene            complement(379274..380866)
FT                   /locus_tag="Anae109_0328"
FT   CDS_pept        complement(379274..380866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0328"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: ade:Adeh_4097 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24543"
FT                   /db_xref="GOA:A7H747"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A7H747"
FT                   /protein_id="ABS24543.1"
FT                   /translation="MARKQATAKARTGKATARKQPSVKAAGTPAIELAADALALPVYEE
FT                   DVRAGGRGRVKALDALLGGALAAAVKAERFAGKAGQELSLPTLGRAPAGRVLLLGMGPR
FT                   GKAEAWPSTGFEPLRHAAGKAARAAAKAGARALAVALPEDGVEDVAGAARALAEGALLG
FT                   AYAFERYKSEDDARRTPLAELTVAVPAGAERRAELRDALELAREIGAAVAWARDLVNLG
FT                   PADCTPTLLAEQAEALAREARLAVEVRGPKEIAALGMGMFLGVTRGSSEPARLVTLSWI
FT                   PRGAAAKKPPVVLVGKAITFDSGGLSLKPTESMVTMNTDMAGSAAVLGAMRVVARLAPP
FT                   FPVHAVLGACENMPGGKAYKPSDVLVSYAGKTVEITNTDAEGRLVLGDVLAWAAQTWNP
FT                   ALMVDVATLTGACMVALGHTTAGLFGPDGAAVDGLLAAAGASGEELWRLPMTESLKEQL
FT                   KSDRADLKNTGERWGGAIAAAHFLHAFVKDVPWAHLDIAGPSHAPKERGYVAKGGTGFG
FT                   VRTLVELVRAHRP"
FT   gene            complement(380986..382833)
FT                   /locus_tag="Anae109_0329"
FT   CDS_pept        complement(380986..382833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0329"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; PBS lyase HEAT
FT                   domain protein repeat-containing protein; KEGG:
FT                   ade:Adeh_4096 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24544"
FT                   /db_xref="GOA:A7H748"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A7H748"
FT                   /protein_id="ABS24544.1"
FT                   /translation="MSAAEHPPAGGRFEPESLLGLVLDGRYELAAHLATGGMGAVFRAR
FT                   HVHLRKDVAVKVLRPDLSSSPDLVERFRREAEIASALEHDNIVRVTDFGRSPDGWLFLV
FT                   MELLCGESLFDRIRRDGCLSPEEAVPILWQVCAGLEAAHALGVVHRDLKPENVFLARTA
FT                   SGREVTKLLDFGIAKIADPASGASTQAGVVVGTPEYLAPEQALGGEVDARADLYAVGLI
FT                   AWRVLGGRHPFKADEPRALLMMQATRPVPPLTDPRPDLGAYPALVAAVARACAKEPDER
FT                   HPSASALRDDLGGSLGPAFVLPPNATPSPAISLSATPPARAPDPVGVADTRAALPPVRT
FT                   APIASSTLSLEAARLAGRARTLARSAARRARAAVRELGAHPRVVAAAAVAALLALTLAL
FT                   ALGWSRGRTAAEARSLLAGGRPGAALALLDRALAERPDDGELLLLRARALHLTGADAAA
FT                   LSAFAAARARGSLDDPARADLVAALAADRATADRAHRLLLEEGEAAVPAVLRAAREGAP
FT                   SQRLRALHLARDLGAEERLDRAAAYGALLDVPDCEVRREAAERLGEIGDRAALPALRRA
FT                   ALATVETKGFFGMTRRAQACGSAEAAAAARRIEAAARSP"
FT   gene            complement(382960..384126)
FT                   /locus_tag="Anae109_0330"
FT   CDS_pept        complement(382960..384126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0330"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ade:Adeh_4095 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24545"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A7H749"
FT                   /protein_id="ABS24545.1"
FT                   /translation="MRSDRLSIAYVHYGAQSGVTDQVARALGTRGHDVRLVEATGDLEP
FT                   RHPVTGRLRPRPAVALTLAAAAARFGVGRSALEHRWNTPFAFDRHSLRAGEALRALDPP
FT                   PRLVLQNGALFAPGLPAPFPYALLLDHTRALAMRGPPCPAAGLAAPLDYGEGWLARETA
FT                   LYRRARVLATFSANVARSLVSDYGVDPACVRVVGAGANVFPGAAPRQDDGRTILFVGRD
FT                   FPRKGGHVLAEAFARLRRTEPRARLLVAGPPAAPPLPVGAHWLGPVELDELPALFAQAT
FT                   VFALPTLREPFGLAFLDAMACAVPCVGTAHEAVPEIVGDAETGLLVPPGDADALAEALR
FT                   RLLAEPERARVMGARGRERVAAGFLWSHVAERLERALLDAISSHGKAA"
FT   gene            complement(384298..384666)
FT                   /locus_tag="Anae109_0331"
FT   CDS_pept        complement(384298..384666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0331"
FT                   /product="GTP cyclohydrolase I"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: ade:Adeh_4094 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24546"
FT                   /db_xref="GOA:A7H750"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H750"
FT                   /protein_id="ABS24546.1"
FT                   /translation="MPTKPARDLQTFPNPKPDRPYEIAMECPEFTCVCPVTGQPDFATI
FT                   RLRYVPAERCVELKSLKLYLWSFRDEGTFHEAVTNRICDDIVQAIAPRWIEVVGDFAVR
FT                   GGIHTVVTARHGERPAGV"
FT   gene            complement(385218..386969)
FT                   /locus_tag="Anae109_0332"
FT   CDS_pept        complement(385218..386969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0332"
FT                   /product="oligopeptide transporters, OPT superfamily"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   PFAM: Oligopeptide transporter OPT superfamily protein;
FT                   KEGG: ade:Adeh_4092 oligopeptide transporter, OPT
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24547"
FT                   /db_xref="GOA:A7H751"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A7H751"
FT                   /protein_id="ABS24547.1"
FT                   /translation="MRELSPSTDLPNLVAPKRELTARAVAIAILVAALMGAAEPTVVLR
FT                   IGYGPNMSVVSAFLGFIVITLIGKLTGRRGTRFENNLVQTAGTAAASGVGFMAVVLAAI
FT                   DMLNQRGLMNLHLSSLQIFAWLAPSGLLGVLLAVPLRKHYIDQENLPFADGTAAGETLL
FT                   VLDEGPKQAGPRVAALGIGGAISVGFTVLRQGFKWIPDTIAFGFLTPHAEALRLGSEVG
FT                   VLSLGAGILVGLRVTLSMGLGMLLGWIVAPDRLFARGLVPELTFNAILQRWIMWPATGL
FT                   MVAGGLTALVLKWKVIAKTFHGLSGKEADTSGDFPMRWVVWGALGCAVVLAAVQKISLG
FT                   FPIWLSAVSVLLSIVLMLVGIRVLGETNWAPISAMANVMQAVFAVLAPGHVPINMVGSG
FT                   MSGAVAANGEHLMQDYRAGKIVGSTNRHLTYLQLIGVPIGAAAVAVAYPAVRAKYGIGG
FT                   EGGLTSPISVKWAGFAELLSQGFGALPSSALVALVVALVAGVVLTLLEASPRFGRYVPS
FT                   PTAIGLGALIPGFAVVPMVIGGVAQDLWRRLSPRTEDVYATPLASGFITGEALVLLFLA
FT                   LWAAVAG"
FT   gene            complement(387106..388743)
FT                   /locus_tag="Anae109_0333"
FT   CDS_pept        complement(387106..388743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24548"
FT                   /db_xref="GOA:A7H752"
FT                   /db_xref="UniProtKB/TrEMBL:A7H752"
FT                   /protein_id="ABS24548.1"
FT                   /translation="MTDSPLPRRAHSVEVMRRGNLLLYFTAAALAVTTAARLPASWASG
FT                   NALNHVSGAWMALAEDLAQGLLYRPLLDPAVGYGGTRWFPLAFVAHAGLRVAGLDLVTA
FT                   GYALSLAVGLLTVVAAYVLLRRVGVTAPVSAAFGVLTLGTYATQYALSSVRFDLLPVAL
FT                   GALGLAALAGGPSRRAVALAATLFVLGFASKPTALTAPAAAFAWLLVRRERRAAATLAG
FT                   AVAAGGIAVVAITDALSGGRFMEILAATASGGARLRDALAAPYRLAHHLAVADPAAIAL
FT                   LGAALAAALAGSRHHLRAARRGAAGPGLLPVLWLAAALAGALVVFASPGTDANHLAEAE
FT                   VAAALALGASWRARGTERRIARGLAPVACALGVVVAAGMARADLAGSRLAEARAVVAAL
FT                   PPGVVVSEDPLLPLVAGMRPFVLDPWMLRLAAERDPSLAGPLLEGLRRDEFPAVVLLQD
FT                   LDSAAARGWYARGNLGPAVVAEIAGHYRLAERHGPYHLYLPLRGTGGDSPVAAGPRAGG
FT                   RRRAQPDLGAIPARSREIPAAALERAAP"
FT   gene            complement(388748..390226)
FT                   /locus_tag="Anae109_0334"
FT   CDS_pept        complement(388748..390226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0334"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ade:Adeh_4090 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24549"
FT                   /db_xref="GOA:A7H753"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A7H753"
FT                   /protein_id="ABS24549.1"
FT                   /translation="MSDSILTRARPLLVARLAGAVLTLAVPMVLARVLLPESYGTFKQA
FT                   WLLMNTLALVLPMGMTMSLYYFVPREPADRDAHVAQALWFHLVLGAFAAALVLAGAPLV
FT                   DRQFHNPELTRAVPWIAAFTALQIAGAPLDIAWNASGRIGAAAVARLVTEVVRGAAILA
FT                   GALLGGSVEAVFAGITVAHLLRAAWTFVTLARAHGLRFSASALRRQAAYALPFGAAFLL
FT                   IVPQQQFHQYAVAAAVSAAAFAVYSVGTFQLPVVDILYTPVSELLQIGLAEVEGAGRPA
FT                   RAGLPLFHEAVLQLAFAFLPLVGLLGVVAPALIELFFSARYLDAVPIFRIGILSVALAA
FT                   LPLDGVMRARAQNRYMLALSVAKLGATVPLVLGGLRVAGPIGALAGWTFAEAVARVVML
FT                   HRAARLFEVPLSRVLPMRSLARQLAATAFAMAPAWVTMRALHAAPPAVRLAAACGAFAL
FT                   AYLGLSWARGWLPAGWLSLFSTRRARTAVAPSES"
FT   sig_peptide     complement(390131..390226)
FT                   /locus_tag="Anae109_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.894) with cleavage site probability 0.854 at
FT                   residue 32"
FT   gene            complement(390586..391665)
FT                   /locus_tag="Anae109_0335"
FT   CDS_pept        complement(390586..391665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0335"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: hne:HNE_2580 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24550"
FT                   /db_xref="GOA:A7H754"
FT                   /db_xref="InterPro:IPR004963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H754"
FT                   /protein_id="ABS24550.1"
FT                   /translation="MWRPERPFRPRAAFVAFAFAVVAALGACGGEDTAGAEAPAEALPR
FT                   NTWTWIDVPGTACGDGSQTGIAVNRGDGDEVLLFLDGGGACWDALTCFTLGLAKPGPFG
FT                   SAEFAARAADVPGTVLDRAAPGNPFARYTLVFVPYCTGDVHAGDEIQGYPGAPRRWHHK
FT                   GRVNVARAIDWLDANLGAPPKVVVSGASAGGFGALITFDAVRRRWPQARGYLVDDSGPP
FT                   LVRDDLSPAVRAAWFVSWRLDEVLLPLCGTACLEDLSAVFPVLSGKYPQDRLSLLSSTR
FT                   DSVIRSFVLLEPARFEDALLRLTTAVIAPLPNARTFLVPGSSHTLLGAPASFTAGGVRL
FT                   DEWLRQQVEDDPAWSSVGP"
FT   sig_peptide     complement(391576..391665)
FT                   /locus_tag="Anae109_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.892 at
FT                   residue 30"
FT   gene            complement(391736..392722)
FT                   /locus_tag="Anae109_0336"
FT   CDS_pept        complement(391736..392722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0336"
FT                   /product="Quinone oxidoreductase putative PIG3"
FT                   /note="TIGRFAM: Quinone oxidoreductase putative PIG3; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: ade:Adeh_4084
FT                   zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24551"
FT                   /db_xref="GOA:A7H755"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H755"
FT                   /protein_id="ABS24551.1"
FT                   /translation="MKAVLFDGKGGPEIVRFAETSDPAPARGEVLVRVRAAALNRADLL
FT                   QRRGLYPPPPGTREDIPGLELAGEVAAVGAGVTAWKAGDRVMAIASGEAQAELAVAHER
FT                   MLVRIPDALSSEDAAAIPEACVTSHDALFTLGGLRPGWPVLVHAIGSGVSTAALQIAKA
FT                   AGATVIGTSRTADKLERARALGLDHGILVAKDEPRFAEEVRRLTGKRGCPLVLDFVGAP
FT                   YAAENLAALASGGRVVVIGTMGGPKAQLDLGLLMRARGAIVGTVLRPRPLEEKIAATQA
FT                   FARDVLPLVAAGAVKPVVDLVLPAERAREAHERMERNESFGKLVLTF"
FT   gene            complement(392719..393150)
FT                   /locus_tag="Anae109_0337"
FT   CDS_pept        complement(392719..393150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24552"
FT                   /db_xref="UniProtKB/TrEMBL:A7H756"
FT                   /protein_id="ABS24552.1"
FT                   /translation="MQARILRFALEDLRARYAGASAEGLDPRTDTAPFRAFRAALLELA
FT                   ARAATAPAELSMWWDGTYNGYSLAVAIVPLDALAGLDPTSACPPDDERVAVPRADRYPL
FT                   AHVEPGRAVVARDADGASFEAPFGAPAGHFGAPGMRRVA"
FT   gene            complement(393197..394525)
FT                   /locus_tag="Anae109_0338"
FT   CDS_pept        complement(393197..394525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_0984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24553"
FT                   /db_xref="GOA:A7H757"
FT                   /db_xref="UniProtKB/TrEMBL:A7H757"
FT                   /protein_id="ABS24553.1"
FT                   /translation="MRLGEREPADRLVRPWSLWAAGAAILASLVALAARDPGRGTPAFF
FT                   VLVGFASAGYLLAMMALARGRHPSPRALVALALLAFGWRLPLLLAPTHPDADMTRYVWD
FT                   ARTVRAGLSPYAVLPADPSVAHLRTAESWPVNNPDVPSPYAPAAQLFFLLATTPGETAL
FT                   AVKTALVACEALLALALWRWLLAVGAGPAWILAYLWNPLVAFEIAREGHVDALGALLVA
FT                   LAALALARRRTLAGSVAFVLALAVKPLPVVLAPLLWRRVSLRDAAVGLSVLAALYLPFW
FT                   LGGDPALGSVPAIVQRFRFNGPVFQAAAAASTPAIAGALAVGAGLAVAAWARARLPATS
FT                   PAAWAWPLGAALLCAPLVYPWYLVWLTPFLVARATLPLLVWTLSIQATDVVWHRPPGAP
FT                   WAVPRWALVVEYGALAAAAAWAWWSARREVAAREPTGAARDGT"
FT   sig_peptide     complement(394424..394525)
FT                   /locus_tag="Anae109_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.934 at
FT                   residue 34"
FT   gene            complement(394850..395647)
FT                   /locus_tag="Anae109_0339"
FT   CDS_pept        complement(394850..395647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0339"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ade:Adeh_4082 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24554"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A7H758"
FT                   /protein_id="ABS24554.1"
FT                   /translation="MIRKIVQIDEARCDGCGQCIPSCAEGAIALVNGKARLSADVLCDG
FT                   LGACLGECPQGAITVIEREAADFDEAAVKAHLARARAPAQEPAPPALAAVAPPAPARPR
FT                   LSIVSDPAPSAGGGCPGSRPRTLTPRPAGPQRVAAGMASAQSRLGQWPVQLHLVPVTAS
FT                   YFQGADLLVAADCVPFAYAGFHDELLAGRAIVVGCPKLDDNDFYAEKLTAILTQSDVRS
FT                   VTVARMEVPCCGGIAMAARHAVAASGKKLPLTDVVVGVDGAVR"
FT   gene            395847..396605
FT                   /locus_tag="Anae109_0340"
FT   CDS_pept        395847..396605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0340"
FT                   /product="heat shock protein DnaJ-like protein"
FT                   /note="KEGG: ade:Adeh_4081 heat shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24555"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A7H759"
FT                   /protein_id="ABS24555.1"
FT                   /translation="MTKTAEITVEQLVRAGRVLFGASFAPESSTWRPALRDAYRRRALE
FT                   THPDRARALGRTEAELAREFGRVADAYRLLSALAAATPARVAPRRGSATARAPVRPSQP
FT                   PRAAPRAAPPPPVASARHGGLPRRRLRLAEFLYYSGRVPWSAFVAAIAWQRAQRPPLGR
FT                   IAVDLGFLAREDVGAILARRRADAATAERFGEYALRRGFLTRLQLLAAVGRQGRLQRRI
FT                   GEYFVESGWLDLRALDAARAELLGHNARFR"
FT   gene            complement(396622..397266)
FT                   /locus_tag="Anae109_0341"
FT   CDS_pept        complement(396622..397266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0341"
FT                   /product="protein of unknown function DUF938"
FT                   /note="PFAM: protein of unknown function DUF938;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ade:Adeh_4080 protein of unknown function DUF938"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24556"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H760"
FT                   /protein_id="ABS24556.1"
FT                   /translation="MDAALARASRRVHDARVKRTAAAALRNREAIASALRRILPARGLV
FT                   LELGSGTGEHAVHLARAFPALEWQPSDPDLEARASIRAWSAEAGLANLLAPLAYDVRLP
FT                   AWQARPADAVLCVNVLHVAPPECAEALARGAARVLPPGGPLVVYGPFRRRGAPLEGRLA
FT                   RLDAQLRAHDPALGVRELEGLAELAARYGLALGEVVAMPEEGDLLLVCRRA"
FT   gene            397335..398546
FT                   /locus_tag="Anae109_0342"
FT   CDS_pept        397335..398546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24557"
FT                   /db_xref="UniProtKB/TrEMBL:A7H761"
FT                   /protein_id="ABS24557.1"
FT                   /translation="MTTPRRATRAGAPARPALCVPLALALALVASLALGACAGRRGGAE
FT                   PAPARQRFELPGHGAFEVTVPQSWKATTGEGEEPMPLTVRLQPREPERPPFIVLLTPFW
FT                   NPRSPGGAAPEAPAAPDELGADAQGDTAQLLAELARRKALATSAEKEIALQELRGEAGV
FT                   HGYWFEATDRALAGKEPGEGEWRHLLQGAAAVGDMILAFTLLDNGPGPQREAVLELVRS
FT                   ARQLKATPAERGAPADDGPMRFTPDPDAETEPLSVAYPGRSFAVLVDLPGFEMFAPRPA
FT                   EGGEGVLVLGQHPALGLVASVTLRDAQGAADARACRERTLERIRRSAPELKELALAEAD
FT                   GAARAAYVLDELRGRSIRQQHAHLFLWREDVCVNVQVSKADPEPEDPGRIEAILASVRF
FT                   GATL"
FT   sig_peptide     397335..397442
FT                   /locus_tag="Anae109_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.355 at
FT                   residue 36"
FT   gene            398554..399321
FT                   /locus_tag="Anae109_0343"
FT   CDS_pept        398554..399321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0343"
FT                   /product="acyl-ACP thioesterase"
FT                   /note="PFAM: acyl-ACP thioesterase; KEGG: ade:Adeh_4078
FT                   acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24558"
FT                   /db_xref="GOA:A7H762"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A7H762"
FT                   /protein_id="ABS24558.1"
FT                   /translation="MEKHRQTFGVHTYEVDAFGTVAIAALSGYLQEVAGQHAAALGVGL
FT                   EVLMPRGLTWVLARQRIENPVPIVLGDRLEIETWPAGIDRLAALRDFVVRRADGTEVAR
FT                   ATTQWFVLDLESRRPVKPAEVLDPRFQRELLPPILPLAPGKLPELRSWEFQKRFHVRYG
FT                   DIDVNMHVTNTSYPTWAQEVVPREVFRGQRLASVEVHFLAEAHYGSAILSRLASTGEGA
FT                   FAHAIVREEDEKELARLATRWVPRAAPAVPGAR"
FT   gene            complement(399604..400170)
FT                   /locus_tag="Anae109_0344"
FT   CDS_pept        complement(399604..400170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0344"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   ade:Adeh_3934 HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24559"
FT                   /db_xref="GOA:A7H763"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A7H763"
FT                   /protein_id="ABS24559.1"
FT                   /translation="MNVALLTRFEAKRAPTSAARREHAPRERRQGTVCASGAPRGRRRG
FT                   EAIRCAIEKHGKRKGAVLPQRQRKADRDPRPSAEPAAPTSTIPAIVRREVWKRDGGRCA
FT                   WVAPDGRRCNSRWQLELDHIQPQALGGPSTVENLRVACKSHNMLHAEQTYGREHMDRFR
FT                   RESVSERTGHAGTAPAAIQQGLYAT"
FT   gene            400237..400686
FT                   /locus_tag="Anae109_0345"
FT   CDS_pept        400237..400686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PFD0740w Plasmodium falciparum protein
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24560"
FT                   /db_xref="UniProtKB/TrEMBL:A7H764"
FT                   /protein_id="ABS24560.1"
FT                   /translation="MPLDSCATFLGPAPPAPQSSRRRRRRPARVTREARPEPSASPLDA
FT                   RAPSAYGRRHTTCPNARAVAVGCDESRGPDPDPDRDRDRDRDRDRDRDPDRDRDPDRDP
FT                   DPDRDRDRDRDRDPDRDPDRDPDPDRDRDRDPDRDRDRGHPERSR"
FT   gene            complement(400725..401264)
FT                   /locus_tag="Anae109_0346"
FT   CDS_pept        complement(400725..401264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0346"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ade:Adeh_4077 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24561"
FT                   /db_xref="GOA:A7H765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H765"
FT                   /protein_id="ABS24561.1"
FT                   /translation="MKTALDALSIWAIPLLLAGVPAVALARGVKVYPAFVDGAKQGFET
FT                   AVRIIPSLVAILVALGMLRASGAMDSFAALLAPLSEAAGVPASVVPLVLVRPLSGGGAL
FT                   GVVADVLRAEGPDGYAGRLVSVMAGSTETTFYVLAVYFGAIGVSRYRHALPAALLADLA
FT                   GFAAAVVAVRLVFGAG"
FT   sig_peptide     complement(401184..401264)
FT                   /locus_tag="Anae109_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.710 at
FT                   residue 27"
FT   gene            complement(401485..402090)
FT                   /locus_tag="Anae109_0347"
FT   CDS_pept        complement(401485..402090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0347"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ade:Adeh_4076 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24562"
FT                   /db_xref="GOA:A7H766"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A7H766"
FT                   /protein_id="ABS24562.1"
FT                   /translation="MGVIWTVLVAVAVVAAAVNGRMAALTPAAMESAGKAVTLSIGLAG
FT                   AMALWLGLMRVAEEAGLVRALARAARPVMRRLFPEVPPEHPAMGAMLMNLSANLLGLGN
FT                   AVTPFGVKAMQALETLNPRPGTASNAQALFCAMNTASVQLVPASVIALRAAAGSRAPAE
FT                   ILGATILASVCGATAAILTAKLLARATPEAAPAEGEPC"
FT   sig_peptide     complement(402019..402090)
FT                   /locus_tag="Anae109_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.945 at
FT                   residue 24"
FT   gene            402167..403699
FT                   /locus_tag="Anae109_0348"
FT   CDS_pept        402167..403699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0348"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ade:Adeh_4075 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24563"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H767"
FT                   /protein_id="ABS24563.1"
FT                   /translation="MRSHRLATGVLAALALSVTACPEQRGGQAKPPRPPRGELAAGAAA
FT                   LPDALSVPRPPGPEWFGLYLVGKKAGFTKVQLSRELRDGRDVLVGRSETLVRATVGGKT
FT                   VERRAEEERVYEARHQGPLLAVRSVWAGDGGDRTVSGTCARAVCKLVEETAAGRQERTV
FT                   EGVTETAELADGVRLAAARRGAVRGRQLDLEKLRVKEMQDVFLRRETIAGGGVQEQVSV
FT                   VAESEAGDRLAAEYRVADDGRIVEIRLGEAIVARPEPEDVARSLEQVDLFALARVAVPR
FT                   PLPRTVPTTITFRLAGLPPSFQKGDARQRFARGRSGETVLSVTARRPLAADPARDTPLA
FT                   LARKGASADDLAATPQADADSAAIAALAKKIAGDAPGAYAAAQLLADDVYRRLEKAYGA
FT                   SHDRASEVLAAGRGDCTEHTVLLVALARALGIPARPVHGLVYARYEDGQDALYWHAWAE
FT                   VRSAGEWIAMDPTFGQPVADATHVALGVGTQVDTVGLLGALKVLGVEVKAGR"
FT   sig_peptide     402167..402229
FT                   /locus_tag="Anae109_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            403805..404209
FT                   /locus_tag="Anae109_0349"
FT   CDS_pept        403805..404209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0349"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ade:Adeh_4074
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24564"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A7H768"
FT                   /protein_id="ABS24564.1"
FT                   /translation="MNGLDHVAILVADLDAAIRLYRDVYGLELAEVEEVPTEKVRVAIF
FT                   GHGAGRIELVSPSGPDSPMAKAIEKRGEGLHHVCLEVPDIEQAMAALRAQGAPLLDEKP
FT                   RPGAGGSKVAFVHPKGSRGVLVELKQGGGY"
FT   gene            404458..406299
FT                   /locus_tag="Anae109_0350"
FT   CDS_pept        404458..406299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24565"
FT                   /db_xref="InterPro:IPR030884"
FT                   /db_xref="UniProtKB/TrEMBL:A7H769"
FT                   /protein_id="ABS24565.1"
FT                   /translation="MSRLLAALAAFLLIAGAARAQDAKKAEESKDAAVPAAELPPETRA
FT                   AIEREVARLKEELRDEVRAEIQGAQAAAEFMGAVAEGPKLEFLELDGYYRVRGHLFDDF
FT                   DLGRRADATGHYIFPVPLKNPDPLTGASAGRATIATANMRLRLEPTMNVSELVRVRAQI
FT                   DVLDNYVLGSSASRLFDDPASPYAVPFYGSTRQLYPGDPTADRDPVLPKRVWGEVQTPV
FT                   GLLSFGRMPSEWGLGVLTHAGGGVDDDYGDTVDRIQFALPPVQTPIGALTLVPILDFEA
FT                   EGALRADPRFGTGIGQPFDAESSDDARTWSLKAARVDTDDEIRRKLERNESSFNFGAYY
FT                   SYRSQDDVVPAWLAEGYGADLDPPSAVALGNRDTSAHVLDLWARVLTSRWRVEAEAVGV
FT                   YGEVGQVFTVGPAPSYAVTGVTSVDLRQWGGALLTEYKAIPNKVTLGGELGVASGDDAP
FT                   GFGNVPSRANPDFAYGVLEGPQFDPDGGATDQSIRNFRFNPAYRVDLILFSRILGQVTD
FT                   AWYLKPKIRWDIFPGLAFDGQLVYSQAINSESTPSAIGPGTGSRPLGLELDGTFTYTSG
FT                   AGFQAYAQYGILQPFDAFGPGDLSRPQMLAVGLVAKF"
FT   sig_peptide     404458..404520
FT                   /locus_tag="Anae109_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(406381..406785)
FT                   /locus_tag="Anae109_0351"
FT   CDS_pept        complement(406381..406785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0351"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: ade:Adeh_4072
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24566"
FT                   /db_xref="GOA:A7H770"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A7H770"
FT                   /protein_id="ABS24566.1"
FT                   /translation="MASEMVVTLPGNKKIDTQIGKHVIRTDQPASAGGEDSAPSPFGLF
FT                   LAAIGTCAGIYVAGFCQKRELPTEGIRIRQRNHFDPETGVLARVELDIEVPPSFPEKYR
FT                   EALVRVADQCAVKKAIQAQPRFEVQTVVAG"
FT   gene            406893..408317
FT                   /locus_tag="Anae109_0352"
FT   CDS_pept        406893..408317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0352"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: ade:Adeh_4071 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24567"
FT                   /db_xref="GOA:A7H771"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H771"
FT                   /protein_id="ABS24567.1"
FT                   /translation="MLASPPPMSAKTKSKPVSRAALAGEADPRLVALSVSIQDDGALYA
FT                   EDIRGSQAHVTMLAEQGIVPKASARRIVAALDQVRAEFAAGKIRLDPALEDVHTHVERR
FT                   LGELVGADAGYLHAGRSRNDQVALDERLFIVAACERCDAALGRLQRALVARAREHEKTI
FT                   LPGYTHLQRAQPVSLAHHLLAHVEAFARDRDRLADVRRRAAVSPLGSGALAGTTLPLDR
FT                   EATAKALGLAGVTQNSLDAVSDRDSAIELLFACALAAVHLSRVGEEIVLWTTKEFGFMT
FT                   LADAFATGSSLMPQKKNPDVGELARGRAGRAIGDLVALLAIVKSLPLSYNRDMQEDKRP
FT                   LIGGPDALVLTADAVGGAIETATFHADRMEEALGSGEALATDAAEYLVERGVPFREAHE
FT                   AVGKAAAFSSAEGRPLAKLTADEWRRFHPAFQKDVLRCFDARKSLARRELTGAPGPRQV
FT                   ARQLARWEKALAKERR"
FT   gene            408607..409875
FT                   /locus_tag="Anae109_0353"
FT   CDS_pept        408607..409875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0353"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: ade:Adeh_4070
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24568"
FT                   /db_xref="GOA:A7H772"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A7H772"
FT                   /protein_id="ABS24568.1"
FT                   /translation="MNHFQRKKGVLHAEAIPLERLAERYGTPLYVYSTATLTRHWKVLH
FT                   RSLAGIRHVVCYAVKANANLALLARFAKLGSGFDIVSAGELYRVLKAGGDPRKVVFSGV
FT                   GKRDDEIAFALESGVRVLNVESAGELARISIVARRMGVRAPIALRVNPDVDPKTHPYIS
FT                   TGLRENKFGVSVDEARRLYPLAAKDEALHVMGIASHIGSQITTVKPFLDAIDRVLSLAR
FT                   ELEKQGIPLAHLDVGGGLGIRYKDEDPPHPDEYGAAIRKALARWKGEVLLEPGRVLVGN
FT                   AGVLVTRVLHVKRSGRKTFVVVDAAMNDLVRPAIYDAHHDIEPVGPPREGEREVVADVV
FT                   GPICESSDFLARKRRMPEPVPGDLLAVRSAGAYGFSMSSNYNARPRAAEVLVDGDQALL
FT                   ARRRETYADLVRGEEPSPSPERV"
FT   gene            409994..410881
FT                   /locus_tag="Anae109_0354"
FT   CDS_pept        409994..410881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0354"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: ade:Adeh_4069
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24569"
FT                   /db_xref="GOA:A7H773"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H773"
FT                   /protein_id="ABS24569.1"
FT                   /translation="MPRLEGSMVAIVTPMKDGAVDLRALRELTEWQIAEGTDGIVPCGT
FT                   TGEGATLTAAERAEVIRAVVEVARGRALVVAGAGSNATHEAIEGVKAAKALGADAALVV
FT                   TPYYNKPTPEGLYRHYTAIWEATRFPVVAYNVPGRTAVDMGPDTVARLAKAGAIVGIKE
FT                   ATASMDRQVQLVERIGKDAIAYLSGDDFTVVPYIACGGHGVISVISNIAPRAMKDLVVA
FT                   ARLGDFARALDLQVRMAELNRVMFVETSPGPVKAAVALLGRAGPELRLPLAPVSEASLS
FT                   KVREAMTRFGLKLA"
FT   gene            410914..411720
FT                   /locus_tag="Anae109_0355"
FT   CDS_pept        410914..411720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0355"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   dihydrodipicolinate reductase; KEGG: ade:Adeh_4068
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24570"
FT                   /db_xref="GOA:A7H774"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H774"
FT                   /protein_id="ABS24570.1"
FT                   /translation="MVNVVVTGAAGRMGTQIVRLVAAAEGLKLTGAVERPGHAGQDAGA
FT                   LAGIPPLGVAVVDDLAGALAGADVVIDFTSHEASARNAELCAEKGVALVIGSTGFTPEA
FT                   KARVAAAAARIPVVFSPNMSVGVNVLFELVRQAAKVLGDAYDVEIVEIHHKRKRDAPSG
FT                   TAVALGEVAAGALGRDPADALAYTRHGILGERPPWQIGVQTLRGGDVVGEHTVYFCGEG
FT                   ERLELTHRATSREQFARGAVRAAGFIAGKPAGLYDMADVLGLRSAR"
FT   gene            411717..412469
FT                   /locus_tag="Anae109_0356"
FT   CDS_pept        411717..412469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0356"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   ade:Adeh_4067 5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24571"
FT                   /db_xref="GOA:A7H775"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A7H775"
FT                   /protein_id="ABS24571.1"
FT                   /translation="MRTCRFRHRGQERHGAVEGAEVRPLTAAPWAGGLPEGRGIPLAEV
FT                   TLLAPVEPSKIVCVGRNYRAHARELGNEVPAQPLLFLKPPSAVIGPQEAIRCPEQSSEV
FT                   HHEAELGVVLARPLSRATAAEARGAVFGYTCLNDVTARDIQREEKQFTRAKGFDTFCPV
FT                   GPFVETALDPLDLPVVCRVNGAERQRGSTRDMTFDPFALLAFISQVMTLLPGDLVATGT
FT                   PEGVGPIRRGDWVEVDIAGIGVLRNPVV"
FT   gene            412497..412988
FT                   /locus_tag="Anae109_0357"
FT   CDS_pept        412497..412988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0357"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   KEGG: ade:Adeh_4066
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24572"
FT                   /db_xref="GOA:A7H776"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A7H776"
FT                   /protein_id="ABS24572.1"
FT                   /translation="MRAYVGVGTNLGDRWGHLAHAAKALRAEPRIALLRGSRVFDTAPM
FT                   GPAQPRYLNAVLELEVDLPAGALLEALQRVERRCGRRRKGVRWAARTLDLDLLLLDDEV
FT                   VRTPALVLPHPGILTRRFVLAPLAELCPDRIVPGTGCTVARLLGDAPAADVVPVGIYPL
FT                   "
FT   gene            413009..413872
FT                   /locus_tag="Anae109_0358"
FT   CDS_pept        413009..413872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0358"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   mxa:MXAN_5924 TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24573"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A7H777"
FT                   /protein_id="ABS24573.1"
FT                   /translation="MTPLRALLTLSLATALAGCEREPKTIVAAPADPPRSTRAPAEPAD
FT                   APPPAPGAPDGARGAPMTPAPGAPGQGLPSSAELLAQVEAMKGQLASAPKSLEILLALG
FT                   NLYFQERRYPDAIGWYDQAVALAEPVWKDYLALPAAAREKEPAAAVKQACTRTEQRGFE
FT                   ALAKEASARARKKDVAGAGYCYRAALEPSIGVRIQRANARLLGGDERGAIADHEALLAR
FT                   VPDQPDALYFLGLALAETARGDVAQLERARALWKRVAELQPNGPYADDLKLATAEVERR
FT                   IAAARR"
FT   sig_peptide     413009..413065
FT                   /locus_tag="Anae109_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.696) with cleavage site probability 0.317 at
FT                   residue 19"
FT   gene            414062..414667
FT                   /locus_tag="Anae109_0359"
FT   CDS_pept        414062..414667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0359"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ade:Adeh_3380 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24574"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A7H778"
FT                   /protein_id="ABS24574.1"
FT                   /translation="MPKLYYVPRTRAARPRIVLEELGIPYELVRLDPGSGETRTPEHLA
FT                   RHPLGHVPVLEDGEVRLFESGAICFWLAERYGEGRLLAPPGSPARALAYQWLCFALSEL
FT                   EPPLAPLAAELKKPEPERDRARVEEGRARFHAAARAVDAALPGREFLLGSELSVADVVV
FT                   AAVLSYGKFLAGLEGLPAAEAYVLRLRSRPAWKRAMAD"
FT   gene            complement(414689..415306)
FT                   /locus_tag="Anae109_0360"
FT   CDS_pept        complement(414689..415306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0360"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: cte:CT1717 tungsten formylmethanofuran
FT                   dehydrogenase, subunit E, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24575"
FT                   /db_xref="GOA:A7H779"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR023288"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A7H779"
FT                   /protein_id="ABS24575.1"
FT                   /translation="MTDVKCELECGELLHGHPCPPLTLGVRAGHAALRALAVPRAVERE
FT                   LFAMVEVTSDHYGQGFADGVQVATGCTFGKDRIVRLPHGKLGLTLLDQRRRRAVRVALR
FT                   AAVGEALESSAWFRAVRSAGEPWAPVPREVLEPILAFVLDCEDDHLFSTSPIFPMELEE
FT                   GAPSFRTVPCQACGDLVLEPYVERRGEAQLCLRCAERIPPRR"
FT   gene            415392..416054
FT                   /locus_tag="Anae109_0361"
FT   CDS_pept        415392..416054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24576"
FT                   /db_xref="GOA:A7H780"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:A7H780"
FT                   /protein_id="ABS24576.1"
FT                   /translation="MHVASARSSQPSPVEKTGSARAGRAALVAALLALALSAVGPKDRL
FT                   TWLMEVAPVLVAVPVLVATRRVFPLTPLLYVLLAVHAAILCLGGHYTYAEVPLGFWVRD
FT                   ALGLARNHYDRLGHLAQGFVPALVAREVLLRTSPLRQGRWLFVLVTAVALAISALYEFV
FT                   EWGAALALGQSADAFLGTQGDPWDTQWDMFLAFLGAMAAQLALGRAQDRQLERLGRR"
FT   gene            complement(416051..416776)
FT                   /locus_tag="Anae109_0362"
FT   CDS_pept        complement(416051..416776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0362"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ade:Adeh_4065 class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24577"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A7H781"
FT                   /protein_id="ABS24577.1"
FT                   /translation="MSPRRRAALSSRRTKARGSPRAARVPAVSGERALRDAIVETCRRL
FT                   HARDLIGAGEGNVSARLGEDRFLVTPSGANKGYLAPADLVVVDGRGAVVSGEGRASTEL
FT                   RMHLAAYAARADVAAVVHAHPITAVALTVAGLPPPNDLVPEAAVTLGEIAVAPFATPGT
FT                   DEVPGSLAPLWAGHDVVLLERHGALALGRSLGEAFDRMETLERVARVALVARLAGRCEP
FT                   LSAEAIAKVLAAAGKPARG"
FT   gene            complement(416773..417807)
FT                   /locus_tag="Anae109_0363"
FT   CDS_pept        complement(416773..417807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0363"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS); KEGG:
FT                   ade:Adeh_4064 KpsF/GutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24578"
FT                   /db_xref="GOA:A7H782"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A7H782"
FT                   /protein_id="ABS24578.1"
FT                   /translation="MASRPKARVVRLPRARAKPRSARGDRPLLEYGRTVLDAESRAIAA
FT                   VRLDERFAEAVRWVLDCRGRVIVTGMGKPGFVAQKISATLASTGTPSHYVHPAEAAHGD
FT                   LGRITRDDVVIALSNSGETEELLRLLPALKKIGARVVAVTRDRVNPLARAADLALVIGD
FT                   VAEACPMGLAPTASTAVLLAVGDALAMTVLANRPFEKEEYALFHPGGKLGRGLMKVREL
FT                   MRGAESNPVVREDQPLSAAVARMTETPGRPGATSVVDAAGKLVGIFTDGDLRRLVEHGE
FT                   TDFTRPVSAAMGRNPRTVRPDALVVDAARVLRQARIDQVPVVDDEGRPVGLLDVQDLLA
FT                   AKIL"
FT   gene            417898..418545
FT                   /locus_tag="Anae109_0364"
FT   CDS_pept        417898..418545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0364"
FT                   /product="putative transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: putative transaldolase; PFAM:
FT                   Transaldolase; KEGG: ade:Adeh_4063 transaldolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24579"
FT                   /db_xref="GOA:A7H783"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H783"
FT                   /protein_id="ABS24579.1"
FT                   /translation="MQFFIDSADVGEIKKALALGLCDGVTTNPSLVAKTGRSFDDVLKE
FT                   IVALAPGPISAEVTATDAEGMLREARAYAKYGDQVVIKIPLIVEGLRAVKVLSQEGVKT
FT                   NVTLCFSAVQALLAAKAGATYVSPFVGRLDDISQDGMQLIADILEIYRNYDFDTKVLVA
FT                   SVRHPVHVLEAARLGAHVATIPFGVIEQLAKHPLTDAGLKKFLADWEKVPKR"
FT   gene            complement(418930..419376)
FT                   /locus_tag="Anae109_0365"
FT   CDS_pept        complement(418930..419376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24580"
FT                   /db_xref="UniProtKB/TrEMBL:A7H784"
FT                   /protein_id="ABS24580.1"
FT                   /translation="MRDRRWDHLYDRERQPVKAYVLERFAGELARELEAWPPPFVEWVS
FT                   DELRARWAAGAAERPRDDVLRFALEVARLDLVRDFEGVERHLAADAHRLQTPAEAAALH
FT                   LLVRLVTEKCLGLKEYAEGARLRREDLAAMLHDVERRLFRVTLA"
FT   gene            complement(419451..420350)
FT                   /locus_tag="Anae109_0366"
FT   CDS_pept        complement(419451..420350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0366"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: ade:Adeh_4060
FT                   alpha/beta hydrolase fold acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24581"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H785"
FT                   /protein_id="ABS24581.1"
FT                   /translation="MPGAPPCRRPKGALHCWREVLRMKVLRVIRRAARRVDEIAAALEL
FT                   PGTQDRIEKRTDFSRCPRPVLLLHGFFASRRTFDILEARLRRDGYGVFSLHLGGFGGTF
FT                   NTRGIDDVADLVRAKIERIYARNPGMGPLTIVGHSKGGLVAAYYVKRLGGWRRTRAVVT
FT                   LGTPHHGTPLAYLGLPLGGVSRSVWQMMPGSAFLERLRDGPWPAQVRLASIWSRRDGWA
FT                   PYPSAVLDTHGLPHLVNVEVRGEHRSFLTSKRVYQAILREIRTGEDQAPLVRGPLTAMR
FT                   GGRAAENGARAVSGSDAA"
FT   gene            420477..421493
FT                   /locus_tag="Anae109_0367"
FT   CDS_pept        420477..421493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0367"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA; KEGG: ade:Adeh_4059
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24582"
FT                   /db_xref="GOA:A7H786"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:A7H786"
FT                   /protein_id="ABS24582.1"
FT                   /translation="MLVVMKPHASEGEIAAVVERIASLGLTAHPIPGAQRVAIGITGNK
FT                   GGLEAELFETMPGVQEALRVSQPFKLVSREVKADDTVLDVGGVPLGGNALAIMAGPCSV
FT                   ESREQLLEAAHAVRAAGARFLRGGAYKPRTSPYEFQGLAEEGLKLLALAREETGLKVVT
FT                   EVMDVETLPMVSEYADVLQIGARNMQNFSLLKQLGELRKPVLLKRGPSATVKEWLMAAE
FT                   YVVSRGNYQVALCERGIRTFETMTRNTLDLNAVPVLKALTHLPVVVDPSHGIGLRAHVA
FT                   AMARAGVAAGADGLIVEVHPHPEKALSDGQQSLTPREFEELMRQVRVIAGAVGRAIA"
FT   gene            421511..422533
FT                   /locus_tag="Anae109_0368"
FT   CDS_pept        421511..422533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0368"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA; KEGG: ade:Adeh_4059
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24583"
FT                   /db_xref="GOA:A7H787"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:A7H787"
FT                   /protein_id="ABS24583.1"
FT                   /translation="MFVAMKPHASPAEFQAVLEKIRSLGLTPQPITGTERKVVAVIGHT
FT                   TGLDPDDLFGSMPGVAEALRVSQPFKLVSREVKEEDTIIDVGGVTLGGKAIAVMAGPCS
FT                   VESKDQILEAAHAVKAAGATFLRGGAFKPRTSPYEFQGLREEGLKLLALAREATGLKVV
FT                   TEVKDTETLPMVAEYADVLQVGARNMQNYSLLERLGAVEKPILLKRGLSATLKEWLMAA
FT                   EYIVSKGNFQVALCERGIRTFETMTRNTLDINAVPVLKALTHLPVVVDPSHGIGLRPHV
FT                   PAIARAGIAAGADGLIIEVHPCPEKALSDGHQSLTPAEFEELMRQVRVIAGAIGRPVGA
FT                   "
FT   gene            422588..422800
FT                   /locus_tag="Anae109_0369"
FT   CDS_pept        422588..422800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24584"
FT                   /db_xref="UniProtKB/TrEMBL:A7H788"
FT                   /protein_id="ABS24584.1"
FT                   /translation="MRHALQEPAGEDPRDLRLPNGCILCGGDLDVRVSDGEARSFCARC
FT                   RWISRPHMQRHADGIHVVHPAGGLA"
FT   gene            complement(422820..423662)
FT                   /locus_tag="Anae109_0370"
FT   CDS_pept        complement(422820..423662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0370"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain; KEGG: ade:Adeh_4058
FT                   tryptophan synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24585"
FT                   /db_xref="GOA:A7H789"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A7H789"
FT                   /protein_id="ABS24585.1"
FT                   /translation="MKTAKASAPAAAAPPTDRIAAAFARCRARGEAALVTYVMGGDPDL
FT                   ATSRAMALACVEGGADLLELGVPFSDPMADGPTIQHAAERALASGTTPDGVLEVAAAVR
FT                   ARSDVPIALMGYLNPILARGVDRFAQGCARAGVDAVIVPDLLPEEAGDVAPVLAARGIR
FT                   TVFLLAPTSDAARVEAAARAATGFLYFVSVTGVTGARRAVAAEIAPAVAAIRAKSPVPV
FT                   VIGFGVSSPAQARELGPLADGVVVGSAIVQRVAEGGSRAARGARVTRFVRSLKRALRR"
FT   gene            complement(423659..424939)
FT                   /locus_tag="Anae109_0371"
FT   CDS_pept        complement(423659..424939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0371"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: ade:Adeh_4057 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24586"
FT                   /db_xref="GOA:A7H790"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A7H790"
FT                   /protein_id="ABS24586.1"
FT                   /translation="MTVPLPDPRGRFGAYGGRYVPETLVPALEELEAAWRAAREDPAFE
FT                   AELAELLTRFAGRETPLGEARRMSADAGGCRILLKREDLCHTGAHKVNNTLGQVLLARR
FT                   MGKTRIIAETGAGQHGVATATAAALFGLPCDVFMGALDVERQALNVFRMQLLGARVVPV
FT                   ESGSRTLKDAMNEALRDWVTNVRDTHYIIGSVAGPHPYPALVRDFQSVIGAEARRQCLE
FT                   VAGRLPDAVVACVGGGSNAMGIFSAFLEDPGVTLVAVEAAGHGLATGRHGASLAKGRPG
FT                   VLHGSRSYVLQDEHGQIREAHSISAGLDYPGVGPELAHLNDSGRLTLMQASDDDALEAL
FT                   QYLARMEGIIPALETAHAVAAARQVARALGPEGLLVVNVSGRGDKDVDQVRRALAARAA
FT                   PGRKAAPRRRARRPAPAAAPRRKRSGR"
FT   gene            complement(424936..425556)
FT                   /locus_tag="Anae109_0372"
FT   CDS_pept        complement(424936..425556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0372"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: ade:Adeh_4056 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24587"
FT                   /db_xref="GOA:A7H791"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H791"
FT                   /protein_id="ABS24587.1"
FT                   /translation="MPPVKVKICGITRLEDALAAARHGADALGFNFWPRSKRFIAPADA
FT                   AAIVRKLPPEVEAFGVFVNASREELLAAVAASGVGTAQLHGDEPPALCASLPVPVVKAI
FT                   RVDGPSALAALAAYEVSAFLLDAAGPGFGGSGRTLDWELAAEAARAARVFLAGGLTPEN
FT                   VAEAVSRVRPYGVDVASGVELMPGVKDEEKVRRFVQAAKEAAR"
FT   gene            complement(425601..426380)
FT                   /locus_tag="Anae109_0373"
FT   CDS_pept        complement(425601..426380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0373"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   ade:Adeh_4055 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24588"
FT                   /db_xref="GOA:A7H792"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:A7H792"
FT                   /protein_id="ABS24588.1"
FT                   /translation="MTFLEGILARKREEVAARRAAEPDGELEARARAAPPPRGFEAALS
FT                   LPGGPARIIAEVKRASPSAGAIAAGLDAPAQARRYAAAGAAAISVLTDGPGFGGSLADL
FT                   AAVRAAVGVPLLRKDFVVDRYQLLEARAAGADAALLIVAALGDDALRALLDDCSALGLA
FT                   ALVEVHDAAEADRALAAGARIVGVNNRDLHTFAVDLATSERILPRLPDGVRGVAESGVR
FT                   SPEDARRLRRAGAANLLVGEALVRAADPGALIREMTA"
FT   gene            complement(426377..427390)
FT                   /locus_tag="Anae109_0374"
FT   CDS_pept        complement(426377..427390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0374"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase family 3; KEGG: ade:Adeh_4054
FT                   anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24589"
FT                   /db_xref="GOA:A7H793"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H793"
FT                   /protein_id="ABS24589.1"
FT                   /translation="MIQQALTRLLDRHDLARAEMSAVMDEIADGGATPAQVGAFLAALR
FT                   LKGETVEEIAGAAEVMRARVDPIRVDRDVFVDTCGTGGDGRHTFNISTTAAFIVAGAGV
FT                   TVAKHGNRAVSSRSGSADVLAALGVDVDAAKDVVERAIEEVGIGFLFAPRLHPAFKAVA
FT                   GIRRELGVRTVFNLLGPLANPAGARYQVLGVYEPRWVPILGGVLAALGAAHAFVVHGEG
FT                   LDEIAVTGMTHVCEVRAGECERYAMVPEDLGLRRHEEAEIAGGDADRNARILADVLAGQ
FT                   QGGPRDAALANAAAALVAAGAAADLREGVRLGAEAVDRGAASDKLARLVAVTRGGA"
FT   gene            complement(427387..427968)
FT                   /locus_tag="Anae109_0375"
FT   CDS_pept        complement(427387..427968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0375"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   ade:Adeh_4053 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24590"
FT                   /db_xref="GOA:A7H794"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7H794"
FT                   /protein_id="ABS24590.1"
FT                   /translation="MLLLDNYDSFTFNLVQYLGELGADVEVFRNDAIDVAGIQARRPDG
FT                   LVLSPGPCTPDDAGVTLEAIAALAGELPILGVCLGHQAIGQAFGGKVIRNARIVHGKAS
FT                   PVLHAGAGVFAGLPSPFEAGRYHSLVVERETLPAALEITAWTEEEEIMGLRHRALDVEG
FT                   VQFHPESILTAEGKRLLGNWLRRLDGGRAR"
FT   gene            complement(428232..429713)
FT                   /locus_tag="Anae109_0376"
FT   CDS_pept        complement(428232..429713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0376"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein;
FT                   KEGG: ade:Adeh_4052 anthranilate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24591"
FT                   /db_xref="GOA:A7H795"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A7H795"
FT                   /protein_id="ABS24591.1"
FT                   /translation="MPVRVEVDADTETPVSAFLKLSRGERQAFLLESVEGGERSARFSF
FT                   LGAGPKSVLRHKLGDRGDPLAAVRAALATHTAVRVPGTPRFAGGLVGHVGYDAVKLFEP
FT                   RVPIANPDELGFPDLLLMDFDEVVAFDNRRHSLHVICEVRCDEGDDPRALYARAVKRIR
FT                   ARLALLAAPLEDRRARRAAKPSELVPRVAKPDYLAAVERAKDYVRAGDCQQIVLSQRFD
FT                   AEVSVPPFEIYRALRRVNPSPYLFFLKDGERALVGSSPETLIKLEDGEVTLRPIAGTRK
FT                   RGGDAAEDARLEAELRADPKENAEHVMLVDLGRNDVGRVSAVGSVRVTALKTVERYSHV
FT                   MHLVSEVKGRLAAGLGAVDVLRAGFPAGTVSGSPKVRAMEIIDELEPARRGPYAGAVGY
FT                   FDRGGDMEMCIAIRTLMARGRRVSVQAGGGLVYDSDPEAEYQETLNKARAVFTAVAQAE
FT                   SRVLDAVARPPAPAARTVAARTPKASRRRPRRGER"
FT   gene            complement(429795..430190)
FT                   /locus_tag="Anae109_0377"
FT   CDS_pept        complement(429795..430190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0377"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase; KEGG: ade:Adeh_4051 aspartate
FT                   1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24592"
FT                   /db_xref="GOA:A7H796"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H796"
FT                   /protein_id="ABS24592.1"
FT                   /translation="MRRTFFKSKIHRATVTHADLDYEGSVSIDEDLLDASGILEYEAVH
FT                   VWNITRGTRLQTYAIKGERGSGVICINGAAAHLNKPGDLVILATFAELDEAEARGFKPT
FT                   VVLVDRKNKIVESDAVEIAGPARRVSA"
FT   gene            complement(430322..431083)
FT                   /locus_tag="Anae109_0378"
FT   CDS_pept        complement(430322..431083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0378"
FT                   /product="glycosyl transferase family 25"
FT                   /note="PFAM: glycosyl transferase family 25; KEGG:
FT                   ade:Adeh_4050 glycosyl transferase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24593"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A7H797"
FT                   /protein_id="ABS24593.1"
FT                   /translation="MHPSFDLLNRTFDRIFVVTLPRALERQARVTSRLTGLDYRFFHGF
FT                   DRQQLDLDRLAREGVYAPERARRVDRHGRALGAGQVGCSLSHRKLYEQAIENGWSRVLV
FT                   LEDDVVARDDDLPQLTAALSQLPEAWDVLYLGYTNFETVTRRDRVKQASYVVLSALRLM
FT                   KWRPREILRFHPRPFSPNLRCAGLHHCTHAYAFTLAGAKKLLAAQTPVAFPADQLLVHL
FT                   VLRGEIRAFVTEPKFFDQEAPPGGVGSFVAA"
FT   gene            complement(431154..432446)
FT                   /locus_tag="Anae109_0379"
FT   CDS_pept        complement(431154..432446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0379"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pha:PSHAa2452 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24594"
FT                   /db_xref="UniProtKB/TrEMBL:A7H798"
FT                   /protein_id="ABS24594.1"
FT                   /translation="MTPSSPLRDAPSPPDAPRWTDSLRAEFPALAGVRIAVVGYVLVSP
FT                   VTGEIQTGGTETYAATLAEVARGLGGDVVFLQRSRTPFAPREVRPGLSARSWARPRDVG
FT                   PLLRAVREEAGARPTVTLLFVEDYLPDVADHPSVFLHHGILDDGAFERRPRSRLMGWVR
FT                   DVRKLWVWHRRRRRHFRMVTRTTRTVAVDTNVGNVTRFMFPQLEWGGRIEYVPNFGTLL
FT                   PRAEVVAKWRDLHAPTTVLFARRFVMKRGTFLWADVLREIAPRYPEVQFRCVGRGPGEP
FT                   WLRELAARQANVKVLERPHDEMVEEHRRAHISAVPSLWSEGTSLSAIEAMCAGAAVVST
FT                   DVGGLGNLVIPNATGLIAPATPDAFGAALRRLLDDRALARRLALSGHRAAAASFSHSAW
FT                   ARRMCRVLAGVLADPTPRSPVRRVAPAPGVE"
FT   gene            complement(432490..434484)
FT                   /locus_tag="Anae109_0380"
FT   CDS_pept        complement(432490..434484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0380"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ade:Adeh_4049 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24595"
FT                   /db_xref="GOA:A7H799"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H799"
FT                   /protein_id="ABS24595.1"
FT                   /translation="MRHVSWIIALVIGFSVGFFSRGAIDGGGRGARPSGQAQQRPARPV
FT                   EDPSAVYRVPVDDTPLRGPADALVTIVESSDFECPFCKRVGPTLKQLEEAFPGKLRFSF
FT                   RHNPLPFHARALPAAIAAEEARAQGGDAKFWAMHDKLFELAPALDDASIERAAQEIGID
FT                   AAKVKEAIASGKHKDRIQRDQRVVQSVGAPATPSFFINGRKLAGAQPFETFRALVAEEL
FT                   KKAEALVQGGTPASGVYAKIMESASSRPVYLPTPTGQAAPQDGAPKAPAAAPAAVYRKV
FT                   PLRADDPARGPASAKLTVVLFSDFQCPFCARVEPTLKQLEEAYPGQLRVVWKHQPLGFH
FT                   QQAMPAALAAEAAREQGKFWQLHDKLFENQRALDDASLARYAKEIGLDARKLEQALQSK
FT                   KHEPRIQEDMRLGASVGASGTPTLFFNCRQLVGAQPFDRMKAVADEELKKADALLGGAR
FT                   PDAGFYDRACDANVAAAPAAPVPAAAQAPAPGPIQKIDVRTDDPVRGNPKAPVTIVLFS
FT                   DFQCPFCARVGPTLDEVQRTYGDKVRVVWKHQPLPFHQQALPAAEAAEAAREQGRFWQM
FT                   HDKLFASQRELSPDAYGRIAREIGLDAKKFQASVQSGKARARIQEDQQLASRVGAQGTP
FT                   TMFVNGEKIVGAVPFAQIKAVIDRQLAAR"
FT   sig_peptide     complement(434416..434484)
FT                   /locus_tag="Anae109_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.758) with cleavage site probability 0.498 at
FT                   residue 23"
FT   gene            complement(434636..435673)
FT                   /locus_tag="Anae109_0381"
FT   CDS_pept        complement(434636..435673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24596"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A0"
FT                   /protein_id="ABS24596.1"
FT                   /translation="MRRLAVAIALAFGAPVLAQDEALPPPPPPPAYEGDVPLPPPPSGT
FT                   RPLSQLDPRLPPAQRPAPPHAAPASGAFQGGAIGESPVAPAGSPAAPLHPDETIGHWRY
FT                   AMASGVAGRFGGMQLDPDRENPGVLLYFGAQADGLWSEGFGKSARLRLRMFTGGESEVY
FT                   LPSDGEIEGAFMIGRREFRFVLGRLEVGRYPALGVNVLAQLATLPCFEGSLPLLGDTMR
FT                   LYYYVSPVEASFVRYHGDAHIEHSAAWATESDVPVAASAGRLRWTLLLPPSVLLSLQGD
FT                   LMKMWNKADTFLAGEASLGYQVLDGSAVFNVAARWDRYRRRGLGAETSETDGEMKLLAI
FT                   ASLVF"
FT   sig_peptide     complement(435617..435673)
FT                   /locus_tag="Anae109_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(435693..436202)
FT                   /locus_tag="Anae109_0382"
FT   CDS_pept        complement(435693..436202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24597"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A1"
FT                   /protein_id="ABS24597.1"
FT                   /translation="MPRLALAALLAALAAAAAPASAQEPHVPTTGLAATFSYGGGGELG
FT                   LDEGEDELGAGVAEIEATLGYEFESTGLRPEIGVVLGLDPDTHWALRPGIRWSLQTLPI
FT                   QVRLAFDGSNARDRSMEWRWLLLGVAAELRFTSVLGLFAEVDGGAPLSSEAGVPLLARA
FT                   GATFRF"
FT   sig_peptide     complement(436134..436202)
FT                   /locus_tag="Anae109_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            436341..436577
FT                   /locus_tag="Anae109_0383"
FT   CDS_pept        436341..436577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0383"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ade:Adeh_4046
FT                   SirA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24598"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A2"
FT                   /protein_id="ABS24598.1"
FT                   /translation="MPAPARTLDTSGRLCPFPIVETAKVVRTLEEGAVLLVISTDAGIA
FT                   TDMPMWCRATRNEHLGTFRDGAAWKSWVRKRAR"
FT   gene            436587..437642
FT                   /locus_tag="Anae109_0384"
FT   CDS_pept        436587..437642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0384"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="PFAM: thiamine biosynthesis protein; KEGG:
FT                   ade:Adeh_4045 thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24599"
FT                   /db_xref="GOA:A7H7A3"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A3"
FT                   /protein_id="ABS24599.1"
FT                   /translation="MPKQGKAIAMISGGLDSTLALALVRRQGVEVKAVTFYTGFCITET
FT                   QRRKGGRADGAVPRNEALRAAADLEVDIEYVDISGSEYLDMLVHPKYGYGANANPCVDC
FT                   RVFMMRKAKEIMEAEGADFIFTGEVLGQRPKSQRRDTLRIIERDSGLDGRLLRPLSAKL
FT                   LQPTIAEQEGIVDRERLEAISGRSRQRQMELARELGVVDWPQPAGGCCYLTDESFAKKF
FT                   FDVLDAREAAGEERRILPEDVVLLSTGRHFRLSPRAKLVVGRTEVENALLEHHVEGRAR
FT                   LEAQDVLGPVAIVEGEPTWEERVLASRIVARYGKGKDAPRVTVEWREGDLVERYEVEPE
FT                   QDEARVEALRI"
FT   gene            437842..440796
FT                   /locus_tag="Anae109_0385"
FT   CDS_pept        437842..440796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0385"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="TIGRFAM: pyruvate, phosphate dikinase; PFAM:
FT                   PEP-utilizing protein; pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; PEP-utilising protein mobile region;
FT                   KEGG: ade:Adeh_4044 pyruvate, phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24600"
FT                   /db_xref="GOA:A7H7A4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A4"
FT                   /protein_id="ABS24600.1"
FT                   /translation="MAQKRIYAFGGGKAEGNKDMKELLGGKGAGLAEMSNIGIPVPPGF
FT                   TITTEVCTEYYRGGKKLPKGLEGELRAAMKRAEALAGKRFGDPKDPLLVSVRSGARASM
FT                   PGMMDTVLNLGLNDATVGGLARASGNPRFAWDSYRRFVAMFGDVVLGLKPEHKEDRDPF
FT                   EEILERKKLARGVRFDSELPEDALRELVTEFKAAIRERKGVEFPDDPYGQLLEAVAAVF
FT                   RSWDNDRAIAYRKLYGYPSDWGTAVSVQAMVFGNLGDDSGTGVAFTRNPATGDDAFYGE
FT                   FLVNAQGEDVVAGVRTPQKISELAARWPEIARQLESVRTKLEKHYQEMQDIEFTVERGK
FT                   LYVLQTRTGKRTGLAAVRIALDMAAERLITKEVALQRIEPEALNHLLRPIFDADRKAAA
FT                   MKAGKLLAKGLPAGPGAASGRVVFFAEDAVTWGARGERVILARHETSPEDIRGMATAEG
FT                   FLTAFGGMTSHAALVARQMGKVAIVGCEALSFDYHGRQMRVATAAGERVVREGDWISID
FT                   GTAAEVIEGELETRPSQVLQVLVEKTLAAEDAPVYREFAQVMAWADQARRLGVRANADQ
FT                   PDQAAVSVALGAQGIGLCRTEHMFFGEGKIGPMREMIVAETVEERRAALAKLLPLQRED
FT                   FRGIFEAMGPRPVTIRTIDPPLHEFLPQDEPGIAELARVTGKPVERIRARIEELHESNP
FT                   MLGHRGCRLGITYPEITEMQSRAIFEAACDVAERGIEVEPEVMIPLVGAKQELDDQAAV
FT                   VRRVADEVFAARGLAVSYHVGTMIEVPRGAVTAGEIAKTAEFFSFGTNDLTQTTFALSR
FT                   DDTGPVLATYLEKDIWPGDPFVSIDREGVGALMRMGVEGGRKTRPDLKLGICGEHGGDP
FT                   SSVEFCHELGLDYVSCSPYRLPIARLAAAQAALRERAAAPAKAAAKRVAKAAKASGGAA
FT                   GRAAKAARTPAQGGKRAKGLRDGKPAAARLGAALASKGLAKVKRALKARARRGR"
FT   gene            440944..442155
FT                   /locus_tag="Anae109_0386"
FT   CDS_pept        440944..442155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0386"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: ade:Adeh_4043 penicillin-binding protein,
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24601"
FT                   /db_xref="GOA:A7H7A5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A5"
FT                   /protein_id="ABS24601.1"
FT                   /translation="MLHRVPSWLVPASALVLAGLVLPRAHSSGGGAGGASASAQKKLAE
FT                   AAPAAPELPIRIGEIVLDEATGRYVAPLGDRRATLTLHPGLQARLERALDTYRVPWGAT
FT                   VLLEPATGKILALAEHSRAEPGRRGLSVAALAPAASIFKLVTAAALLEHGTQPDEEVCY
FT                   HGGKRRLAPGNLADDPRRDHRCRTLVSAFGHSTNVVFAKLAGRGLDAESLRATAERFLF
FT                   NTEIPFARPVEVSRADIPEDDFGFANTAAGFGPVKLSPLHAALLAAIVANDGVLVPPVI
FT                   VESVDGGAIPSAGEPRRVIEEPVAAELARMMRSTVTEGTARRAFARARGPLRGIPVAGK
FT                   TGSLADAQPYRDYSWFVGYAPADHPQVAIATVVVNERLWHARAPTVAREALEAYFAAQV
FT                   AQVP"
FT   sig_peptide     440944..441027
FT                   /locus_tag="Anae109_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.552 at
FT                   residue 28"
FT   gene            complement(442330..443445)
FT                   /locus_tag="Anae109_0387"
FT   CDS_pept        complement(442330..443445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24602"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A6"
FT                   /protein_id="ABS24602.1"
FT                   /translation="MRGLMGSFAVLPLSELVDLLARRSMSGTLGCERGTVQKSVHVREG
FT                   VAVGAESNDPREHLGQLLLNFGHVTEEQLAKAFQTQEETRIRLGKVLTLVGLVSPDTVR
FT                   DVLAIKLRETLLDVFLWDAGVFWFDGGSPPVVDDLDAAVPLADIAREAEFRTTAWSAFR
FT                   GEFPSGAATLVVEEAAATASADPTTVDGRLLALAREGKTIDEIGLALHATDFHLYQRLY
FT                   ALARQGALRAAPAPLAAAAAAEPVGAADLIDRARALLADGRADDAELVAARAVELAPAS
FT                   EAARSLLGETERVLGERLRAELLGPPRTPRVRLSSPEVARLRLSSADKYLLSRCDGRRD
FT                   LRELARVAPLRELDVLKAIRRFADAGLVELG"
FT   gene            443579..444163
FT                   /locus_tag="Anae109_0388"
FT   CDS_pept        443579..444163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0388"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ade:Adeh_4040 electron transport protein SCO1/SenC like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24603"
FT                   /db_xref="GOA:A7H7A7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A7"
FT                   /protein_id="ABS24603.1"
FT                   /translation="MALVAAALVAGGAYLAYDRLVTQPALERAALLGFGVDRTDVPAPA
FT                   LELEALDGSRFSLAQARGQVVFLNFWATWCPPCREEMPSMLRLGRELEAKYPGRFRMVA
FT                   VSVDEGWDPVKEFFAAPPYFGKPGLAVTLDPGHAVTKAYYCAARGGSCPDLKFPESYIV
FT                   DKDGRLVAYVVGPRDWNDPTARQLLESLIGS"
FT   gene            444471..445427
FT                   /locus_tag="Anae109_0389"
FT   CDS_pept        444471..445427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0389"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="KEGG: ade:Adeh_4039 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24604"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A8"
FT                   /protein_id="ABS24604.1"
FT                   /translation="MVLVGLGEDGRAIARAVVARPELTVVAAVDRDPALAGASLDALLG
FT                   AGAPEVRVEGDLAKALGRARGGVLIQSGVDRLDDALADVRAAVKAGLHVVSTCPELAYP
FT                   ALDRADDAEALDALCEQRGVAVVSTGVTPGFSLDRLPALLAQVAGPIRHVRAVRVVDLA
FT                   SADDPLRRRVGVGLSEAAFDDALEREELGQLGLAQSAALVAESCIGTDDYEVDEELVPL
FT                   VAEEDGAVRRGEVAGVQQIARVFAEDQEVVRLELTIQVGARDPRDEVELDAAPPLRLLV
FT                   PGGVPGAAGTANAVVNAIAAVMERQGLLTVLDLPVGR"
FT   gene            445436..445873
FT                   /locus_tag="Anae109_0390"
FT   CDS_pept        445436..445873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0390"
FT                   /product="MaoC-like dehydratase"
FT                   /note="KEGG: ade:Adeh_4038 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24605"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A9"
FT                   /protein_id="ABS24605.1"
FT                   /translation="MLDRSLIGRESEPVEHEVERSAIRRFADALGDPNPIYQDEAAAQA
FT                   AGYAALVAPPTFPVTLTANERFRHSLDLGTRSILHSEQQLEYARPIVAGDRITVVSRVA
FT                   DVLERPGASGPMDVLVLEDEGRDEKGEWVFRSRATLILRRG"
FT   gene            445882..446850
FT                   /locus_tag="Anae109_0391"
FT   CDS_pept        445882..446850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0391"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   ade:Adeh_4037 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24606"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B0"
FT                   /protein_id="ABS24606.1"
FT                   /translation="MLTARQLYFEAVKVGDELPPLVKPPVDRLQIARYVGAAQDWNPLY
FT                   IDEPYAKNSGFPSALAPGMIAMGFLGELVVDWVRGARLRRFSARFVKIVWPGDVLTVRG
FT                   RVTDRRFEEGGRYAVDIEVWAENQRGELVVRGLTGFQLYYSAEDEARQRAGGAPLVVTK
FT                   EEEEARLAKLSRAQPSRPAAPASRPLAPPRLPQPPAQPAQPAPAARTAPPAAARPQAAS
FT                   RPPAPAATAARAAPAAAPKPAPKAAPVGARPRPGTKPPAPATQTPKRAAARPRPAAKAT
FT                   AGKAKAARPRPAKRPAGKEKGANARARAHGAARKPTGKKRR"
FT   gene            446866..447741
FT                   /locus_tag="Anae109_0392"
FT   CDS_pept        446866..447741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24607"
FT                   /db_xref="InterPro:IPR031823"
FT                   /db_xref="InterPro:IPR038537"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B1"
FT                   /protein_id="ABS24607.1"
FT                   /translation="MPSRRSLALAALALVAGASACRRPAETAPAPADARAAPGPFEAAL
FT                   AEGVRAFEERADPARLVEAISAFQRAAAARPGAVDAELPLARAQAFRALSAREPAEAKE
FT                   AWDASARAAERALRVTSPGWAQAIDRGEDPAAAAARVDPPGGEALYLLAQGAMRGAQAT
FT                   GYAAVLAVKDAALAMMARAAELDERIDAAGPHRALGAWRAALPVAAGGGADAARAHFDR
FT                   ARQLAPDDLLGRVAEAETYAVLVQDSALFDRLLAEVTGSDPASDPARAPENGVAQRRAI
FT                   ELRERRARLF"
FT   sig_peptide     446866..446949
FT                   /locus_tag="Anae109_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.583 at
FT                   residue 28"
FT   gene            447751..448668
FT                   /locus_tag="Anae109_0393"
FT   CDS_pept        447751..448668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24608"
FT                   /db_xref="InterPro:IPR025634"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B2"
FT                   /protein_id="ABS24608.1"
FT                   /translation="MVREPEAIAASPARRRRAAVLLAIASALVACRPRVPPPDLSRDAG
FT                   ELLAQVRAGQARVQRVSGEARVKVDAKGMRTAVTVRQFIAAEKPDRLHVEVLDFFGNVG
FT                   AVLAAEGGRFQLFDAKERVFYRGAATPENLARLVPLPLPAEDLVTILCGSAPLLDAAED
FT                   VEVRGAALVLSLGADGRAQEVRVGEQATVERSSVVAVGPGTAPAYSLDFDGFRPLAAGR
FT                   FPGELRIRAEDPRVRLDLRWGEVQVNGDLGGVRFTIDPPRGARVVELGDEEHEVPNLFR
FT                   EGVPEPAPGSSPAHGPGGAGSPSR"
FT   gene            448766..449455
FT                   /locus_tag="Anae109_0394"
FT   CDS_pept        448766..449455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0394"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   ade:Adeh_4034 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24609"
FT                   /db_xref="GOA:A7H7B3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B3"
FT                   /protein_id="ABS24609.1"
FT                   /translation="MDTSFLGILKTSWSMWIIGACSVLALAVAIERAIALWGFAARART
FT                   VADAVVRALLRGDLEEARAECERSPSPAADVFLAGLAAAGRRAARGGLPDPEKIDAAVE
FT                   RERQQMNLRLRRNVWVLGTVGAIAPFIGLFGTVVGIMQAFRHMAATGQGGFTVVASGIS
FT                   EALVATAGGIAVAIEAVVIYNFFNVHVQKLALQLKLMVEEFLETLHEVLPAAAARPAPE
FT                   PRPAREA"
FT   sig_peptide     448766..448849
FT                   /locus_tag="Anae109_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.790) with cleavage site probability 0.567 at
FT                   residue 28"
FT   gene            449457..449912
FT                   /locus_tag="Anae109_0395"
FT   CDS_pept        449457..449912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0395"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_4033 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24610"
FT                   /db_xref="GOA:A7H7B4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B4"
FT                   /protein_id="ABS24610.1"
FT                   /translation="MAIGGPNGGDGGDDLEMPGGIFADINITPLTDIFLVLLIIFMVTT
FT                   TAIAEAGRDEGGFKVNLPKGGKGETSAVARDVTVAVLADGRAVVGGKVQDDAELRRAFT
FT                   EARERSPETVVLFQADEGVPHGRVVQVMELARAAGLSRLAIATRAEQ"
FT   gene            complement(450073..450447)
FT                   /locus_tag="Anae109_0396"
FT   CDS_pept        complement(450073..450447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0396"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: ade:Adeh_4031 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24611"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B5"
FT                   /protein_id="ABS24611.1"
FT                   /translation="MSTAVTQGIRVEVRSAYRPDRSEAGRWLFTYTVRIANQGETPALL
FT                   AARHWIITDANGEREEVVGEGVIGQQPQLSPGDEFEYTSFCVLETPHGSMQGSYRMERP
FT                   DGSSFHARIAPFPLVAGTLN"
FT   gene            450522..451334
FT                   /locus_tag="Anae109_0397"
FT   CDS_pept        450522..451334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0397"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: ade:Adeh_4029 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24612"
FT                   /db_xref="GOA:A7H7B6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B6"
FT                   /protein_id="ABS24612.1"
FT                   /translation="MEPKLQQLLDDVRRAQGRVVALTGAGVSAESGIPTFRGREGFWVV
FT                   GSRNYMPQEMATHEMFARAPEEVWRWYLHRFGVCRDARPNAGHAALVALERALGERFTL
FT                   VTQNIDGLHRRAGSERVLCIHGDAAYVRCADGCGTGLLDLPLFPQRGKDDPLTDADRAR
FT                   LACPSCGGWLRPHVLWFDEYYDEVNYRMESALRAAAEAELLLVVGTSGATNLPMQIGRL
FT                   AFERQAALVDVNPEVNPFAELASRSSRGFFARGSACERLPAIVAALGA"
FT   gene            complement(451369..453690)
FT                   /locus_tag="Anae109_0398"
FT   CDS_pept        complement(451369..453690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24613"
FT                   /db_xref="GOA:A7H7B7"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B7"
FT                   /protein_id="ABS24613.1"
FT                   /translation="MRTRSVAVIAAVFLGAAALSLFVVLQLTRERPRAVPPAAPSAPSP
FT                   SVTPPLEPAATEADGRVELRATANDAPLAGAEVRLYLQLPPRTGALEPAWLRAAEARTD
FT                   AEGIARLPARPGTYLAAVRAAGLAPAHAEVFCAPGEELTHAEVALAQPTTLDVRVVARP
FT                   DGRPVQARIVLLPSVGRGARLAPPSAPVEERLSASADGAGAARVDGLAPGSYAVAAEAP
FT                   DLHPVLLPRVEVPRAEPLAISLEPLGRISGVVRDPSGRPAAGATVRGASRDHAASATSD
FT                   AEGRYTLAAPAGAYRLIAAAGEGAAGAGPVTVQAGATTEGIALALGRAAALEGVVVDER
FT                   SGRPVPGAEVALVLHDTGALAARAVASEEGRYRLAPLAPGQYDLRAAAAGRSPAVQRGV
FT                   TLAARQTFPLDVALAGTGTIEGAVADARGGPLAGARVRVEARGDGLAGALPLEARSDFE
FT                   GRYRIEGVEVGRAELVARQDGVALGVSRAVRVAPGSTARADFSLPEAGVLAGRVSQAGG
FT                   TAPVGTAVVAVPLKAGAGTPQRARAVADARGTYRLALPAGEYRVHAAPGDADRTDLRVA
FT                   PAFARVEAGATSRLDLTAAAPTAEEGVELVILEPGGAPSPGAAVTLARAGDDRIALATS
FT                   AGEDGRVVLAKEMGLAGASITVRARSGGRSGAWTGALPASGQVAVQLERGGAIAGAVRA
FT                   RGAEPRSVVVEVASRPSADGWRVTDVHRFPGARFELADVPTGPLRLTVRADDGRRGAAE
FT                   LSLASGETRTLEIPLEPDRR"
FT   sig_peptide     complement(453619..453690)
FT                   /locus_tag="Anae109_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.497 at
FT                   residue 24"
FT   gene            complement(453774..454982)
FT                   /locus_tag="Anae109_0399"
FT   CDS_pept        complement(453774..454982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0399"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ade:Adeh_4026
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24614"
FT                   /db_xref="GOA:A7H7B8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B8"
FT                   /protein_id="ABS24614.1"
FT                   /translation="MPVSRALSFSIFLVVSLAVVGGMHTYLWMRLVRDPALPEPWHRIA
FT                   TVALIVLAFAMPLGMIALRAAPQPLARVVPVVAFGWLGLAFMCFCVLVSVDLVRAAARG
FT                   GELLADWLRRRPDPPVDPARRLLVARALAGGAALATGGAAALSFRSATGPAEVTDVPVR
FT                   LERLPPALSGFTIAQITDLHVGPTIGERDVRRVVEQTNALRPDVVAITGDLVDGSVRDL
FT                   GRAVGELARLRARLGVFFVTGNHEYYSGVEEWLEALGAMGIRVLRNERVRIGDPAASID
FT                   LAGVDDWSAAHRNGGHENDLRLALEGRDPDRGLVLLAHQPRGIEAAVQAGVELQLSGHT
FT                   HGGQIVPFNLLVAAAQPYVRGLHRHAEPGRAGQIFVSRGTGYWGPPFRLGSPPEIARVV
FT                   LTS"
FT   sig_peptide     complement(454917..454982)
FT                   /locus_tag="Anae109_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.775) with cleavage site probability 0.430 at
FT                   residue 22"
FT   gene            complement(455159..455488)
FT                   /locus_tag="Anae109_0400"
FT   CDS_pept        complement(455159..455488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24615"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B9"
FT                   /protein_id="ABS24615.1"
FT                   /translation="MTSLSLRKLALAAALAVAVPSAALAMPCESERVPAPPRPTPAGWH
FT                   HESARERELREIRRELRALEDERADFHARYAGRPGKIRKFERWYASRRAELEARRDALR
FT                   YYAWR"
FT   sig_peptide     complement(455411..455488)
FT                   /locus_tag="Anae109_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.950 at
FT                   residue 26"
FT   gene            complement(455574..455912)
FT                   /locus_tag="Anae109_0401"
FT   CDS_pept        complement(455574..455912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0401"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: ade:Adeh_4024 transcriptional
FT                   coactivator/pterin dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24616"
FT                   /db_xref="GOA:A7H7C0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C0"
FT                   /protein_id="ABS24616.1"
FT                   /translation="MDFSQKRCVPCEGGIPKMTAAQVEESLRSLDGWDARLDATQLHKH
FT                   YRFKDFPQAIAFVNAMAALAEDEGHHPDFCVHYSAVDVTLWTHAIGGLSENDFILAAKL
FT                   DRLPASRA"
FT   gene            456000..456368
FT                   /locus_tag="Anae109_0402"
FT   CDS_pept        456000..456368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0402"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   ade:Adeh_4023 protein of unknown function DUF423"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24617"
FT                   /db_xref="GOA:A7H7C1"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C1"
FT                   /protein_id="ABS24617.1"
FT                   /translation="MERTFFALGAISAAVSVAAGAFGAHALKARLSPDLLAVFETGARY
FT                   EMYHALGLVAAAWAAARFGGAAPAWAGWLFLAGTVLFSGSLYALALTGVRGLGAVTPFG
FT                   GVAFIAGWLALAVSTLRR"
FT   sig_peptide     456000..456080
FT                   /locus_tag="Anae109_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.558 at
FT                   residue 27"
FT   gene            complement(456414..456728)
FT                   /locus_tag="Anae109_0403"
FT   CDS_pept        complement(456414..456728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0403"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ade:Adeh_4022
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24618"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C2"
FT                   /protein_id="ABS24618.1"
FT                   /translation="MTRLSPADAHALVSQGGHDLVDVREPHEWARGHIPGARHVPLRTL
FT                   VASPQAHLGARPVVFVCAHGVRSLTAAALAERAGAPATASVDGGTVRWAREGLPFEGSP
FT                   "
FT   gene            456807..458111
FT                   /locus_tag="Anae109_0404"
FT   CDS_pept        456807..458111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0404"
FT                   /product="TGF-beta receptor type I/II extracellular region"
FT                   /note="PFAM: TGF-beta receptor type I/II extracellular
FT                   region; major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_4021 amino acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24619"
FT                   /db_xref="GOA:A7H7C3"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C3"
FT                   /protein_id="ABS24619.1"
FT                   /translation="MSATARDRFPPSIKYLAWNEAAERFSYYGMTSILALYMARNLGLP
FT                   EHRAIAGFQVFTAAVYLMPLVGALLADWFWGRYRTILWLSFGYVAGHATLAIWESGTGL
FT                   AVGLGLIAIGAGGIKPCASAFAGDQIPAGKEALLSRLYDLYYWMINLGSTVGTLVIPLL
FT                   LDRVSPRVAFGVPGIAMAAALAVFWVGRGRYVRVPPARSAPPPAAADAAEPPARGAILR
FT                   ILAIFAPVAAFWALFFQYGSSWTLQADRMRREVLGFQIAAGQVQTLDAALVLTLIPVFA
FT                   VLVYPAVERRGVRVTPLRKMSVGMFVMVLSFVSAAVVEARLLDAGAAAPHVAWQIPQYL
FT                   FLAVGEVLVSVTALEFAYGEAPRRLKSVVMGLWYLTIASGSILTALVAWANRFHGVAYY
FT                   AFFAALMLAAAVVFALVAWWYPAASSRRAAVDAAA"
FT   gene            458136..459512
FT                   /locus_tag="Anae109_0405"
FT   CDS_pept        458136..459512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0405"
FT                   /product="amino acid/peptide transporter"
FT                   /note="TIGRFAM: amino acid/peptide transporter; PFAM:
FT                   TGF-beta receptor type I/II extracellular region; major
FT                   facilitator superfamily MFS_1; KEGG: ade:Adeh_4020 amino
FT                   acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24620"
FT                   /db_xref="GOA:A7H7C4"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C4"
FT                   /protein_id="ABS24620.1"
FT                   /translation="MARTERYPPQVKYIVGNELCERFSFYGMRSILTLYMMQYLLFAQQ
FT                   DAKAYFHYFVMANYLTPLLGGWIADRFWGRYRTILWISLGYVGGHAVLAIWETPAGLLA
FT                   GLSLIALGAGGIKPCVSAFVGDQFGPTQKTLMQRVYGWFYWSINLGSASANLLIPWLLK
FT                   RHGPSVAFAIPGVLMALSLLVFWAGTKHYVQAPPSGPNPHGFLRVVGRAVRRAGTGRAG
FT                   EHWLDVARDQHPPEAIAGAKAVFRIMGVFAAVTLFWTLFDQKASSWVIQASQMDLVVRG
FT                   WEMSPAQLQAANPFLVMTLIPLFTWGVFPFLERRGVELSPLRKMTAGMFLTALSFGAAA
FT                   IVQTFVDRGGAPPSALWQLPQYVLLTVGEVLVSVTGLEFSYTQAPKTMRSTIMSLWFLT
FT                   IALGNLLTAVLTRVVSLEGAAYFWLFAGLMLAAAFAFREVARRYRPVPAAVEAGVVAEG
FT                   "
FT   gene            complement(459558..463985)
FT                   /locus_tag="Anae109_0406"
FT   CDS_pept        complement(459558..463985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0406"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases; KEGG: xac:XAC2450 ATP-dependent
FT                   DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24621"
FT                   /db_xref="GOA:A7H7C5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C5"
FT                   /protein_id="ABS24621.1"
FT                   /translation="MLDAFHPVVRDWFVRRFGDATEPQTPAWREIGARRDVLVSAPTGS
FT                   GKTLAAFLHAIDALLKEGLAGELGDRTRVVYVSPLRALGNDISKNLQAPLAEIRAAAHA
FT                   AGLALPELRVAVRTGDTPAAARRKLLLRPPHILVTTPESLYLLLTCDSGRASLGDVETV
FT                   IVDEIHALAGDKRGAHLALSLERLEALARRRPQRIGLSATVDPVAEMARFLVGAERVDR
FT                   RGNARCAIVEVGRRRRFDVAIEVPRDELSSVASKELWAESYDRVAELIRAHRSTLVFVG
FT                   TRRLAERAAHALAERLGDGAVAAHHGSLSRERRLATEERLKAGALRAVVATASLELGID
FT                   VGEVDVVVQLGSPGAISTGVQRIGRAAHVRGGTPKGRLFPMSRDELVECAAFVRGLRRA
FT                   RLEPVAPRDAPLDVLAQQLVAEATCGSIHEDRLYALARRAWPYRALPRADFDAVVEMLA
FT                   EGIATTPGRTTALLHRDGVNGRVKARRGARIAALTGGGTIPDTAQYAVVAEPEGVTIGQ
FT                   VDEDFAVESLAGDVFLLGTTSWMIRRVEAGIVRVEDAHGAPPGVPFWNAEAPGRSAALS
FT                   AEVSALRAELEPRLADPPAAIAWLVAEAALPEAGARQVVDYLAAGRAALGALPTQDTLV
FT                   AERFFDEAGGMQLVLHAPFGARTNRAFGLALRKRFCRTFDFELQAAATDDGVLLSLGPQ
FT                   HAFPLETIFSYVTPATLDEVLEQAVLQAPMFGVRWRWNATRALAIPRLFRGKRMPPPIA
FT                   RMRAEDLLAAVFPAQVACQDNAPGGPLEVPDHPLVRETLRDCLTEAMDAAGLRALLERI
FT                   AAGEVRLLAVDTPEPSPLSHELLNARPWAYLDDAPLEERRARAVAVRRALPAAEASGIG
FT                   ALDPAAIAEVAEQVWPAPRDADEVHDALLDLGVLPLTAAAGWEGWLGELEVAGRAARMT
FT                   VGEARWWVAAERVGTARGAAVELGGATPTPTPAGSPEAGHPERSDAATAAARSRRAPTP
FT                   TPTPSTPALAGRIEGSARPEPVEARAGAAGAIFAPPLSPLPSERIPDDAVLAVVRGWVT
FT                   HLGPTTARDLAGRIGLPESAAASALLRLEAEGLVLRGTFLPDAPWSAEAPHWCERSVLA
FT                   RIHRLTLGRLRREIEPVSTAVFLRFLARWQHVAPGTRLHGAHGLAEVLGQLQGFHAAAG
FT                   AWERDLLPARVGGYEPALLDAACLSGEVAWGRLHVAPPQDGSPRRKGAPTRSAPVTLAL
FT                   REDLPWLLEAIAPEPPPLGEIATALVEVLARRGASFLAELAPAVGAPPGETEEALWELV
FT                   SAGLVTCDGFAGLRALIAPPPRGRVIRPGSAGGRWALLRAPGAIERAASGESATSSVSQ
FT                   PTLDHLAHQYLRRYGVVFRDLLAREPRPPPWRDLVRVYRSLEARGELRGGRFVVGFSGE
FT                   QFALPEAVDALRAARRAGDGHAERLDLSASDPLNLAGILTPGPRIPAVPGSRLVLEGGV
FT                   PAATPAPGTQVGTG"
FT   gene            464076..464600
FT                   /locus_tag="Anae109_0407"
FT   CDS_pept        464076..464600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24622"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C6"
FT                   /protein_id="ABS24622.1"
FT                   /translation="MLLKETALVRLLSLRIPVLLFVAPRVKRLDDEVCEIEIPLGWRTR
FT                   NHLGSMYFGALCVGADLAGGLHAARLTTFGPYRGVNLVFADVRGEFLKRADGDVLFRCT
FT                   DGARVAAAVRETHERGERVTLPVEIAAFVPEKYGDEAVARFTLALSLKRATGAPMRVVA
FT                   TPPSRGNAAGA"
FT   gene            464664..464846
FT                   /locus_tag="Anae109_0408"
FT   CDS_pept        464664..464846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24623"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C7"
FT                   /protein_id="ABS24623.1"
FT                   /translation="MRPLAQAAALAAALALAGPTAVAAAPRSPPGQFIEDDYDRARADA
FT                   RARGVPLVVDVWAPW"
FT   sig_peptide     464664..464738
FT                   /locus_tag="Anae109_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.537 at
FT                   residue 25"
FT   gene            464862..465992
FT                   /locus_tag="Anae109_0409"
FT   CDS_pept        464862..465992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0409"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: ade:Adeh_4014
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24624"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C8"
FT                   /protein_id="ABS24624.1"
FT                   /translation="MRAYVLPDERLRKLAGRFVWLDIDTEKPRNAAFVERFPIDAWPSI
FT                   LIVNPEDERVLVRWAGTATAEQIERLALDGERALRAGKASRAEEALARADRLLGERRHA
FT                   EAAAAFQEALAAGGPRFAARERASEAAVQSLGLAGAATECAATAQKLLPSLGGASAARV
FT                   AAQGISCALEQEEVAARRSAVAALEPRARGLLDDRRVLADDRSWLYDVLSSARSEAGDD
FT                   AGAKALARRWLAFLEREAARAKTPLARSAFDGQRLQAALRSGEPARALPALLASERDLP
FT                   HEYVPPTNLGVLYLALDRPAEALAAADRALALAEGPRRIRVLVLRAEAQAKAGDGAGAR
FT                   ATLERAVQEGEALPEAARPRGYLRKAKKLLGELRAS"
FT   gene            complement(466036..466728)
FT                   /locus_tag="Anae109_0410"
FT   CDS_pept        complement(466036..466728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24625"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C9"
FT                   /protein_id="ABS24625.1"
FT                   /translation="MKRPRPRPRPRPRPRPRPRPRPRPRPRPRLSNPGRTPPDSRCSIP
FT                   RPRLRSPAVRALVPLLLAALAAPAPAAPAAPAEKPTPPSVEARRDRIARELIQLAGELQ
FT                   RAIEAEDVATIVARVPAGGLRCGPRVVPRERVERELRSETSWLHGVLFGGPGHVPSPGV
FT                   ARSLRALFREASEVAVLVAFRRDPAAGAVGLPCVDYRAPGLGTPGAPLCFERRDGRWWF
FT                   TESLYPCR"
FT   gene            467231..468406
FT                   /locus_tag="Anae109_0411"
FT   CDS_pept        467231..468406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0411"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   ade:Adeh_0859 HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24626"
FT                   /db_xref="GOA:A7H7D0"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D0"
FT                   /protein_id="ABS24626.1"
FT                   /translation="MPAIAPSALDSTLLAQRLSELAGEERDVQVEFLLHLEVFDRRRAY
FT                   VDAGYPSLWAYCLEVLHLREGAAGRRIQAMRVLRRFPSLEGALRDGRLCISTVQLLGQV
FT                   LTEENLPDLVARAAYRTKAEVDHLVASLQARTAPRAGVRKLPDRASAASAPALPLAAAE
FT                   PARAEPQESPLAPPSSAAAAGVSPATMPAPSDPSRQRTRAVTRAVSESGWSLRVTIDRA
FT                   CKEDLETLTALLSHEFPDGDLAAVLREAIRCAIEKHGRRKGAVAPQRQRGTDREPRPSA
FT                   ESAAPTSTIPAIVRREVWKRDGGRCAWVAPDGRRCNSRGQLELDHIHPQALGGPSTVEN
FT                   LRVACKSHNLLHAEQTYGREHMDRFRRMGVAGVTPDASGAPPAPQQALWGP"
FT   gene            complement(468621..469769)
FT                   /locus_tag="Anae109_0412"
FT   CDS_pept        complement(468621..469769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0412"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: ade:Adeh_4012 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24627"
FT                   /db_xref="GOA:A7H7D1"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D1"
FT                   /protein_id="ABS24627.1"
FT                   /translation="MRFFATCAKGTEGALRRELSALRLPAVRGDRGGVSFEGPLEAGMR
FT                   ACLHARTAMRVLLELARFPAPSPEALYEGARAIAWDEWLTVRTTLAVEATVTSSAITHS
FT                   GYAALKVKDAAVDALRDKLGARPDVDPKDPDVRVVLHLARDEAALSLDLAGEPLHRRGY
FT                   RGASTVAPLKETLAAAILALGGVEPEAPFVDPMAGSGTLAIEHVLRARRIAPGLGRAFG
FT                   FQRWPMYRGGPQSAWDRMKAEARAAILPAAPAPVLARDLHTKALEAARRNAAAAGVAAD
FT                   VTIERADARELQPIAASGFLVTNPPYGERLMSGEEDPGVQQKKLAGFYRGLAEMLARHS
FT                   GWTAVILSGNPLLERAIRMRPEVDHRLWNGPLETHLLKYRIP"
FT   gene            complement(469780..470766)
FT                   /locus_tag="Anae109_0413"
FT   CDS_pept        complement(469780..470766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0413"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ade:Adeh_4011 diguanylate cyclase
FT                   (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24628"
FT                   /db_xref="GOA:A7H7D2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D2"
FT                   /protein_id="ABS24628.1"
FT                   /translation="MEPTRVRTPSRERPTEGLDAAAPPRAEPDPGRVAGTVAGSSALAR
FT                   AAWIGAAFGMTLCVGAADYLTGTDVSLILLYLAPIGFCTWFVTLRGAIALSAGGAVVAT
FT                   AADTLFRLESGGPALPVAVLGWNAVIQLGTSLALVLVLNALRVRLEAEELLARTDALTR
FT                   IANRRAFIEAASLELERARRHRRPLTFAYVDADDFKDVNDRLGHAEGDALLAVVARTLR
FT                   GATRAVDTVARLGGDEFGLLLPETDEPMAEALLGRLQATLQEVMARHGWGLRFSVGAAV
FT                   FRTPAVSVDEMMARADELMYTAKRAAKGSVRLGVYDGGARASAARPR"
FT   gene            complement(470799..471956)
FT                   /locus_tag="Anae109_0414"
FT   CDS_pept        complement(470799..471956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0414"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /note="KEGG: ade:Adeh_4010 outer membrane protein,
FT                   OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24629"
FT                   /db_xref="GOA:A7H7D3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D3"
FT                   /protein_id="ABS24629.1"
FT                   /translation="MRRIGERLDGERPSWGGARYDGVRMHRHALPFALAIALGCATAPV
FT                   EPLSTLTPNGAILRGADLARTRCLLVAPFENASDVALAAEAATSAFVSGVDPSRARVFP
FT                   IPELREVFRDTPLELPAGIAPSLALELAELVGADAAVYGTVEGGGKGEDAPLLVSVRVA
FT                   VTGAHRLLFARNAVVRAQPGEAPEDAVRRTVDELARPLLARIGDPGRKQCFDPERTRAL
FT                   RRFALAEPRPDRRAEPQSAPGPAVAPVAATSAPAAAAPRTPRQTEWARKLAAGERLVVD
FT                   DVAFAGRTAELLRDGGLADLAIALAAAPGVTVRIEAFVDASDDRAGDGKLSEEMARTAG
FT                   ERLHQLGVARARLAWSGRGGESPLLPNFTARGRAANRRIEVAPGR"
FT   gene            472001..472696
FT                   /locus_tag="Anae109_0415"
FT   CDS_pept        472001..472696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0415"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ade:Adeh_4009 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24630"
FT                   /db_xref="GOA:A7H7D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D4"
FT                   /protein_id="ABS24630.1"
FT                   /translation="MTSVLLVDDERDLLSLLDFNLRAAGFETLLATTGEQALVQLRRRI
FT                   PDLVVLDLMLPDVSGTEVCRQIKADARTRHVPVVMLTAKGEEVDRVVGFEVGADDYVTK
FT                   PFSVRELVLRLKALARRTGAGRPAERPPEQVGPIRVDVDAHRAFVDGEEVQLTPLEFRL
FT                   LTMLMARLGRVQSREQLLEDVWEMSSEVETRTVDTHVKRLREKLGSGRDLLETVRGIGY
FT                   RLVDPREKG"
FT   gene            472702..473835
FT                   /locus_tag="Anae109_0416"
FT   CDS_pept        472702..473835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0416"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; KEGG: ade:Adeh_4008 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24631"
FT                   /db_xref="GOA:A7H7D5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D5"
FT                   /protein_id="ABS24631.1"
FT                   /translation="MFGRTPLAAAIQALRAELAGGPRADLGRDVRELADLLSARAQRRP
FT                   GTLYPEAPEQELLAALPDAAALVSREGWVRVSNAAFDTLAATGRAAGLTPLEITRSAEL
FT                   SEAVRRALEGTARRLDLQLGRRSYLVHLAPLLRGEVLLSLRDVTEARRAEATRRDFVAN
FT                   ASHELRTPVAAIRAAAETLLAGAVDDPAGARQFVEIVARQAERLARLTEDLLDLSRLES
FT                   RQWSFDLAPVDAAAVSTQAVELLALTARDKGLEIAAEVPAGATVRADARALEQVLVNLL
FT                   DNAVKYTGEGEVTLRGERDGDAWVLSVADTGPGIDRHHLPRIFERFYRIDAGRSREQGG
FT                   SGVGLAIVKHLVQGMGGEVGVESGTGGTRFWVRLPAV"
FT   gene            473968..475176
FT                   /locus_tag="Anae109_0417"
FT   CDS_pept        473968..475176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0417"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   ade:Adeh_4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24632"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D6"
FT                   /protein_id="ABS24632.1"
FT                   /translation="MNRLTAVLAAIALVPALARAQDAAAEQQDPAAAQGATEESSFDAS
FT                   AMQGKVDSLAEQYAETKTDVAKLKKLKLSGYVQGRYAWQESAAADFNTTPESAPSQQGF
FT                   FVRRGRFKATYDADWSQFAVQLDATPAGVSAKEAFASIKLPWKGFAVDAGLQLFPFGYE
FT                   VAVRSSSDLDLLERSAVTRAYIADEYDLGVALRGAYGIMNFKVGLFNGNGVAAKQAGVD
FT                   NDQRKDVIGRVGFDLGMLTGGVSGWYGTTVNYVASDDPDYDRYRLGADAQLFLDLVPVG
FT                   GTALKGEYIWGRTTLSDKNGGAGDRLGDTGHGWYALVTQNVWRWNQLAVRYEEFTPDHT
FT                   VDLTTGTAVKTGREIQAALHTFVGEGGKISLAWYHPMNGDRASGVSSDPKRDQFIVQAQ
FT                   AKF"
FT   sig_peptide     473968..474030
FT                   /locus_tag="Anae109_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.973 at
FT                   residue 21"
FT   gene            475217..476029
FT                   /locus_tag="Anae109_0418"
FT   CDS_pept        475217..476029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0418"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   ade:Adeh_4006 ABC transporter, periplasmic phosphate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24633"
FT                   /db_xref="GOA:A7H7D7"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D7"
FT                   /protein_id="ABS24633.1"
FT                   /translation="MKRTLIALVAAIAPALASAAVTVKGSDTMVILAQRWAESYMKQNA
FT                   GKRVQVTGGGSGVGIAALINGTTDIANASRDMKSAEKAKVRERYNVLPTEIAVAKDGVA
FT                   VYVNAGNPVEQLTIEQLEKIYAGDVTNWKDVGGSDAPIVLYSRENSSGTYVFFKENVLK
FT                   GADFASSAQTLPGTAAVVNAVSKEKNGIGYGGAAYAKGVKEVKVVGADGKGYAPDADSV
FT                   ATGKYPLARPLFMYTRAKPAGEVKAFIDYCLSPEGQKIVTQVGYFPVK"
FT   sig_peptide     475217..475276
FT                   /locus_tag="Anae109_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.904 at
FT                   residue 20"
FT   gene            476112..477089
FT                   /locus_tag="Anae109_0419"
FT   CDS_pept        476112..477089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0419"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ade:Adeh_4005
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24634"
FT                   /db_xref="GOA:A7H7D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D8"
FT                   /protein_id="ABS24634.1"
FT                   /translation="MVGSEERARPAPSMRRRQIREAAIQAAITLVALTGIAAVVLIFVF
FT                   VAREALPIFTSPEVREETDLARMFLPQAWREGRAAFFSWQPVSDVPKYSMVPLFVGTLK
FT                   VTAVAMLVSVPVGIAAAVFTSEFAPRRLREVLKPTIELLAGIPSVVLGFFALMVMATVL
FT                   QGAFGFTSRLNAIVAGLALALTVVPVIFTVSEDALAAVPRSYREASLALGATRWETSFK
FT                   VVLPAAAPGVLAAVVLGFGRSIGETMIVLMASGNAAMTTWSLGDSVRTLPATIAAEMGE
FT                   VVFGGAHYSVLFFIGVELFLFTFVLNMLASLFVKRLVRRMAGTA"
FT   gene            477086..478000
FT                   /locus_tag="Anae109_0420"
FT   CDS_pept        477086..478000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0420"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ade:Adeh_4004 ABC
FT                   phosphate transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24635"
FT                   /db_xref="GOA:A7H7D9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D9"
FT                   /protein_id="ABS24635.1"
FT                   /translation="MSVASRKVVGTGLTVLTGATAALVVAMLAVILVDVVRGGAARVSW
FT                   EFLTAAPEEGMTAGGIFPAIYGTAIMTLIMTVAVMPVGVLTAVYLHEYAAPRSRMAALV
FT                   RVAVTNLAGVPSIVFGLFGLGFFIQFVGGSLDRAFSPPGELFYGRPALLWAALTLAVLT
FT                   LPVVIVSTEEALRAVPRDHRDASLALGATKSQTLVRVILPQALPGILTGAILAVARGAG
FT                   EVAPILFTGVAYFLPDLPGSVWSQFMHLGYHVYVLATQSPDIDATRPLLYATVFVLLAL
FT                   TFALNLLAIAIRTRTRRKAAAGH"
FT   sig_peptide     477086..477166
FT                   /locus_tag="Anae109_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.661 at
FT                   residue 27"
FT   gene            478005..478787
FT                   /locus_tag="Anae109_0421"
FT   CDS_pept        478005..478787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0421"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; KEGG:
FT                   ade:Adeh_4003 phosphate transport system permease protein
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24636"
FT                   /db_xref="GOA:A7H7E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E0"
FT                   /protein_id="ABS24636.1"
FT                   /translation="MTSLLQPLPAAVKMETRGLEIRYGAKLAVKGVSLSLPEHQVTALI
FT                   GPSGCGKSTFLRALNRMNDLIPGASAAGEILLDGRSIYAAHLDAVELRRRVGMVFQKSN
FT                   PFPKSIFENVAYGLRVGGLGDRRELAERIERSLRSAALWDEVKDRLAESAMGLSGGQQQ
FT                   RLCIARALAVEPEVLLMDEPASALDPIATAKIEDLIHELKARYTIAIVTHNMQQAARVS
FT                   DQTAFFYMGELVEVGPTEAIFTNPREQRTEDYVTGKFG"
FT   gene            478810..479505
FT                   /locus_tag="Anae109_0422"
FT   CDS_pept        478810..479505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0422"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   ade:Adeh_4002 phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24637"
FT                   /db_xref="GOA:A7H7E1"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E1"
FT                   /protein_id="ABS24637.1"
FT                   /translation="MVTTHTDKAYEAELKDLRDKLLEMGGLVERAMAASVRSITERDTP
FT                   LAEQVKERDREINRMEVAIDSACRRVLALRQPAASDLRFITTALKIVTDLERMGDLAVN
FT                   VAERAIDLNKVAPLGPLHDLSRLAEMSETQLKHALDAFVTGDVAKAEDVMRSDEHLDAL
FT                   YLKIFNDLLAMMMEDSRNIRRATSLMFAAKHLERFGDHATNLAEMVVYMVRGTDVRHPR
FT                   SRAPSAPPA"
FT   gene            complement(479880..480386)
FT                   /locus_tag="Anae109_0423"
FT   CDS_pept        complement(479880..480386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0423"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bba:Bd1011
FT                   phosphohistidine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24638"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E2"
FT                   /protein_id="ABS24638.1"
FT                   /translation="MELLVVRHAIAEDRDVFAATGRDDPERPLTAEGRRRFEKGARGLR
FT                   ELVESIDVLATSALARAKETGAILAAAYELRGASQLGELAPESDPAALVPWLRKHRARS
FT                   RVAIVGHEPHLSRLVQYLLTGSAGRGFVALKKGGACLLSLGDTQLVGGAQLRWLLTPAQ
FT                   LRRLG"
FT   gene            complement(480650..481258)
FT                   /locus_tag="Anae109_0424"
FT   CDS_pept        complement(480650..481258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0424"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: bte:BTH_II0398 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24639"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E3"
FT                   /protein_id="ABS24639.1"
FT                   /translation="MRIRSVSGGNDMRKLTFAAALLAPTLVLGQGTGGTTTGAGSSGSG
FT                   AAGGAAPGSTAGQTGTGSTAADPTATGTPSGTAGTAGTTGGAGTQACPPGMVPATSAGM
FT                   PSTAGSGTTGTGSAQGTGSAGGSSGTAASSGTAGATGASGACVPAGSTGGTGAGGATQS
FT                   PGAGGNADVAPPAGGAAQGSGSGTSGSVGGASTPGSQRP"
FT   sig_peptide     complement(481169..481258)
FT                   /locus_tag="Anae109_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.732 at
FT                   residue 30"
FT   gene            complement(481378..482007)
FT                   /locus_tag="Anae109_0425"
FT   CDS_pept        complement(481378..482007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0425"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   ade:Adeh_4001 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24640"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E4"
FT                   /protein_id="ABS24640.1"
FT                   /translation="MTDDRETGLPAGTFELDAGGGASITIDPATATAVIRDGRLARILS
FT                   LDEALLLSFRRFHSPWRTIVARTLTHLGDAKSWTFAGIALLATGSAHGRHLGLRLGAAT
FT                   LLATALSQTLKRSLTRARPDVSIAGFEALAANPDRFSFPSGHTAAAFSVAVAFADEPFG
FT                   LGPLALLLSVGIGLSRVYLGAHYPLDVGAGALLGVVAGLASRLLVS"
FT   gene            complement(482004..482804)
FT                   /locus_tag="Anae109_0426"
FT   CDS_pept        complement(482004..482804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24641"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E5"
FT                   /protein_id="ABS24641.1"
FT                   /translation="MNDRHPGRTASRAAPLLGLALALATGCAAQRAASPATSPSAVSPP
FT                   APEAGARAGDEPPDAGAESTWGARDSAAPKDAEPAAVAEGDPELEAVRARVVDAARALV
FT                   GRRFRGDCSAFVLRAFHEAGVRVRLGPGVSRSESLHRASRPLETPRPGALAFFHDSYDR
FT                   DRDRRRDDRFTHVALVERVEGSSVILLHRARKGVERTRMDLSRPGDPDANGRLRVRRRG
FT                   DPRGTRYLTGELFAAFGELLEGEFTQMLQAGRAVETDDRHPAPR"
FT   sig_peptide     complement(482706..482804)
FT                   /locus_tag="Anae109_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.607 at
FT                   residue 33"
FT   gene            complement(482801..483778)
FT                   /locus_tag="Anae109_0427"
FT   CDS_pept        complement(482801..483778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0427"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; KEGG:
FT                   mxa:MXAN_0035 ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24642"
FT                   /db_xref="GOA:A7H7E6"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E6"
FT                   /protein_id="ABS24642.1"
FT                   /translation="MRRRAPLLALALSAALGCSRAKGPDAPLRLGYFPNVTHAQALVGV
FT                   DDGTFARALSGRLETRMFNAGPAAMEALLAGDLDASYVGPGPAAIAFLRTHGEALRVVA
FT                   GAASGGAALVVKDARAPKDLAGKRVASPQLGNTQDVALRMWLRQQGLQDARGQGPVEVT
FT                   PLANPDILALFARGDLAGAWVPEPWAARLVAEAGGRILVDERSLWPEGRFPITVLVVSA
FT                   RALERRRADVIALVRAHLELTRRWEADRAAFARLANAAYGKRAGKALPDAVLLDALSRV
FT                   EPVSDPLPRQLERMARDAQELGFAPKGDPSGIVDATMLQEIARR"
FT   sig_peptide     complement(483713..483778)
FT                   /locus_tag="Anae109_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 22"
FT   gene            complement(483775..484539)
FT                   /locus_tag="Anae109_0428"
FT   CDS_pept        complement(483775..484539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0428"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_3998 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24643"
FT                   /db_xref="GOA:A7H7E7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E7"
FT                   /protein_id="ABS24643.1"
FT                   /translation="MRASLRTGLLLLVPLVVWELLSRIGPWPHWLFPGPLAVAGSLGRM
FT                   LADGRLGAATGRSLARLAQGYTFSAVAGVPFGVLLARSELVRGGLRPIVLGLQALPSIC
FT                   WLPLAILWFGLSETAILFVVVMGSVFAIAIATEDAVSGVDPLLLRAAGTLGIRGARFHG
FT                   GVLLPAALPGILTGLKLGWSFAWRALMAGELLFVAGGLGQLLQNGRELLDAAQVMGVML
FT                   AIVAIGVAIDRVLFRVVELRVRRRWGLVEEPA"
FT   gene            complement(484472..485413)
FT                   /locus_tag="Anae109_0429"
FT   CDS_pept        complement(484472..485413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0429"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_3997 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24644"
FT                   /db_xref="GOA:A7H7E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E8"
FT                   /protein_id="ABS24644.1"
FT                   /translation="MWRQVSERFSRLARELRVRRRRRGLLTPRVRRSGPPKIDVSRVGH
FT                   RFANKVVALHDVNVEVHAGEFVCLVGPSGCGKTTLLYALAGHLEPSGGRITIDGLRVKG
FT                   PGPDRLLVFQEPALFPWLTVRQNLVFALRARGLPRADADARAREYVARVHLEGFEETLP
FT                   HELSGGMRMRVQLARALALDPAVLLMDEPFAALDAQTRSHMHELLQQVWLRDRKTVVFV
FT                   THDVREALVLGDRVIVMAARPGRVLQDLDVRLPRPRDPDDEALVGMSRRIRDELRRAEA
FT                   AGGTDATEERDARIAADGTAPARPPRRLGAPL"
FT   gene            complement(485514..486458)
FT                   /locus_tag="Anae109_0430"
FT   CDS_pept        complement(485514..486458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0430"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; KEGG: ade:Adeh_3996
FT                   putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24645"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E9"
FT                   /protein_id="ABS24645.1"
FT                   /translation="MPKERIFCACAPGLEPILAAELAALGLEARAVRGGAEASGEDAAA
FT                   VACLASRTADTVLLRLWEGDASGLAAAKRAAARRAAGARLEIRTGPGRATISVDAAGAP
FT                   LFRRGWRARVGAAPLRESLAAGILLASRWAGDRPFLDPMCGSGTLAIEAALIAARRAPG
FT                   LGRAFAFEGLPGHDAARTERLRAHLAALARPVAVPIHASDRNAGALRLAQKNAAAAGVG
FT                   DAIRFSREDAALVRPPAGAGLCAVNPPYGVRLDADVTAAWRALGALLPRLAGWEVAVLG
FT                   PDRGYEGLLPLAPAAALPVSNGGISCRLLRFTP"
FT   gene            486585..487394
FT                   /locus_tag="Anae109_0431"
FT   CDS_pept        486585..487394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0431"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ade:Adeh_3994 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24646"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F0"
FT                   /protein_id="ABS24646.1"
FT                   /translation="MRLGGFVIHGNNADTLARCLDAIAAVADEVVAVDSCSSDGSAELV
FT                   RARGLRQVVHRWEGYGAARQVATAALQGCDYVFFLDSDEWLEAPAIAALRAWKASSPDA
FT                   PHYSLARRDWAELPHRRFLFRTERHVRLVRRDHARWEPSMIVHEALPPAPTVRLDAHVE
FT                   HRFATSVEAMRSKVDRYALLWAIRFHAEGRRAKPPALQKVVHALKEALVHGALFRGGRD
FT                   GIRLAEAVAHYHARKYALLGDVRRGGHPELVRAFAERRFADVYRLLP"
FT   gene            complement(487386..488564)
FT                   /locus_tag="Anae109_0432"
FT   CDS_pept        complement(487386..488564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0432"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="KEGG: ade:Adeh_3989 major facilitator superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24647"
FT                   /db_xref="GOA:A7H7F1"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F1"
FT                   /protein_id="ABS24647.1"
FT                   /translation="MRAFSAESRLSARPARRAAALVILTLPLLDRAALAAVLERVRADL
FT                   WLTDLQLGLAAGLPAAIAALLAFRRPLAAPGRLRRASGALLWGAAAALAGAARGAWTLF
FT                   AARLVAGGAAGAGRRAALVVEGGVAVRPPLRDAALIVPAMTLAALGYAGAGALGWRLGW
FT                   RAALVAAGAASVVLTLAAAWLARREPGAALAPVAARAAADRAYASRPAIAGGALVAFAA
FT                   AALATWAPAFLERARGVPRAIAPLEIAAAALMAGVAAAWARPTLAKTLRDPRWLCSGAA
FT                   LASAPLALAALLARQPGVYLAALVAALALALVALATLRDALALDAPRDGSAAASAALPW
FT                   VALLGDAPAALLVGLASHATSLWWAMLAVPAALLAGGALLALVARRPREPSG"
FT   sig_peptide     complement(488457..488564)
FT                   /locus_tag="Anae109_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.918) with cleavage site probability 0.728 at
FT                   residue 36"
FT   gene            488787..490385
FT                   /locus_tag="Anae109_0433"
FT   CDS_pept        488787..490385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0433"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_3988 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24648"
FT                   /db_xref="GOA:A7H7F2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F2"
FT                   /protein_id="ABS24648.1"
FT                   /translation="MISVQNVTKAFGPKKLFEDVNVAFSPGNRYGLTGPNGAGKTTFMK
FT                   ILAGDEEADEGSVLRPKKLGILRQDHFRYEDNRVLDVVLMGNVGLWSALQQKEALLAKD
FT                   EISEEDGTRLGELEGTIAEEDGYSAEADASELLQGLGIEQPWHDQPMRALTGGYKLRVL
FT                   LAQALFGKPQGLLLDEPTNHLDIESIRWLEKFLHAYEGVLITISHDRHFLNAICTHIAD
FT                   IDYETIITYPGGYDDMVRHKGQVRSRVESENAEKKKKIEQLREFVARFHAGTRASQVQS
FT                   RIRAMQKLKLEDMKRSNIQAPFIKFEQKAPSGKQTLTLEAIEKRYGGNEVVQPFSALVT
FT                   RGEKICVIGKNGVGKTTLAKMIAGELQPDHGHVKWGHQAQVGYLPQDQQGVIRPGTTAF
FT                   GWLRELEDKLSNEEISGLLGRMLFSGEERMKPTATLSGGETVRLLLAKLMLFKDNVLVL
FT                   DEPTNHLDLQSIAALSEGLQRYEGTIIVVTHDQELIREVGTRIWSMHQGEPVLDFPGTF
FT                   DEFVAKHPDLATAHA"
FT   gene            490513..491298
FT                   /locus_tag="Anae109_0434"
FT   CDS_pept        490513..491298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24649"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F3"
FT                   /protein_id="ABS24649.1"
FT                   /translation="MREVVVAVLSLGFALGARAAEFEGKAEYRVKGVGAGPARDGSAVV
FT                   YLSPKGSRSEVEIAASPELASQGMTEPMRMISIVKAGEPGRAYVVNPGTKSYSVLDGQP
FT                   EGKAGSWTVERAGSDRVGGVGCERARISGSGGERFEVCITRELGTVGSWAASGGGQDAE
FT                   LPRALKKAGLDGLPARWSVVDPATGAPQMTMELVRAARQKVPAAMFEIPAGYAKTSVPQ
FT                   ASPEMQRKLEEAMKDMPPEQRKQLEEMMRRGGGDRPPGR"
FT   sig_peptide     490513..490572
FT                   /locus_tag="Anae109_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(491303..492094)
FT                   /locus_tag="Anae109_0435"
FT   CDS_pept        complement(491303..492094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0435"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: ade:Adeh_3985 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24650"
FT                   /db_xref="GOA:A7H7F4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F4"
FT                   /protein_id="ABS24650.1"
FT                   /translation="MHPFLSLPSPWLVAHRGGSALAPENTLAAFELAAELGADAIETDV
FT                   RRTRDGVVVIFHDETTERLTGAPGTIEERTLAEVKALDAAAGFTRDGGRTHPRRGTGIA
FT                   IPTFAEALARHPAMRFIVDAKADDAALAEALADAVRAAGAERRVCVGSFFDAQAERLGA
FT                   LLPGCARYLPQDAAKCHVLAALSGGDASSCPGGYELASLPARMGELQVVSPPVVAHFHA
FT                   RGMPVHAWTVDDAEEMRALLAVGVDAIVTDRPDVLRSVLGR"
FT   gene            492255..493088
FT                   /locus_tag="Anae109_0436"
FT   CDS_pept        492255..493088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24651"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F5"
FT                   /protein_id="ABS24651.1"
FT                   /translation="MRRQVKGEAVRRELLPGTSPELLKELHLLTRAGDLNADSLRKLKQ
FT                   VNHLAGLLAPALDDVLARFGDPVLVDCGAGKSYLGFVLYELFLRAAGKGRLLALESRPE
FT                   LARAGAERAARLGFERLRFVEASIAAAPVPERVHLVTALHACDTATDDALALAIRHGAD
FT                   HVAVVPCCQAEVARQLAGAPAPSPLLAPLFDHPWHRREFGSHLTNVVRALALEAAGYKV
FT                   TVTELTGWEHSLKNELILGRKVRSGSREARERLDALLAAAGVRPKLVRLLAGEEA"
FT   gene            493131..493871
FT                   /locus_tag="Anae109_0437"
FT   CDS_pept        493131..493871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24652"
FT                   /db_xref="GOA:A7H7F6"
FT                   /db_xref="InterPro:IPR025749"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F6"
FT                   /protein_id="ABS24652.1"
FT                   /translation="MVLRRVQGEPAGASASPPLGAGARGLAGLRALWPVLLGALAFRAA
FT                   CYVVMTAAAIWNERRPAPALPDLVLSWVPYVDWVARANYLLWLVAYVPLALVLLWRAPG
FT                   RFARYTVTGGLVSLARGATLMLTGLGAPPPHAGGAGIAGHSFGEVLLSLMSPWQVFADG
FT                   AMGAYLTQDLFFSGHTATTFLLVLYVWRSPPLRLAALGAHLLVVASVFLSHLHYGIDVV
FT                   GAYAVTFAIFALREGWPARAGAPA"
FT   gene            complement(493881..495737)
FT                   /locus_tag="Anae109_0438"
FT   CDS_pept        complement(493881..495737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0438"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: ade:Adeh_3981 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24653"
FT                   /db_xref="GOA:A7H7F7"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F7"
FT                   /protein_id="ABS24653.1"
FT                   /translation="MTTPSSLPPDTEGSPAKVAGTRLERGLLALFLLAMVALPAASTVS
FT                   RRLVGRELPGSAVLAQHITLWVGFLGALLATASGHHLALSTIELVPAGTPRRIARFFTA
FT                   AVSAAACALLAWASAVLVAVEWKGFGTVAFGIRVAWSELVMPIGFGFMALRFAWRAGEG
FT                   AARWPLRAAALAIAAAAFALGRAEPAPLLVWILAAVVLAAFLLGAPVFVAMSGFAMALF
FT                   FRDGGPEAIAAVPTATFNLVSSATLPAIPLLTAAGYVLAEGGAAQRLVRAYKGIFGWMP
FT                   GGVAIMATFVCALFTTFTGASGVTILALGGLLLPALRREGYPEDFSVGLVTASGSLGLL
FT                   FPPSLPVILYGVVAQAPIDHLFLGGLVPGLLMIVLVAAYGVAVGVRSHAPRERFEPREA
FT                   AAALWAAKWDLGLPTLVVVSVATGFATIVEAAALAAAYSILVELAIFRSIHPLRDLPRV
FT                   LVDAAALVGSVLILLGTALGLTSWFVDAEIPTLLVDWMTATVKSPALFLLMLNAVLLVL
FT                   GSVLEIYSAIVVLAPLVAPLGAAYGIEPIHLGVVFLANLELGFLFPPMGLNLFLAASRF
FT                   GKPLPYMYRKALPFLVIMSAGVLAITYLPAITTGVVQLLVGD"
FT   gene            495882..496721
FT                   /locus_tag="Anae109_0439"
FT   CDS_pept        495882..496721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24654"
FT                   /db_xref="InterPro:IPR031823"
FT                   /db_xref="InterPro:IPR038537"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F8"
FT                   /protein_id="ABS24654.1"
FT                   /translation="MSFVSDAVAQSGSSYATDDDPELVRGAVPFGLKTMEGLLSEDPHH
FT                   EGLLRALAGNFTQYAYAFVQADADLADLQGNLDAARAGRERARKLYLRARDYGLRALEQ
FT                   RHDGLSKRLREGRDVAGALKAAEKKDVEVLYWTASAWTLAIANGKGDMGLVAELPVPVA
FT                   MMERALALDEKWGQGALHEYFVSLDAARGEVEGGGPARAKAHLERALELSMNKKLGPRV
FT                   AYAEGVLVKQQDRAAFERELGVVLQANPDEAPEHRLANILAQRRARALLDHVDDLFL"
FT   gene            496738..497718
FT                   /locus_tag="Anae109_0440"
FT   CDS_pept        496738..497718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0440"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: ade:Adeh_3979 TRAP dicarboxylate transporter-DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24655"
FT                   /db_xref="GOA:A7H7F9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F9"
FT                   /protein_id="ABS24655.1"
FT                   /translation="MKKLLLAALFAALATTARAQTVTLKLGTLAPQGSTWHDILREMGQ
FT                   KWEQASGGKVKLRIYAGGAQGSEGDMVRKMGIGQLQAAAISNVGMHDVIPEPQALSVPF
FT                   LFQSEAQMECAFEKVRPRIEQALEKRGLVALQWSRIGAIHLFCDSPFKTPAEVSRAKIW
FT                   AWEGDPKSVEAFRAAGLQPVVLSANDMYPSLQTGMIDCVPNVPLYVLTARLFEKANHMV
FT                   DVSWAYMIGATIVRKDAWEKIPADVRPKLLEIAQSLGRKVDDEVRRLNTDAVTAMQKQG
FT                   LQVVKVDPGPWRQAMEKSWTVVRGGVVPAEFFDAVKSARDACPAK"
FT   sig_peptide     496738..496797
FT                   /locus_tag="Anae109_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(497727..498653)
FT                   /locus_tag="Anae109_0441"
FT   CDS_pept        complement(497727..498653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24656"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G0"
FT                   /protein_id="ABS24656.1"
FT                   /translation="MIRPMAPLLDRAIDGLAMWMEDRRPREPMGFRPAPAASLDCFGPL
FT                   PVLPAGPPREGAWHAPSPRPAEGDATMAVHAQAARGPRRGTALLVPPWKVPRLAAVSGY
FT                   ARLLARAGYAVWTLVPPRHLHRAPPGLRSGEGFVSPDLPALRAAFEQLVLEIRILVTLA
FT                   RAEGGTVGVVGLSLGALGAALAATAPEPLDFAALVAPPADLAAVFAGTPIGRRYLSLAR
FT                   RAGAPVPPPDALSRMLAPFRADQRRPTARRVLVAVGTDDRIALGAGALGLAAAWGAAAR
FT                   RYPRGHLTLLFACRALRRDLARFVAAG"
FT   gene            complement(498696..499076)
FT                   /locus_tag="Anae109_0442"
FT   CDS_pept        complement(498696..499076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0442"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_3975 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24657"
FT                   /db_xref="GOA:A7H7G1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G1"
FT                   /protein_id="ABS24657.1"
FT                   /translation="MLPTVARPARILVVEDDVAIRQTLAELLADEGFEVACASNGAEAL
FT                   DHLSCSAAPSLILLDLAMPVMDGWKFRSAQREDPRLARIPTVVVSASHSADRRCAEELA
FT                   PDAFLAKPFDLDSLMSTIHRLC"
FT   gene            499279..500211
FT                   /locus_tag="Anae109_0443"
FT   CDS_pept        499279..500211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24658"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G2"
FT                   /protein_id="ABS24658.1"
FT                   /translation="MAENEGSSGSAAAVFGRARPPSVSLPDRGVVIGLRWSGVEGAGNQ
FT                   ILAAKIECGRTKVRLTRLWRPFTDAPGRRDVHVRFAGWLAEEAKWAEGRLVVGVDFALS
FT                   LSETHLRQLGLLRQALRGPAVLGRNLHERFVGAGGDFTEGAARFRDELGKDRPRATDCY
FT                   RGELAPPTSARTYRQTFFGLCTLAHVQASFLPWDPPQPGRPSIAEVRPAHVARVLCGVC
FT                   GYRDDDRDGVARASTRAAILRTLRSAAKLEFEMEQAAQVVEDGRGEHLDAVLAATGAAA
FT                   ASEDGFQGVPSNVPRSEGWIHSVREEPWR"
FT   gene            500202..500864
FT                   /locus_tag="Anae109_0444"
FT   CDS_pept        500202..500864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0444"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   ade:Adeh_3973 uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24659"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G3"
FT                   /protein_id="ABS24659.1"
FT                   /translation="MALRVKGSRPRKASSVVAALEAVHRDIQAFRPDGFGPPVHGPAVA
FT                   SRILLVGQAPGPHEARFGRPFAWTAGKTLFRWLERATGADEQTVRARVYIAAVVRCFPG
FT                   KTTGGGDRVPSPEECALWRGFLAREVEILAPRLVIPVGRLAIQEVLGHTEPIAAVVGRT
FT                   LRTQFHGVNVDVLPLPHPSGASTWFKMEPGRTLLEDALALLARHPEVARAFPRRAAR"
FT   gene            500861..501289
FT                   /locus_tag="Anae109_0445"
FT   CDS_pept        500861..501289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0445"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: ade:Adeh_3972 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24660"
FT                   /db_xref="GOA:A7H7G4"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G4"
FT                   /protein_id="ABS24660.1"
FT                   /translation="MTARRSRPLGRVALAVLLGAVAACSHAPRHAPDESPRRPSAEAPA
FT                   ASGEVGLASFYGKRFHGRRTASGARYDMNAMTCAHPRAPFGARLKVTDLENGRSVVVTV
FT                   NDRGPFKRGRVVDLSRAAARKLGMIERGLARVRVERAD"
FT   sig_peptide     500861..500938
FT                   /locus_tag="Anae109_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.887 at
FT                   residue 26"
FT   gene            complement(501345..502811)
FT                   /locus_tag="Anae109_0446"
FT   CDS_pept        complement(501345..502811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0446"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: sth:STH2088
FT                   two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24661"
FT                   /db_xref="GOA:A7H7G5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G5"
FT                   /protein_id="ABS24661.1"
FT                   /translation="MNVAAAIAAAAALVAVLSGALSRRLSFAPGWRDQQGFSLVAFSAA
FT                   AYSVCNLATTLGLPDAVVTVTSRFQVASALAHFWAWLGYSATFVGMREDRLRMGVRRGI
FT                   LALAALATLPGVVFSDRVVSHEFPAFGAVYRDALPTSFGYAVFAALLVASVVTWYRFLR
FT                   AWRGGVRHAGVHAVAFGALILFGLNDALATTGQVPLPYLLDTGFIVPIVAVYWTLTVRF
FT                   ADNARALHSMRARLEELVEARTRALADAQAALHQSEKLAALGRFATAVAHEIRDPAAVI
FT                   TTNLRLLEDALRRADAAAPEAHEALADTLAALDRLGALVRALADAGGAAAVEPGGRTAV
FT                   GEAVRATISDARIRAGDRIRILEEIPEGLVVRARPENVVHVLGSLLANAADAVPDGRAG
FT                   RVEVRAERRTGAVRITVSDDGAGMPPEVLRRAFDPFFTTRRDERGRGLGLAIARGVVEG
FT                   SGGAIWLESEPGRGTRAVLELPELEDSGPA"
FT   sig_peptide     complement(502743..502811)
FT                   /locus_tag="Anae109_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.292 at
FT                   residue 23"
FT   gene            complement(502808..503500)
FT                   /locus_tag="Anae109_0447"
FT   CDS_pept        complement(502808..503500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0447"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   ade:Adeh_3971 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24662"
FT                   /db_xref="GOA:A7H7G6"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G6"
FT                   /protein_id="ABS24662.1"
FT                   /translation="MPLPPIRIAPSILSADFGRLAEEVRAIEAAGADVVHVDVMDGRFV
FT                   PNITIGPLVVEAVRKVTKLPIDVHLMIVEPERYVEAFAKAGADLLSVHAEASPHLHRTL
FT                   QAIRAAGARPAVALNPSTPLSAVEWVIEECEMVLVMTVNPGFGGQRYIEACTDKLRQLR
FT                   ALADARNPSLEIEVDGGVNAERAGLVAGAGANLLVAGTAVFGAPDYRAAISALRAGAEA
FT                   ARAGGARR"
FT   gene            complement(503590..504909)
FT                   /locus_tag="Anae109_0448"
FT   CDS_pept        complement(503590..504909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0448"
FT                   /product="NusB/RsmB/TIM44"
FT                   /note="PFAM: Fmu (Sun) domain protein; NusB/RsmB/TIM44;
FT                   KEGG: ade:Adeh_3970 NusB/RsmB/TIM44 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24663"
FT                   /db_xref="GOA:A7H7G7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G7"
FT                   /protein_id="ABS24663.1"
FT                   /translation="MSARQIAFEVLRRVDEGGAYASRALDAALTGAGALDPREAGLATE
FT                   LVYGTLRRSLTLDAALAPHSRRPVGALDPPARVALRLGAYQLLFMGKPPHAAVGETVSL
FT                   VKAVDHGRAAGYVNAVLRALARAPALPEPPPLSVDPAGHVALAEALPRWLAEEWVEWLG
FT                   PAEALALARGMNQPAPLTVRSPARDALVERARSAGLAAEPTRRSPDGVLLAGASVAALA
FT                   RAAGGLPFQVQDEAAQLVTLYAAGGLRGTRARVLDACAAPGGKAFHLAEQLAPGSEVVA
FT                   VELHPRKAEELAREAARRGLAGVRVVCADAARPIPGLEAGSFDAVLVDAPCAGLGTLRR
FT                   HPELKLRRVPEDLARMAVLQADVLAGVARYARPGAPITYSICSLSRVEGPRVVEAALRS
FT                   GLARAGGGAVPSDVLTAEGDLLTLPHRHGTDGFYAARLVG"
FT   gene            complement(504906..505934)
FT                   /locus_tag="Anae109_0449"
FT   CDS_pept        complement(504906..505934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0449"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: ade:Adeh_3969
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24664"
FT                   /db_xref="GOA:A7H7G8"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G8"
FT                   /protein_id="ABS24664.1"
FT                   /translation="MTRTSTSTSTWAAPSPLDRALDPAYTDPLMRIVFMGTPAFAVPPL
FT                   DALARAGHEVAAVVAQPDRPAGRGQALREPATKVWARAHGVAVLQPEKVRDGRLARELE
FT                   ALRPDLLAVAAYGRILGSDLLQLAPHGALNVHGSLLPKYRGAAPIQWAIAEGEAETGVS
FT                   IMQMDEGLDTGDVLLQRVLPIGPDETSESLAPKLAALGGEALVEALALLPHGGLVPVKQ
FT                   DASRATLARILEKEDGRVDWTRSARRIRDRLRAFTPWPGATTTLDGRSVKLLEVREEPE
FT                   AAGALAADPGAAALVPGRGVAVRCGDGTALLVTRLQPEGRPPQAAVDFANGLRRRTFTF
FT                   GT"
FT   gene            complement(506124..507296)
FT                   /locus_tag="Anae109_0450"
FT   CDS_pept        complement(506124..507296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0450"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   ade:Adeh_4042 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24665"
FT                   /db_xref="GOA:A7H7G9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G9"
FT                   /protein_id="ABS24665.1"
FT                   /translation="MHHARDRPFRPRLDPARPAPARARRRGARRPGRVPPPPRGVRSPP
FT                   RVRGRRVPLALGVLPGGAPPARGRGGATHPGDAGAAPVPSLEDALRDGRLCISTVQLLG
FT                   QVLTEENLPDLVARAAYRTKAEVDHLVASLQARTAPRAGVRKLPDRASAASAPALPLAA
FT                   VVAGPAEPQEAIPAPPAAAGGSPATVSAPPDQPRPKARAETRAVSESGWSLRVTIDASC
FT                   KEDLETLTALLSHEFPDGDLAAVLRDAIRCAVEKHGKRKGAIAPERQRKADREPRPSTE
FT                   SAAPTSTIPAIVRREVWKRDGGRCAWVAPDGRRCDSRWQLELDHIHPQALGGLSTRDNL
FT                   RVACRSHNLLHAEQTYGREHMDRFRRGNLAERTGHAGTAPAAIQQGLWAT"
FT   gene            507777..508526
FT                   /locus_tag="Anae109_0451"
FT   CDS_pept        507777..508526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4018 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24666"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H0"
FT                   /protein_id="ABS24666.1"
FT                   /translation="MGCDESRGRGRGRGRGLIIPHKTGGRIAKVLTPENRAEVLPRFFG
FT                   RSRREAEAVAVSLRPAEVVPTREVVTAFRPAAIRAATVQAALLAPSPESPALRVHPDEP
FT                   TTPVTVAAPRPLPTPPPPRESVERLDAELARVHVTVSRRFLEKLEAATDALGHACPEGN
FT                   AAEILERGLDLILAQHAKRRGLVEKPRKSRGGSRRDTIPAEPSRPAPHGEGGRGGFVSS
FT                   RAVDMYAVSHANFGRPQARENGARRDR"
FT   gene            complement(509085..510455)
FT                   /locus_tag="Anae109_0452"
FT   CDS_pept        complement(509085..510455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0452"
FT                   /product="MOFRL domain protein"
FT                   /note="PFAM: MOFRL domain protein; KEGG: ade:Adeh_3968
FT                   MOFRL"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24667"
FT                   /db_xref="GOA:A7H7H1"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H1"
FT                   /protein_id="ABS24667.1"
FT                   /translation="MRCSPLGPASPGTGDSIACPSHRNDAAAREVTMQARRPLASTCED
FT                   IYRAALHRLDAARRVAAELASSPLPPGPVRVLALGKAATPMIEAALAALGDRARHPLCV
FT                   HPEGTRPPAGARAIAAGHPRPTRGSLAAGEAIRAWADANGGATALVLLSGGGSALAVAP
FT                   AAGLSLEEKADALAAVMRAGATIQELNAVRKHLSDLKGGRLGARLAPAPVRVLVLSDVP
FT                   GDDLSTIASGPLVPDPTTWADVGAVLDRTRTRGALPAAVRAFVEAESAAGRETPKPGDP
FT                   RFATIAHRLLAGPTELARAAAEAAAERGISAEADPAPLTGDVAAVAARLGAWARANAGR
FT                   GPRLLALGGEPTISVPAAAHPDGGRAQALALLAAKELAGLPAAALAAGSDGRDGPTEHA
FT                   GAVVDGETAPGAAAAGVDLDAALAEARSGPACAALGVAIPRFETGTHVCDLVLVAVE"
FT   gene            510553..511101
FT                   /locus_tag="Anae109_0453"
FT   CDS_pept        510553..511101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0453"
FT                   /product="histidine kinase HAMP region domain protein"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   KEGG: ade:Adeh_3967 HAMP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24668"
FT                   /db_xref="GOA:A7H7H2"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H2"
FT                   /protein_id="ABS24668.1"
FT                   /translation="MAGAGLAVALVFGLWLHQAHVQATALLASDPETRALVARSDRVLL
FT                   GAFGAIALLLAGALGLLGVVVTHRVAGPVFVMGHYVRVLSEGRFPRMRTLRRSDELKPF
FT                   FRTFIQAVEAMKAREARHAAVLSDALQRMCAASARSPELAPAIEALTAALAERHSALAL
FT                   DDSEPTPIAVPAPQRRALP"
FT   sig_peptide     510553..510618
FT                   /locus_tag="Anae109_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.829) with cleavage site probability 0.725 at
FT                   residue 22"
FT   gene            511119..512660
FT                   /locus_tag="Anae109_0454"
FT   CDS_pept        511119..512660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0454"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: ade:Adeh_3966 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24669"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H3"
FT                   /protein_id="ABS24669.1"
FT                   /translation="MRTLPAVLACLALAACGSPSDPEGWAKRAAGRSRLDEKLEALSHV
FT                   RKVQGDRRAAVPHLVAVLKQAPRARAEAALALGEIGDPAAAAPLLAALDPAPKDRDTID
FT                   ANRRIAEALGALRAREAVPALQELTASPDGYTQVAAVDALGRIGDPAAVDTLVAIATGD
FT                   RVEPFTAKKALLALGSIADPRAGKAVLRMLFEERPGVSFFPEAAFAASQIGAPMTAPLL
FT                   AVLEGRDAELAGWARQRGVVPGALFAKSAQLLGDVAGAEAVPALVQKLSYQDADPRLAL
FT                   YVRVFAAESLGRMRAQEAVRPLASLLPRERDPDVRDRYCDALARIGDPAALPALRAASG
FT                   SPDARLRDGALAALSRIGGAAERPVVEAAEQRACAGGCDAARKAAFAGRTARLDAAAAC
FT                   GVDPACWAGKLADPIAAVRDRAALEVGRRGSARHAAALTDALVRPIEQDADVAARYHAV
FT                   LGLGWLASREKLGAAGADLAGKIDGMIAHDRGRTLTARVNEDALRLAARLRREAR"
FT   sig_peptide     511119..511172
FT                   /locus_tag="Anae109_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.890 at
FT                   residue 18"
FT   gene            complement(512725..514188)
FT                   /locus_tag="Anae109_0455"
FT   CDS_pept        complement(512725..514188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24670"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H4"
FT                   /protein_id="ABS24670.1"
FT                   /translation="MGERPRPSPLCARTGERGPCQARYTRRPGRPVPRRLSDRRWLEQL
FT                   LDEELLGHDPHQARARLPADVRAAASTPLDLAPAANLLVARSLRRRVAVRVPGEGADRP
FT                   ASARDVFLDEVRAHIGLALDLALLRGDPFVRARRRAEIAAALAAAAGEHALAIEAEPEQ
FT                   PGGASDRAVERAVRGAAEALHARFYPPAEPAHALPLHAGKVAVLRRRLARVVSGYHRDG
FT                   RLVGAALARHGAYAARETLLLVEALAGLLGAAGDGDGAAVRVLRQRQIARLGLGRADAR
FT                   EARRAIVAPRDPEAIADAAPERVRGFLLEQLRLAQLGLKLVEEEPAAWVERFVRAAGLD
FT                   AQAIASAEIEAAAQHADHADWLEALGDGPRAWQGLASDLDVATDEVVERVTVAVTDNLE
FT                   ALVTEIRETGELGQLLARAASGGALSRDEKKKVKAQLIDLAKAVPALAIFAAPGGMLLL
FT                   PLLAKLLPFNLLPSAWEKPAESKRKQVAR"
FT   gene            complement(514201..515277)
FT                   /locus_tag="Anae109_0456"
FT   CDS_pept        complement(514201..515277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0456"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: ade:Adeh_3964 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24671"
FT                   /db_xref="GOA:A7H7H5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H5"
FT                   /protein_id="ABS24671.1"
FT                   /translation="MAVAPEKEKAIELAVSSIEKAFGKGSIMRLGNEEALVKDVQAVST
FT                   GSVSLDIALGVGGFPRGRIIEIYGPESSGKTTLALHAVAEAQKKGGIAAFVDAEHALDV
FT                   GYARKLGVRTDDLLISQPDTGEQALEIAETLVRSGAIDVLVVDSVAALVPKAELEGEMG
FT                   DAHMGVQARLMSQALRKLTGTISKSSTIVIFINQIRMKIGVMFGNPETTTGGNALKFYA
FT                   TQRLDIRRIGAIKDGDQVIGNRTRVKVVKNKVAPPFKEVEFDIMYGHGISREGDLLDLG
FT                   SNENIVEKSGTWFSFGGERIGQGREQAKAFLREHPEVLQQVEGKLFEKFGIRRGPVAVP
FT                   PPPPDEAEEKKGRARSGR"
FT   gene            complement(515668..516267)
FT                   /locus_tag="Anae109_0457"
FT   CDS_pept        complement(515668..516267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0457"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   ade:Adeh_3962 protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24672"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H7H6"
FT                   /protein_id="ABS24672.1"
FT                   /translation="MPSPAPSGLAPGFLVAAPALGDPNFAGSLVLMAEHHGEGALGFVV
FT                   NRPGPVTVAEVLASVDEDLRRAAEANGRAGAPVLVGGPVQPERLWILFRPGGIGADAEG
FT                   AVPVGNGLSLGGSRELLEALVRAPRGDPFLLLLGYAGWAPMQVEREVAAGAWVPLELEG
FT                   SDLVFDVPLEQRWETAVRRLGLEPGGFLVGGGGASA"
FT   sig_peptide     complement(516202..516267)
FT                   /locus_tag="Anae109_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.950) with cleavage site probability 0.923 at
FT                   residue 22"
FT   gene            complement(516388..516981)
FT                   /locus_tag="Anae109_0458"
FT   CDS_pept        complement(516388..516981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0458"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ade:Adeh_1457 DNA-binding cold-shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24673"
FT                   /db_xref="GOA:A7H7H7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H7"
FT                   /protein_id="ABS24673.1"
FT                   /translation="MQKPIEIGWRNVAPSPAVSALIRDEAARLERASDRIVGCSVKLEA
FT                   PSRHHRHSGSQYRVRVEVSVPRGKIVVGRNPPRTDTHADLYAVVKQAFREARRQLEDRV
FT                   RRIDGRVKSHAPPAEEAVVARLLPEESYGFLRTADGRDVYFHANAVLRGLFSRLRVGRA
FT                   VRFVETRGDEGPQASTVDPLPARRRATPAPAPAR"
FT   gene            complement(517042..518802)
FT                   /locus_tag="Anae109_0459"
FT   CDS_pept        complement(517042..518802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0459"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: DNA polymerase X;
FT                   phosphoesterase PHP domain protein; KEGG: tbd:Tbd_1446 DNA
FT                   polymerase X"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24674"
FT                   /db_xref="GOA:A7H7H8"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H8"
FT                   /protein_id="ABS24674.1"
FT                   /translation="MENAEIARVLSEIADLLELSEGNAFKVRAYRRAAQAVDLHPASVA
FT                   ELWRAGRAGELHGVGAHLAERIGELVETGECREHGRLAAGVPPGVLAMLRLEGMGPKAV
FT                   AAVWKELGVTDLAALEDACRSGRILAATRMGPARARALLAAIARHRARAGRMPLHRALE
FT                   YAEGILARLRTVPGVRRAEVAGGLRRRTETVDDLELLVAADDAAPVLRAFCGLPGVEPV
FT                   LGQATTTTQAKARLRAGIRADLRVLPPGCFGAALHHFTGSKEHTVAIRRRAAQRGLDLS
FT                   EYGVFDREGRRLGGAEEIEVFRAVGLPFIPPELREGSGELEAAEAGRLPRLVEESELLG
FT                   DLHVHSRASSDGRSTLEELARAARALGRRYLAVTDHSRSRPLGLDAERLRAHAAEVRAL
FT                   DARLGGEPQLLAGVEVDVLPSGALDLPEDVLADMDLVVAGVHARFGDSSARTTERLERA
FT                   LRSGVVHVLAHPTGRELGLRDAYPLDLERLLSVAREEGVALEVNAMPERLDLTDAGCRA
FT                   AGAAGVPVVISTDAHDAAQLANLRYGVWVARRGWLEAKDVLNTLPLEGLARRLARVTRA
FT                   PDRAHGGSSR"
FT   gene            519203..520228
FT                   /locus_tag="Anae109_0460"
FT   CDS_pept        519203..520228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0460"
FT                   /product="putative FHA domain containing protein"
FT                   /note="KEGG: ade:Adeh_1548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24675"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H9"
FT                   /protein_id="ABS24675.1"
FT                   /translation="MAAKTVGALVGALLLFCGAGAAPGRAAAQAGGAAVSFEVFESGLA
FT                   PYGEWVVAGSYGRVFRPSGVAPGWRPYTQGEWVWTVEGWFWASDEPWAWAAYHYGRWIF
FT                   DPWLGWIWVPGYDWAPAWVAWRVGGGYIGWAPLPPGVVTWWVEPVPIVVTSWVFVPVRR
FT                   FVGHPVHRALVPPARVPELVPRTRPAPPRSAGVAPAPPRGGPPRPLVEAEIGRPVRPAP
FT                   IVAVPSPDAARRRSGDAVPAFRPAAKPAPAPAKAPAPSTARERRPEPAPAPATGARAPA
FT                   SPPSGKAETAPRAAPGSAPAAPAPAPAPKGGEARPARPPEANSGATAPSPAPAPAPARR
FT                   P"
FT   sig_peptide     519203..519289
FT                   /locus_tag="Anae109_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.454 at
FT                   residue 29"
FT   gene            complement(520259..520846)
FT                   /locus_tag="Anae109_0461"
FT   CDS_pept        complement(520259..520846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0461"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: ade:Adeh_3960 2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24676"
FT                   /db_xref="GOA:A7H7I0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I0"
FT                   /protein_id="ABS24676.1"
FT                   /translation="MEGKTHRLFVALEPPDAVRRRIGARAAALRQAAGRHAEDVRWVPV
FT                   ENLHLTVQFLGAVPEQRVESVADGVRAAAAASRPLALEVKGAGGFPNARRPRVIWLGLE
FT                   GDVEAARALVADVGRRLAPLGFAPEARPWAAHLTLGRARDPRGAPGLGGALVARAQEDG
FT                   IPWRAGELVLVESHLSPKGPRYEPIVQAALGA"
FT   gene            complement(521230..523065)
FT                   /locus_tag="Anae109_0462"
FT   CDS_pept        complement(521230..523065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0462"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   ade:Adeh_3959 glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24677"
FT                   /db_xref="GOA:A7H7I1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I1"
FT                   /protein_id="ABS24677.1"
FT                   /translation="MCGIVGYVGPRQCVDLIVGGLRKLEYRGYDSAGVAVVGPSGLAVK
FT                   RAKGKLQNLVTILRDGPLPGCTGIGHTRWATHGRPSDENAHPHSYGGVAVVHNGIIENH
FT                   LDLKAALTGRGHRFTSETDTEIFAHLIADALGDGAKDLHAAVRAALQQVQGTYAIAVVS
FT                   EKRPGEIVAAKNASPLVVGYGEGESFLASDVPAILEHTRQVSYLEEGELAVLTAEGITV
FT                   FGRNDEPITRPPRRIEWSAVAAEKDGHKHFMHKEIFEQPRAVADTIRGRASLEQGDVTL
FT                   DGVELPEDYARSLERIVIVACGTSWHAGLSGRQMIEALARVPVEVELASEFRNRDPLVN
FT                   ERVLCLAISQSGETADTLAAVKIARARGAKAYAICNVVGSAIPRECDGGTLFTRAGPEI
FT                   GVASTKAFTTQLAGLYLLAVKLGRLRGALSADKAREHLEALRHVPSWMEQMIRQEAALM
FT                   PIAKRCAAARDVLFLGRGAQFPVALEGALKLKEISYIHAEGYAAGEMKHGPIALIDEDL
FT                   PVVVLATREPAYEKTLGNIEEVRARGGHVFAVVSEGDTHAASLAEVALPVPPAPPLLAP
FT                   LVSIIPLQFLAYHVADLKGTDVDQPRNLAKSVTVE"
FT   gene            complement(523104..524567)
FT                   /locus_tag="Anae109_0463"
FT   CDS_pept        complement(523104..524567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0463"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: ade:Adeh_3958
FT                   UDP-N-acetylglucosamine diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24678"
FT                   /db_xref="GOA:A7H7I2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H7I2"
FT                   /protein_id="ABS24678.1"
FT                   /translation="MSHSPTPLAAIVLAAGKGTRMKSQKAKVLHEVGGRPLAWFPTRRA
FT                   LEIGANPVVAVVGHQAEAVEAALAATLPGAPLRFAVQREQLGTAHAVLSAREALGRYQG
FT                   AVLILSGDTPLLRAETLSRVVAARAGATLSLATMRLADPHGYGRIVRDPAGTPARVVEE
FT                   KDATDAERALDEVNAGLYCADAAFLWEALSKVGSANAQREFYLTDLVAMAARAGGVVAV
FT                   PVPPEEASGVNDREELARAGRVLLRRRASELMRSGVTIEDPERFDCDEGVEIGADAVIE
FT                   PNVRLKGRTRIGAGCRLGAGAILTDAVLADGVTVKPYTVIEEATVAARAILGPFSRLRP
FT                   GSDIGEEAHVGNFVETKKARLGKGAKANHLTYLGDATIGAGANVGAGTITCNYDGEKKH
FT                   PTTIGEGAFIGSDSILVAPIEIGAGAYVAAGSTLTESVPPGALALGRAKQVTKEGWVAR
FT                   RKAEAQNKGAAEAAPAPSPADSPRGGRAS"
FT   gene            524620..526326
FT                   /locus_tag="Anae109_0464"
FT   CDS_pept        524620..526326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0464"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase; KEGG: ade:Adeh_3957
FT                   gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24679"
FT                   /db_xref="GOA:A7H7I3"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I3"
FT                   /protein_id="ABS24679.1"
FT                   /translation="MTARKRRRRWYTTWMPVLLALVLSATAVSSRGAVATAHPLASEIA
FT                   ADVLRGGGNAADAAVAAALALAVVEPQSSGIGGGGFALVYDARARRVHALDFREVAPAA
FT                   ATPDMFAPSPGAPGAPPRSLDGGLAVAVPGAVKGYAELARRFGSRRFAALAAPAARLAE
FT                   RGFPASPSYSDAARARLACLAARPAAAREFLAKGSDGRPAAPGPGDRVVRRELARTLRL
FT                   LGRDPDAFYRGPLAERIARAARDDGGVLAASDLGRYRVRERPPVEGRYRGHRVVSMGLP
FT                   SAGGAIVVGVLQALERETPRAGGYRPVRFLHAMAEAEKRLFARRAALGDPAFAPGAAAV
FT                   VDEMVSPRYAARLSAEVGERALPVAAEAPPQGEDKHTTHVSVVDGEGNAVAITTTVNYL
FT                   FGACVVVPGTGILLNDQMDDFDAAAGVPNAYGLVGTGANAPAPGKTPLSSMAPTLVFEP
FT                   GGALWLVLGAPGGSTIPTTIAQAISHLVDDGMTLEQALAAPRLHHQWQPDALRVEPNGL
FT                   EAETARALQARGHRLQVSERPWGNAQAVRRRPDGRWEAASDPRYDGVPSAP"
FT   sig_peptide     524620..524718
FT                   /locus_tag="Anae109_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.513 at
FT                   residue 33"
FT   gene            526384..526959
FT                   /locus_tag="Anae109_0465"
FT   CDS_pept        526384..526959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0465"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: ade:Adeh_3955 CheW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24680"
FT                   /db_xref="GOA:A7H7I4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I4"
FT                   /protein_id="ABS24680.1"
FT                   /translation="MTTRPESSAATGGLRPPRAALTAEVRRLEEELGRAQRELLAQGGD
FT                   VLPGLHLLVETVGLRALLGAGRVSEVVRLVSTVPLAGAGPHVLGTFVCRGTPVVAVDLA
FT                   ALLGIAREPSLDAQIAVVPGAPTIGLVVDRVDRLVDGPRLFHGDAQAGTPDAWRGSPLV
FT                   AGLCLHGGEVVPLIDPGPLAAGLAEPRS"
FT   gene            526956..528434
FT                   /locus_tag="Anae109_0466"
FT   CDS_pept        526956..528434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0466"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; Methyltransferase type 12; KEGG: mxa:MXAN_2682
FT                   chemotaxis protein methyltransferase CheR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24681"
FT                   /db_xref="GOA:A7H7I5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I5"
FT                   /protein_id="ABS24681.1"
FT                   /translation="MTATGAPSAAGVEDVERALRDACGITLTEGLRTTLAEALRRAARA
FT                   TGLDPDTFRARLRARDARCVAELVEAAVVGETYFFRHPEQLEVVRQLVLERAPRERPLR
FT                   IWSAGCATGEEPYTLAMLLRDAGRAGCRDRILATDVSVRALAVAAEATYGPWSLRRLDP
FT                   VARARHLAGEMPVVRVREEVRAAVELRRHNLFSEPAPPGPFDLVVCRNVLIYFDPETAR
FT                   AIAARLLEAVAPGGFLLLGPVEVPLAERLEAERIEVGGTTLLRRMAEGERAGERVAPKP
FT                   ARGRARSGSGASPTASRTPIRTRTPVPGPPEAGHPEPFDSAACGRYAQDRLRSAAPAAE
FT                   RSRGTPTPTASATPTPAPGFEQARDAARRGDVEFAEQLAREVAERHLCPESFLLLAMAA
FT                   DARGDLAGAIDALRRALYLEPGLAMAHAALVPLYARVGRHDEAARARRNALEAVEGLDD
FT                   TAPLRGVEPITVGALRSALGAVHRPQAGAGRSEA"
FT   gene            528431..528805
FT                   /locus_tag="Anae109_0467"
FT   CDS_pept        528431..528805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0467"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mxa:MXAN_2684 response regulator CheY4"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24682"
FT                   /db_xref="GOA:A7H7I6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I6"
FT                   /protein_id="ABS24682.1"
FT                   /translation="MKVLLVDDTRTLLSLIQVYLMGWQIEFVEAKDGTEGLARAREHRP
FT                   DLVITDVRMPGMDGFELCAAIRADTVLHKTPIVLLTSLADDASRKKGKLVGATAFLTKP
FT                   VSVEELRNTVGGILRLPARR"
FT   gene            528807..529367
FT                   /locus_tag="Anae109_0468"
FT   CDS_pept        528807..529367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0468"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: mxa:MXAN_2685
FT                   chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24683"
FT                   /db_xref="GOA:A7H7I7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I7"
FT                   /protein_id="ABS24683.1"
FT                   /translation="MALGSRDTREPAPRAPADPRAGLDVAPSPEERRRVLDERARAIAP
FT                   ARETAAVATLPVVAFALGGERYGIPVEDVFQILDAGTLSPLPAVPAWLVGAAVSRGRIV
FT                   PVVDLRQLLGLDGGGMSDLAKIVVVEHGADAFGLAAEVVEGQLELPRAGLSPVTAGPFA
FT                   WIAPDRLAVLDLGKLAAPAALGG"
FT   gene            529371..531863
FT                   /locus_tag="Anae109_0469"
FT   CDS_pept        529371..531863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0469"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region ATPase domain protein; Hpt
FT                   domain protein; KEGG: mxa:MXAN_2686 sensor histidine
FT                   kinase/response regulator CheA4"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24684"
FT                   /db_xref="GOA:A7H7I8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I8"
FT                   /protein_id="ABS24684.1"
FT                   /translation="MDRELFRQIWPVFSAEAREHLEGISAGILELERDPGRPVIDGVRR
FT                   IAHSLKGSAGSLGLADLERLAHALEGSLAGYDPAAGLSRAAVQAALEAVEAMEAALASG
FT                   DAGGVVEVPAVDALLVGLGAAARIGQGPGTAARDEATLGPTGAAAASADVLAGMDALEA
FT                   ALEQLCAPLEPDARRAVAGGAARGALHLAALAAPGVAALARRAADAFTLLAEGGPDAPR
FT                   ATAALAGDLIDLREALARAPVAPAPAEAGPTGAAAAAKARGERSIRVLASTLDSIGRQF
FT                   ELLALAEARRARRARDVLGHAEAVRGALQSLDHATRRLRGAGIETGRAELDSASTRLRE
FT                   VAAALGRVALEAQREAEAQRLAGTVLREDLRGLRMVPAALVLEPLRRAVRDVAGRLGKE
FT                   VELTVEGGEVRLDRQIVDALRDPLLHLVRNAVDHGIEAPAARRDAGKPTGGRIAVRVEP
FT                   RGARVAIVVEDDGPGLDVGAIRAAAVRKGLLTTEEVDRLTDAEAARLVFHAGVSTARAV
FT                   TEISGRGVGMDVVLETLARLQGTIDVRWEAGRGTRFDLDVPLALSASAALVVRVGRDVV
FT                   AVSADPIEHVVLLRDQDLGTVAGRTTVLVAGEHVPYAPLARLLRSEEGGGPARQAVALV
FT                   LAHGGARVAVGVDELVGQQELVISSLGGLVAQIAHLAGAAVLDDGRVVGVLSAPELLRR
FT                   AQPGAAAARAREGGRRVLVADDSLTTRSAMKALLELAGYAVLPAADGEEALQLLREAGA
FT                   DLVVSDVQMPRLDGFGLARKVKADPRLRRTPVILVTSLDAPEDRATGLAAGADGYLVKR
FT                   EVERGKLLDLVRQLLPRA"
FT   gene            531860..532927
FT                   /locus_tag="Anae109_0470"
FT   CDS_pept        531860..532927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0470"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: ade:Adeh_0614 response regulator receiver
FT                   (CheY-like) modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24685"
FT                   /db_xref="GOA:A7H7I9"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I9"
FT                   /protein_id="ABS24685.1"
FT                   /translation="MIRCLLVDDSRSFRALLRALLERAGIDVVGEAADGDAAVAKAVAL
FT                   RPDVVTMDVRMPGKDGLAAIEEIMRVAPTPVVVVSAEAGPERQELAFWALELGAVEVLA
FT                   KPRAVDAARFDREVQAIRDAVRSVAGLKVVTRHRRRALPAAAPRAAPAPPPRGASPAHA
FT                   PRVLGIAASTGGPAAIARILRALPREFPAPILVVQHIAPGFEAGLAHWLGSETRLSVKL
FT                   AQDGELLRAGTVYVGADGRHLTARADRVRLVDAPPVRGFRPSGTTLLESLAREYGGAAA
FT                   GLVLSGMGDDGADGLRSVRERGGWTAAQGPASAVVFGMPGAAIERGAALHTLELDDIAP
FT                   ALLRLARAPALAPRA"
FT   gene            532968..533792
FT                   /locus_tag="Anae109_0471"
FT   CDS_pept        532968..533792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0471"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   ade:Adeh_3953 TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24686"
FT                   /db_xref="GOA:A7H7J0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012022"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J0"
FT                   /protein_id="ABS24686.1"
FT                   /translation="MWFDALLHARALRTRDLDDLAFFGVSGALVPSDDTVVPATASAIR
FT                   AGWDETAAAARRLRRAGLDGHAAVGIHPRCIPLRGLEALLAELPVALDRPEVTAIGAVG
FT                   LAGGGELEERVFARQLALARELRRPVLVATPWRAKERITRRVLALLREAELDPRRVLVT
FT                   GADARTVRAVRACGYLAGLSLSATGAPRGPIAEAVRLVRALGPEGLVLGSDAGVAGADL
FT                   LALPLAADRLAKAGLSEAVVRRVCGGNARAFLGLGAEPRGRRAPARREGGAR"
FT   gene            complement(533789..534259)
FT                   /locus_tag="Anae109_0472"
FT   CDS_pept        complement(533789..534259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0472"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: ade:Adeh_3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24687"
FT                   /db_xref="GOA:A7H7J1"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J1"
FT                   /protein_id="ABS24687.1"
FT                   /translation="MKMIDVGAKPRTERVAIARGFVAMSRETVARVERGDVEKGDVLAA
FT                   ARLAGVMAAKKTPDLVPLCHPIALSGVETEVEPGPRGVAVTATVRTVDRTGVEMEALAA
FT                   VAAACLTIYDMLKRYEKGMRIEGLELVEKKGGRSGHWKREDAEARPRRRRSR"
FT   gene            complement(534264..535208)
FT                   /locus_tag="Anae109_0473"
FT   CDS_pept        complement(534264..535208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0473"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   ade:Adeh_3951 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24688"
FT                   /db_xref="GOA:A7H7J2"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J2"
FT                   /protein_id="ABS24688.1"
FT                   /translation="MAQHERLVIIGSGPAGYTAALYAARANLNPLMFEGMQPGGQLTIT
FT                   SEVENFPGFPEGILGPELMELMKKQAERFGTRFELGEVTRVDFTRRPFQLWQEDRLFTA
FT                   DAVVVATGASAKWLAIASEKQYQGRGVSACATCDGFFFRGVDVAVVGGGDTAMEEAIFL
FT                   TKYATKVYVIHRRSELRASKIMQERAQKNPKVELVLESVVDEILGDGKAVTGVRLRSTK
FT                   DGSLREVPLKGVFMGIGHEPNTGIFKGQLAMNDVGYLEVRSPSTATSVPGVFAAGDVAD
FT                   PSYRQAISAAGSGCMAAIDAERFLGEHTTETWD"
FT   gene            complement(535260..536093)
FT                   /locus_tag="Anae109_0474"
FT   CDS_pept        complement(535260..536093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0474"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: ava:Ava_4335
FT                   trans-aconitate 2-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24689"
FT                   /db_xref="GOA:A7H7J3"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J3"
FT                   /protein_id="ABS24689.1"
FT                   /translation="MPTAERDVWNPDRYARFAGERRAPFLDLLATIEPRPGMRIVDLGC
FT                   GSGELTRLAHERLGARETVGVDASAAMLARAAAHAGGGLAFRQGDLAAVDDGPYDLVLS
FT                   NAALHWVPDHAALLPRLAALLAPGGQLALQIPANEEHPSHAVAREVAREPDLAAALAGF
FT                   VRQSPVLAPEAYARVLWSLGVSRQRVRVEIYAHPLPEPAAVIEWVRGTLLTDYERRLSP
FT                   EAYARFLARYRERLLAELPDERPFLYTYRRVFLWARRPPGPSGRAGGAPGIEPSP"
FT   gene            536182..537246
FT                   /locus_tag="Anae109_0475"
FT   CDS_pept        536182..537246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0475"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ade:Adeh_3950 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24690"
FT                   /db_xref="GOA:A7H7J4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J4"
FT                   /protein_id="ABS24690.1"
FT                   /translation="MKSRHLVVAALALALAACQSPRPAQQASNGQAQKQDPKAPVAKIG
FT                   AQTITAGELDELVKKDLDQLEQQYQEQRYQLRRQALEAMIRKRIVEEKAKAQNLSPEEM
FT                   VQRDIGAKVAEPSEEELKALYDRAKAGGQQLPPYEQVKPDIARFVKNQKAQGLLAEYYE
FT                   ELKKDAKVEVLLPAYEPPKVEVAATGPSKGPQGAPVTIVEFSDFECPYCVRAEDTVKQV
FT                   LAAYPDKIRLVYRDFPLPMHARAPKAAEAAHCAGDQGKYWEMHQRLFASSNAIDVPDLK
FT                   KYAGELKLDQAKFDKCLDSGEKTQVVEEHRKAGEEAGVSGTPAFFINGRMLSGAQPLDA
FT                   FKKVIDQELASAGK"
FT   sig_peptide     536182..536262
FT                   /locus_tag="Anae109_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.754 at
FT                   residue 27"
FT   gene            537459..538577
FT                   /locus_tag="Anae109_0476"
FT   CDS_pept        537459..538577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0476"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; PFAM: IspG family protein; KEGG:
FT                   ade:Adeh_3949 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24691"
FT                   /db_xref="GOA:A7H7J5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J5"
FT                   /protein_id="ABS24691.1"
FT                   /translation="MGGYGQGAAATLGERRKTRGIRLGNVPIGGGAPIAVQSMTTTQTS
FT                   DAPATLAQIRALAEAGADVVRVAVPDRDAAAALPAIVRASPVPLVADIHFDYRLALAAL
FT                   EAGIHGIRLNPGNIGARERVREVVHAARERLVPIRIGVNAGSLEKDIVEKHGWPTAEGM
FT                   VESAERHIRFLEDEGYREIKVSLKAHDVAMTVQANRLFSQRFEYPLHLGVTEAGTLLAG
FT                   TVKSAAGLGILLGDGIGDTIRVSLTADPVEEVRVARLLLKSLGLKFGGATMTSCPTCGR
FT                   CSVDMIPIAERVEKRLATLKGEVAVAVMGCEVNGPGEAAAADVGVAYGHNGVGLLFRGG
FT                   KIVKRMKAEELEDAVVAEAISIASSRTPGERD"
FT   gene            complement(538574..538909)
FT                   /locus_tag="Anae109_0477"
FT   CDS_pept        complement(538574..538909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24692"
FT                   /db_xref="GOA:A7H7J6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J6"
FT                   /protein_id="ABS24692.1"
FT                   /translation="MTRRARLAALAVAAVAVALAIALAAAPRGRPSLVGTPEALARGER
FT                   VFRAKCLHCHGDVPLARRVAGWTAERAYDAIGRLPQLYPVMPEFHGSDEDRRALAVYLS
FT                   AMGEGSD"
FT   sig_peptide     complement(538835..538909)
FT                   /locus_tag="Anae109_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.864 at
FT                   residue 25"
FT   gene            539024..540751
FT                   /locus_tag="Anae109_0478"
FT   CDS_pept        539024..540751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0478"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: ade:Adeh_3947 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24693"
FT                   /db_xref="GOA:A7H7J7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H7J7"
FT                   /protein_id="ABS24693.1"
FT                   /translation="MPVVRLSQAFVPTLKEAPADAQVASHKLLVRAGFIRQLGAGIYDY
FT                   LPLAKRTLAKIEAIVREEMDAIGGQEFYLPALHPAEIWKESGRWEVMGDNMFRLKDRKN
FT                   GDYCLGMTHEEIFTAIARDELRSYRQLPQVWYQIQTKFRDEPRPKSGLLRVRQFTMKDA
FT                   YSFDVDRAGLDKSYEDQRRAYERIFTRCGLDFVAVQAHSGAMGGSESSEFMVRTDAGED
FT                   LVAACPRCRYAANTETATSRLASEQDGAGLPKPEKFATPGVVTIEALEQPPYGVAARRQ
FT                   LKTLVYVADEKLVVAVVRGDQELNEAKLQTATGAQVIRPAHPEEIPSLMGARAGSLGAV
FT                   GFSRAKVFVDPSLADRKDMVTGANEDGFHLRGVEVRRDVLTGPHATVAELRTVRAGEGC
FT                   PRCDGTLDVFKALEVGHIFKLGTKYSESMKATVLDADGKAVPIVMGSYGIGVERIMAAA
FT                   IELHHDELGIRWPPAIAPFQATVLTLGPEPELKKAADELVKALSDAGLEVLHDDREERA
FT                   GVKFKDADLVGIPLRISVGKKGLAEGKVEWKLRGDKAVELVPLAEVARRAAEHVRAGR"
FT   gene            540758..541879
FT                   /locus_tag="Anae109_0479"
FT   CDS_pept        540758..541879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24694"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J8"
FT                   /protein_id="ABS24694.1"
FT                   /translation="MRARLSVGRDGEVLVPPREAEALGLGGGGEVDLVSARGAFALLVP
FT                   ARGDEAPRAWFAGSLAALTVPEVIQFVFTSLKTGVLLLAFGEDAARAAPDTPDRLRRKS
FT                   IYFRDGQVVFASSSDPSDRLGPVLLREGLVGEEELARCARLARAGRPLGQVLVDEGVLG
FT                   PGQLYEGVTRQVREIVLGAFAELTGEFAFLEGPVDDATAVKLPERTRELLLAGMKRLEE
FT                   AEAARAAATTPGPGEPEVTIEIAPPEPAAPARASGPFETYRRIFRRVHAALAAVTPDAA
FT                   DRLNGYLAQLPDKRRAPFAGVHVQHDGDLDVAQVLGNVSAAGAHRGAAARARALEALDE
FT                   LLAFALFEAKNRLPREEAERLLREVGRMQVGKG"
FT   gene            542068..542781
FT                   /locus_tag="Anae109_0480"
FT   CDS_pept        542068..542781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0480"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG: ade:Adeh_3945
FT                   orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24695"
FT                   /db_xref="GOA:A7H7J9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J9"
FT                   /protein_id="ABS24695.1"
FT                   /translation="MGRSHGGANRMQPKDRICAAIDFPSWSAAEPFARAVAPEVGMLKV
FT                   GLELFVAEGPPVVRAAAALGRPVFLDLKLHDIPNTVEGAARSAAASGASLLTVHASGGA
FT                   EMVRAAVRGAGPGVRVLAVTVLTSLDAAALDAIGLAGPPEDAVVRLARLAVGAGAGGIV
FT                   CSPHEVAAVRAAVGAGPLLVIPGVRPAGAAKGDQARVATPAEAVRSGADVLVIGRPLRE
FT                   GGDPGAAARAIAGTL"
FT   gene            542850..543761
FT                   /locus_tag="Anae109_0481"
FT   CDS_pept        542850..543761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0481"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rme:Rmet_0202
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24696"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K0"
FT                   /protein_id="ABS24696.1"
FT                   /translation="MPELFPGFTVHDLETRGARIHARAGGSGPPVLLLHGYPQTHAIWH
FT                   RVAGPLAARFSVVAADLRGYGDSGKPPSAPDHAPYSKRAMAQDLVEAMGLLGFESFHVV
FT                   GHDRGARVGHRLSVDHAARARSLTVLDIAPTLAMYEQTDMDFARAYYHWFFLIQPEPLP
FT                   ERLIGADPGFFLREKLRGWSQGRWPFEAAAFAEYLRCFEDPATIHASCEDYRAAATIDL
FT                   EHDRADRDAGRRVRCPVLASWGERGTVHRCFRPLEEWRRVADGDVGGGPLPSGHYLPEE
FT                   VPELLLRELLPFLERAETAPRA"
FT   gene            543935..544597
FT                   /locus_tag="Anae109_0482"
FT   CDS_pept        543935..544597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0482"
FT                   /product="Peroxidase"
FT                   /EC_number="1.11.1.7"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bja:blr5308 anti-oxidant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24697"
FT                   /db_xref="GOA:A7H7K1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K1"
FT                   /protein_id="ABS24697.1"
FT                   /translation="MPLRINDEAPNFTAQTTQGPIDFHQWIGNQWVILFSHPKDFTPVC
FT                   TTELGYMARIKPEFDRRNTKVIGLSVDSVADHARWAHDIQETQGAAPNYPIIGDADFEV
FT                   SKLYDMLPATVSGDAKARTPADNQTVRTVFLIGPDKRIKLILMYPMTTGRNFDEVLRVL
FT                   DSIQLTAKYRVATPANWHQGDDVIIAGSVSDEEARRQYPEGWRAPRPYLRFVHQPTR"
FT   gene            complement(544741..545145)
FT                   /locus_tag="Anae109_0483"
FT   CDS_pept        complement(544741..545145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0483"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: rso:RS04693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24698"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K2"
FT                   /protein_id="ABS24698.1"
FT                   /translation="MSTPGMIHLEHVYPHPPAAVWRALTDPELHARWWAAGDVRPVVGH
FT                   RFTLDMGRFGKQPCEVTAVEHERLFSYRFATGSLDTTVTWRLSAEGEGTRLSLTHEGFD
FT                   LDSPLARGAWEGMKGGWPAILERLGAALGA"
FT   gene            complement(545142..545471)
FT                   /locus_tag="Anae109_0484"
FT   CDS_pept        complement(545142..545471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0484"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: mpa:MAP1641c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24699"
FT                   /db_xref="GOA:A7H7K3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K3"
FT                   /protein_id="ABS24699.1"
FT                   /translation="MFPCMPQPDVFSALANPVRRNILMQLRKGPRAVKDLAAGFDVGRP
FT                   AISEHLQVLRQARLVREEPRGRERYYHLDPRPLSEVDTWLEAFSRYWERRLVALGEVLD
FT                   KEKTR"
FT   gene            545839..547194
FT                   /locus_tag="Anae109_0485"
FT   CDS_pept        545839..547194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0485"
FT                   /product="glycosyl transferase family 28"
FT                   /note="PFAM: UDP-glucuronosyl/UDP-glucosyltransferase;
FT                   glycosyl transferase family 28; KEGG: rpe:RPE_2215 glycosyl
FT                   transferase, family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24700"
FT                   /db_xref="GOA:A7H7K4"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K4"
FT                   /protein_id="ABS24700.1"
FT                   /translation="MVRRQRPCEAAGRRPAMRIALLTAGSRGDVQPYLALARALARSGH
FT                   ACTLVTQRVFAPLAAEYGVTFHAAGGDDWPTPESVRERVRNGELAELAGKRNSFSQLSL
FT                   VAALFARHMTRFTADALPACEGVDAVAFAPMAAVAGHSLAEKLRVPFVPALLAPAFSTR
FT                   EFPSVLFPPRASFIPGYNRLSHWAAERLLWRLNRESAIRLRRDVLGLPPYPRSAFELMH
FT                   RAEPPVLVGVSPNVVPRPRDWAPYLHLTGYWFLDEPSGWNPPARIARFLASGSPPVCVG
FT                   FGSMVSEDPRGDVRIVAEALDRVGRRGILLSGWAGLDDHAADLPSSILPLDSIPHSWLF
FT                   PRVAAVVHHGGAGTTAAALRAGVPQVVVPFITDQPFWGDRVRRLGVGPAPIPRARLTAE
FT                   RLARAIACALERGAMTARARDLGHTIRAEDGARLAVEILERELGRGRRRAPG"
FT   gene            complement(547320..549566)
FT                   /locus_tag="Anae109_0486"
FT   CDS_pept        complement(547320..549566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0486"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   mxa:MXAN_0210 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24701"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K5"
FT                   /protein_id="ABS24701.1"
FT                   /translation="MWATAAPAQEAEGDAPVAESQLEDLLESASRSQGVTRRYTEGDFA
FT                   PYFASGELAEAKALFDRGSHARARARLRGEQPPVRYLRAVSALRDAPASAVVELRALAD
FT                   DYPRMRDHCLFHAARALERLRKRRAAADVYAQVSPGSTLYAEARLGRSRVLERGLDLDG
FT                   ALDALVPLRELPAIPRHDAVRRKALLAAARLCQKKGDYPCEHRAMLELWATSPLSREAK
FT                   VVWERLKELPIPNRWRLRRAESFLAFHDNLEALRLARQVKTPLPDEHACTASFVIGNAL
FT                   RKERQHRKAAAELGPMVEACKSSELRPQAMYVLGYSQSVIGQDAVRTYEALAHEYPGHA
FT                   FADDALFFAAELDLRGGRRAVALERLEQVAARYATGNFAPEALFRLAWEHRTAGAHEEA
FT                   LAALDRLDRLPGLGREQRLRSRYWRARTLADKGDAAAAPAFAALAADHPAEWYGLLARA
FT                   RLPDLAPLVASHRTASSYAAATVWPLEAGPLGDDPRFLAGVELLRMQLPDGAAELLAID
FT                   RRSLPEDAARLLVEALQRSGSSAAAAYVARTTLGRTLTGGIDDRTADVWRATYPLPFRS
FT                   LVERWAKASSVDPDLLQALMREESRFNPWARSATGARGLTQLMPRTAQDVARGLKLGRV
FT                   NPGMLHRPALNIRLGAAYLAELLSEYEGSMVRAVAAYNAGPVAVWRWVRARPDEDVDVW
FT                   VEKIPITETRDYVKRVLGSYGAYRHVYGRGAGPLEDRSPRARGDRGEPKPARRL"
FT   gene            550018..550554
FT                   /locus_tag="Anae109_0487"
FT   CDS_pept        550018..550554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24702"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K6"
FT                   /protein_id="ABS24702.1"
FT                   /translation="MNTRRLAVMAALVAATTARAQSGGSAADPAESGASRDSASQAAAQ
FT                   QQAPSVTSTEGPGGSSPRPVTQGQGENRRFGNEPAATPGITGRRANEPGRTGASQNQVS
FT                   GRVALVNPSEREIAIDAGTATMQFKVAPDAKITIDGEKASFEDIAKGAEVRASLDRSGG
FT                   EFQAKRLEVTSTGKK"
FT   sig_peptide     550018..550080
FT                   /locus_tag="Anae109_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.942 at
FT                   residue 21"
FT   gene            complement(550979..551935)
FT                   /locus_tag="Anae109_0488"
FT   CDS_pept        complement(550979..551935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0488"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mxa:MXAN_2240 oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24703"
FT                   /db_xref="GOA:A7H7K7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K7"
FT                   /protein_id="ABS24703.1"
FT                   /translation="MQASVPAQMRAAAFDRYGGPEVLHTETLPVPQPGPTQVLIRLDSA
FT                   GIGAWDPYLRSGEVELGPSGFPRVIGNDGAGEVVAVGDRVRGFRIGDRVYAYSFDAGFY
FT                   AEYVAVNEDEVAQIPRGLSAEEAGVLGADGVTAVRGLDDQLHLGPGQTLLVYGASGGIG
FT                   HLAVQLAKRMGARVLAVASGRDGVELVRRLGADAAVDGKRDDVARAARDFAPAGLDAAL
FT                   VLVHGESLDPALSAMRKGGRVAHPNGVEPAPTAPPGVTLLSYDGQPGRDAFEQLNRLIG
FT                   AGPFHVEIGRVYALDDAARAHREIGRHHLGKLALRIH"
FT   gene            552073..552765
FT                   /locus_tag="Anae109_0489"
FT   CDS_pept        552073..552765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0489"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: ade:Adeh_0466 sigma-24
FT                   (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24704"
FT                   /db_xref="GOA:A7H7K8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K8"
FT                   /protein_id="ABS24704.1"
FT                   /translation="MAQDAGSARGFQAGGAPDEAVVHRVLAGDTASFELLMRRHNQRVY
FT                   RTIRAVLRRDSADVEDAMQQTYLHAYRALAAFEGASSFGTWLTRIALNVALGFVRRQRV
FT                   AGVELSVEVDEMTRGARDEGPEDGAARSEAAALLERAVAQLRDEHRIVFVLREVEQLST
FT                   AETAEALELSEENVKVRLHRARLALREILAGEVGQSAPQAFAFLAPRCDRVVHSVLSSI
FT                   GARPRTSG"
FT   gene            552849..554225
FT                   /locus_tag="Anae109_0490"
FT   CDS_pept        552849..554225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0490"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: nca:Noca_1954 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24705"
FT                   /db_xref="GOA:A7H7K9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K9"
FT                   /protein_id="ABS24705.1"
FT                   /translation="MALSRGRDRSKLTRIMGISLTSLGALASAAVIAGTGQPVAAAKGD
FT                   DTLERLASEPVARAAAKAFLEGRETFRFDTFGDEAFWGGQLRLHEAIAGSANGGVGEGV
FT                   SPRAALAVGLKVDADGLPANLRQQLRRGEVDLDDPATTLALLKLGAVVGVKGVFEGDRL
FT                   TSAGITCALCHSTVDDSLAPGVGRRLDGWANRDLDVGTIVALAPDLSPFTTLLGVDDAT
FT                   VRSVLRSWGPGKFDAELVLDGKAFRPDGKPAATLLPPAYGLAGVNLHTWTGWGSVTHWN
FT                   GLVANLEMHGQGTFFDPRLDDAAKFPIAAREGFGNVRNTPDLVTAKLPALHLYQLALPA
FT                   PAPPDGSFDRELAAQGKALFEGKARCATCHVPPLYTEPGWNLHTPEEIGIDSFQADRSP
FT                   DGRYRTAPLKGLWAHQKGGFYHDGRFAKLEDVVNHYDEHLDLGLDAGEKAALVEFLRSL
FT                   "
FT   sig_peptide     552849..552950
FT                   /locus_tag="Anae109_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.673 at
FT                   residue 34"
FT   gene            complement(554250..554570)
FT                   /pseudo
FT                   /locus_tag="Anae109_0491"
FT   gene            complement(555013..555474)
FT                   /locus_tag="Anae109_0492"
FT   CDS_pept        complement(555013..555474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24706"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L0"
FT                   /protein_id="ABS24706.1"
FT                   /translation="MAAIPAKHSIGDAIDAAVEAAVARALPSLRRAIDAAVAAGVRAGK
FT                   PSARVAARTPVPAAPARTARRNVAVPRAGEITRWVADQRARRVPTFVIEATGLDTKKQI
FT                   VARFGANSAFAKGKPLPHAKPAQAPAAPAKTERVVKARPPIVRKAAAAK"
FT   gene            complement(555593..556135)
FT                   /locus_tag="Anae109_0493"
FT   CDS_pept        complement(555593..556135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0493"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: ade:Adeh_3940 Smr
FT                   protein/MutS2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24707"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L1"
FT                   /protein_id="ABS24707.1"
FT                   /translation="MTEEELWESATSGVRPLDRGPGVAAPPPPPPAAGPFWHPDLEAID
FT                   ELRALVAGDAPFDLSDTDEFIEGRAAGLDANLARKLRRGEFAVQGHVDLHGMTRDEAKG
FT                   AVEDFLRRSRQAGKRCVLVVHGRGLHSKDQLPVLKDALKTWLATGRFARHVLAFASARP
FT                   VDGGAGAIYVLLRRPGR"
FT   gene            556280..556462
FT                   /locus_tag="Anae109_0494"
FT   CDS_pept        556280..556462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24708"
FT                   /db_xref="InterPro:IPR017143"
FT                   /db_xref="InterPro:IPR025990"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L2"
FT                   /protein_id="ABS24708.1"
FT                   /translation="MDIEIQCPYCGEWVVVFVDPGGGAEQTYVEDCPVCCRPWIVHARE
FT                   EEPGGFAVGLARQDD"
FT   gene            556577..557290
FT                   /locus_tag="Anae109_0495"
FT   CDS_pept        556577..557290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0495"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_3939 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24709"
FT                   /db_xref="GOA:A7H7L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L3"
FT                   /protein_id="ABS24709.1"
FT                   /translation="MSIVSVEHVSKDYMLGKTVVPALRDVSLSVDEGEFLSIAGPSGSG
FT                   KTTLLNLVGCVDTPTAGRVLVAGQDTARLSERALTELRLRTIGFIFQSFNLVSVLTVFQ
FT                   NVEFPLLLQGGQTRKERAERVLALLDAVGIQEHARHRPSELSGGQRQRVAIARALVTRP
FT                   ALVLADEPTANLDSETGGNIIDLMREMNRRDGTTFIFSTHDPKVMAHASALVRIEDGRL
FT                   ASREDLDGAASAGGR"
FT   gene            557290..559428
FT                   /locus_tag="Anae109_0496"
FT   CDS_pept        557290..559428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0496"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ade:Adeh_3938 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24710"
FT                   /db_xref="GOA:A7H7L4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L4"
FT                   /protein_id="ABS24710.1"
FT                   /translation="MAERRDAVRVLLRIAFRNLAASPVRTAILGAIVLVGSLIVVVGSS
FT                   VLDSIDRGMRTSIQGSLGGHLQVYDARSEGALELYGGLRGESLLEPIEDFARVKEVLSK
FT                   VPNVRQVVPMGIDQAMVATGNTFDVALERLREDVRRLEAGADDAELRRAYAAHQSHVRR
FT                   MVQLLREEISQAREIVDPGGREGAERRQEWEALQRAATDGFWDGFDRDRYGSLEFLENR
FT                   VAPLAMDTAFTFLRYVGTDVDAFFEAFPLAEVVKGERIPSGRRGVLVGGQFAEEWLKLK
FT                   NARRLDQIKDARDRRGKRIAEDEELQRWVRENGSGIREILLQLDPVRADELAAELRPAL
FT                   GAPAGEALEPLLARLFATTDESFDRNHRIFYDLVAPKVRLYRVDVGDVITIKAPSKSGY
FT                   FSSVNVKVYGFLQFKGIERSGIAGMMSVLDLMSFRDLYGYLTAEKAAEIRRLQESMGVR
FT                   ELDRERAEAELFGGGGGLVGEARAAEIDEGALVAGREEDRASAADLAARVYSREELERG
FT                   VALNAALILEDPRQLDRTRRDVEAAIRDAGLGLKVVDWQEAAGLVGQFVTLLRVVLFTA
FT                   VVIFFAIALVIINNAMVMATLQRVKEIGTMRAIGTQRRFVVTMLLVEIATVGVVFGIAG
FT                   ALLGGVVVWGIRAAGGIPAVTDLLYFVFSGPALFPRLGALAVGGSLVVVLLVAILSALY
FT                   PAVIAMRVTPVEAMATED"
FT   gene            559430..560737
FT                   /locus_tag="Anae109_0497"
FT   CDS_pept        559430..560737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0497"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ade:Adeh_3937 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24711"
FT                   /db_xref="GOA:A7H7L5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L5"
FT                   /protein_id="ABS24711.1"
FT                   /translation="MLGVDLQIAGRNLARHTRRNLFLGGALAAVTALLVLLGALTAGME
FT                   SSMMQSALTLMTGDVNVGGFFKVTSGSAAPLVSQYPRVLETVRATVPEVEYVTMRGRGW
FT                   AKAVSESVSMDLVLAGVDVANEPTFRSVLRVVDGDLEALAQPGTVLLFEGQAERLKVRV
FT                   NDVVTLSAPTARGVNNTADVRVAAIARNVGLLSAFSAFIQVDTLRELYGLNAATTGALH
FT                   LYLRDPGDAPRVAARLRTALADAGFRVMEPDAQPYWMKLMQTVPSEDWTGQKLDVTTAD
FT                   DEMGQFKQFILALRVVTGLLVVILMVVVVIGLLNTLAIAIRERTREIGALRAIGMQRRK
FT                   VMWLFLLESALLGALGTAAGVAVALAVAVAVNAAGIALPEAVQVFLAQERLAFLLDPRA
FT                   IVGDALLLSAITVVASIFPARRAARLKPVTAMHHVG"
FT   sig_peptide     559430..559555
FT                   /locus_tag="Anae109_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.756) with cleavage site probability 0.224 at
FT                   residue 42"
FT   gene            560746..561522
FT                   /locus_tag="Anae109_0498"
FT   CDS_pept        560746..561522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24712"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L6"
FT                   /protein_id="ABS24712.1"
FT                   /translation="MHRVPLVTAALALLASAAPALALTAPELAKVVATIDERQRNSGDW
FT                   KALCYMEAKEKGKTDVVYELVVYRRDEDDKQMFLFTKPRAEAGKGYLRIDKNLWLYDPA
FT                   VGRWERRTERERIGGTDTRRGDLDESRLVEEYDATFEADEKLGAYDVHRILLVVKPGVD
FT                   VAFPKVRLWVDRATLNVLKRQELALSGRLMRTAYYPRWKKLFSPSKRADVWYPEEMRIF
FT                   DEIEKGNSTLILIKEIDLRPLAANLFTKAWLESKSR"
FT   sig_peptide     560746..560814
FT                   /locus_tag="Anae109_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.964 at
FT                   residue 23"
FT   gene            561609..563192
FT                   /locus_tag="Anae109_0499"
FT   CDS_pept        561609..563192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24713"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L7"
FT                   /protein_id="ABS24713.1"
FT                   /translation="MRIAVALAALAVATASLGQERPTEEELFGKPPAESPQATGEEEQE
FT                   PQPRQPEERPGSPRPEEAELFGGTGSPNAAPPPAEGILPRDVADPLRLGGQLYLRAQAL
FT                   WQEEVAPADWSLSTPNLLDLWLDARPNDRVRAFTLARMRYDPTAPETDESALPAAEQAL
FT                   LTDATSTRGLVTGVRGPRVLLDQLWVNFDVGRHVFVTAGKQHVKWGVGKFWNPTDYLHP
FT                   VRRDPLAVFDERTGTTMVKVHVPWERRGWNAYGVALLEDVAGRVEPTNRVGRIGVGGRA
FT                   EIVAGTVELGADALAQDGRRPRFGVDVSAGIWDLDVYAEAALRTSRDAPRWTEVDPGAP
FT                   LVARYARDDPEGFTPAVVLGGSWSANYSDEDALTVGAEYSFDDAGYDSKDVYPFLLAGA
FT                   PELTGELAAPFRQRDPTAFRPFYLGRHYAGAFLLLPSPGRWNDTTVTLSVLGNLSDRSF
FT                   VARLDHAVLALTYLRVESFVAASFGARGGEFRLGLDVPLSDVAPGLPSDQAISVPAPVL
FT                   QLGLALRVAL"
FT   sig_peptide     561609..561665
FT                   /locus_tag="Anae109_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 19"
FT   gene            563357..563728
FT                   /locus_tag="Anae109_0500"
FT   CDS_pept        563357..563728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0500"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   ade:Adeh_3932 protein of unknown function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24714"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L8"
FT                   /protein_id="ABS24714.1"
FT                   /translation="MRKQVSGKYDEVLAKIPELLKGEGFGVLTRIDVTATVKEKLGVDF
FT                   RRYQILGACNPKLAHQALTYEVGLGVMLPCNVAVWEDDAGKVIVSAVDPLQTIASQDPN
FT                   LEPIARQVREKLSRVLAQL"
FT   gene            564270..566213
FT                   /locus_tag="Anae109_0501"
FT   CDS_pept        564270..566213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0501"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 2; KEGG: tbd:Tbd_1072
FT                   conserved hypothetical protein containing twin-arginine
FT                   translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24715"
FT                   /db_xref="GOA:A7H7L9"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L9"
FT                   /protein_id="ABS24715.1"
FT                   /translation="MRRAVHSTLAAPAVALAVCTAAVASAQDPSVPESIPKYDRPLVIP
FT                   PAMPVTSTPVVPGVGPIDYYEIAVRSLSQQILPVGYPQTTVWSYGSVNHPGTLNYPAFT
FT                   IEARFARPVRVKWINDLVDEEGAPLPHLLPVDQTLHWANPPGGVEGRDMRPSTPVVEPY
FT                   LGPVPMVPHLHGGHNAQESDGYAEAWFLPAAAYSDEAFEDFAKEGRWYAPFKALFESKY
FT                   GVEWEPGTATFQYENDQRAGTFWYHDHTLGMTRVNVYAGPAGFYLLRRGPGDLPAGLPG
FT                   PAPTVGSDPFGTFYEIPIAIQDRSFKSDGSLFYPATRAFFDGFPQPYIPDSDVSPIWNP
FT                   EFFGTTMVVNGRTWPYLEVEPRRYRFRFLNGCNSRFLILKIAGDALEERPAQPALHFVQ
FT                   IGGEGGFLPSPVVLDQLLLGLAERADVIVDFTGLEPGTELFLVNEAPDEPFGGGRVVED
FT                   FDPADPETTGQVMKFRVVELQGRDGSLPVDRLKLPAAPPLPPATATRRLSLNELESTMG
FT                   GEGPIAALLGTMEGAEPVPLFWDDEVTEIPRLGATEIWEMSNFTADAHPIHIHEVQFQV
FT                   VDRQPFGGATRAPEPWEAGYKDTVIAYPGEITRVKAKFDLPGLYVWHCHIVEHEDNEMM
FT                   RPYCVGECPALE"
FT   sig_peptide     564270..564350
FT                   /locus_tag="Anae109_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.920 at
FT                   residue 27"
FT   gene            complement(566302..568623)
FT                   /locus_tag="Anae109_0502"
FT   CDS_pept        complement(566302..568623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0502"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   ade:Adeh_3930 malate dehydrogenase (oxaloacetate
FT                   decarboxylating) (NADP+)., phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24716"
FT                   /db_xref="GOA:A7H7M0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M0"
FT                   /protein_id="ABS24716.1"
FT                   /translation="MATDFTPPKNPPSSPVPNPKKKIRREDALAYHSSGRKGKIEVVAT
FT                   KPMATARDLALAYSPGVAEPCLEIEKDQDLSYLYTARGNLVAVISNGTAVLGLGDIGAA
FT                   AGKPVMEGKGVLFKRFADIDVFDIEVDEKNVDAFCKVVKALEPTFGGVNLEDIKAPECF
FT                   VIEERLKREMQIPVFHDDQHGTAIISGAALLNALEIAGKDIAKVKVVVSGAGASAIACT
FT                   KFYLSLGVRRENVVMVDTKGVIYRGRTEGMNEWKTEFAVDTKARTLADAMKGADVLLGC
FT                   SAKGMVDQDMVRSMAKDAIVFALANPDPEISYPEAKEARLDVIMATGRSDYPNQVNNVL
FT                   GFPYIFRGALDVRAKAITEEMKMAAARALAALAKEDVPDSVSRAYGGEKFRFGREYIIP
FT                   KPLDPRVLLWVAPAVAKAAMDGGVARQQIDLGEYRDRLRKMQSRANQVMGSIISKAKKK
FT                   LTRIVFPEGHHPKIQQAAEILREEAICEPVLLGPVEDIQRSIQEQRLDDLDGVTIIDPM
FT                   TSDAFSRYVARYWELRRRRGVTFEEAQRRMRMRNYFAAIMLEQGAVDGLVTGLTSGYAA
FT                   SVRPSLEVVRTRPGQRAAGVYIVVTKNDFKFFADCTVNVDPSSEELAEIALTTCDLARY
FT                   FDVVPRVAMLSYSTFGSAEGPSPRKMAIAKDLVRQHHPELEVDGEIQVDIATNTEVRVP
FT                   EFPFSTLKDNANVFVFPNLDAANIAYQMLANVGGAEVIGPVLIGMQKPVNVLQMGCSVQ
FT                   SIVNLAAITALRAQGDKFLF"
FT   gene            complement(568870..570696)
FT                   /locus_tag="Anae109_0503"
FT   CDS_pept        complement(568870..570696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24717"
FT                   /db_xref="InterPro:IPR025150"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M1"
FT                   /protein_id="ABS24717.1"
FT                   /translation="MPEPTQPFPRFVPLLLAAALVAPLRAGAAQVWTALATEKIRPATA
FT                   ARAEASARIAAARNEFEAFQIVVTGAASDVRATASELSGPATFGGVRLYRESIIHLQNA
FT                   SSLDGATGPWPDALVPEVDELSNERRNAFPFAVPSGESRAIWVEVFVPPEAPAGEYTGA
FT                   VSVTWQGGSATVPVTLTVWPFTLPSTASLKSAFGFTYGAIPGGHGVGAADAFAALRERY
FT                   GRLALDHRITLSHVDDGSAAIDHAASLYGPAMDGAAPTALRGARMTSYELLYDAKSWST
FT                   YFDGEGWLDRLFQYTCDEPPLTCAWSDIPARAATARAANVRTLVTTSIQEADAQGVTGS
FT                   IDVIVPVINYLDDREGTYAGNQRAKYDAFLAGSPRRELWAYQSCMSHGCGGTVNFGSPS
FT                   WSDRYFTGWPSYMIDASAVRNRAMEWLSFRYRVTGELYWETAYAYSHDAWTNQWDFNGN
FT                   GDGTLFYPGTPAKIGGTTHVPVASIRLKMIREGMEDYEYLKLLSDAGDEAFAREVADAL
FT                   FPNPYSTEVAPATLMAAREKLARRIVELGATAPAPDGEPLPLPPPPAGDDGTAGSGDGL
FT                   GVVRAGCASGSGAGALALAGLAAALRLRRRRA"
FT   sig_peptide     complement(570610..570696)
FT                   /locus_tag="Anae109_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.941 at
FT                   residue 29"
FT   gene            complement(571240..571731)
FT                   /locus_tag="Anae109_0504"
FT   CDS_pept        complement(571240..571731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24718"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M2"
FT                   /protein_id="ABS24718.1"
FT                   /translation="MTRDEKVRALREKARVLYEGKEVAHRSCGVALAETFGRDPRPYLT
FT                   LRRGGLTGEGLCGAVLAGQLVLGELLGGDDFTAPAPPALREALERYRAAVAARLRTGGA
FT                   ESLVCNALVGRFPIFQSEERAAFCTDIAATVAEIVAEIAVDLGAEVEVTAMRPSTPLRG
FT                   "
FT   gene            complement(571728..572669)
FT                   /locus_tag="Anae109_0505"
FT   CDS_pept        complement(571728..572669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0505"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycolase; KEGG:
FT                   ade:Adeh_3929 DNA-formamidopyrimidine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24719"
FT                   /db_xref="GOA:A7H7M3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M3"
FT                   /protein_id="ABS24719.1"
FT                   /translation="MPELPDIEVYVEAIAARVRARPLLRVRLGSPFVLRSVDPPLGEAA
FT                   GKRVEDVRRVGKRIVLALEGDLFLALHLMIAGRLHWREAGAKLPGRVGLAALDFEDGTL
FT                   VLTEAGTKRRAAIHLVRGAAALAALDRGGIEPLDADLAAFRAALTRENHTLKRALTDPS
FT                   LLSGIGNAYSDEILHRARLSPVKLTSRLTDEELARLHAATRAVLTEWTDRLRREAAGGF
FT                   PEGVTAFREEMAVHGRHRQPCPVCGTAVQRIVRAENEVNYCPRCQTEGQILSDRSLARL
FT                   LKEDWPRTIEELERNPALGAPRPPPAPRRRSR"
FT   gene            complement(572701..574062)
FT                   /locus_tag="Anae109_0506"
FT   CDS_pept        complement(572701..574062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0506"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; AAA ATPase;
FT                   KEGG: ade:Adeh_3091 sigma54 specific transcriptional
FT                   regulator with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24720"
FT                   /db_xref="GOA:A7H7M4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M4"
FT                   /protein_id="ABS24720.1"
FT                   /translation="MPRLPEHSPSLFPDVDTVESLRRVADALPEGVFVTDRDGKVTFWN
FT                   RGAERITGWSRDEAIGQRCSLLAGDYVNGCTCGAGPLYCGIAERSRTARRCTLRTRDGR
FT                   PQVIVKNAIALYAADGTPVGTLETFTDVDPGPELACALGGAVAATAPGDLCGLVGRHPA
FT                   MVELYRMIRLVARSSATVMITGESGTGKDRIAEAIHSLGERAAGPLIRYSCAALDPGAA
FT                   EGELFGTSDGRRGRIASAERGTLLLDEVSGAPPALQTKLLRLVEDRTFTARDAAPIPAD
FT                   VRILCTTQRDLRHLVQEGRFRADLYFRLAAFPLHVPALRERIDDVPLLAERFLAEQRAA
FT                   GHAVGTLSPQTLRVLRAYPWPGNVRELRNTIEYAALVAGAGEIAPEHLPRDVLESRAAP
FT                   GTPCDPDVDARRALVEALERTGWNRTRAAELLGVSRVTLWKRMRRLGVADPGER"
FT   gene            574393..575838
FT                   /locus_tag="Anae109_0507"
FT   CDS_pept        574393..575838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0507"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: ade:Adeh_3928 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24721"
FT                   /db_xref="GOA:A7H7M5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M5"
FT                   /protein_id="ABS24721.1"
FT                   /translation="MALSEDVLFSGVDALSQRLRARELSPVELTEAFLARIDAHAGRLG
FT                   CFVTVTPERALAEARAAETELAAGRWRGPLHGVPFGLKDLVDTAGIRTTFGAAPYADRV
FT                   PTRDAAIVTRLAQAGAVLLGKLSMVELAGGLGYHTGAAALNGPCRTPWDLARWSGGSSS
FT                   GAGSAVAAGLVAFAIGSETWGSITCPSAFCGVTGLRPTYGVVPRHGAMALSYTMDKLGP
FT                   MARSARDCALVLDAIAGPDARDPSAISPPPGLARVRPQVARGLRVAVLGFPEKPEPAPG
FT                   AREAFARAEEVLREAGGLLEPAALPELPYEPLANLFIEAEVATACEELIRSGRTRELAD
FT                   ASHRAKRPEDYLPKANAADYVRAMRVRGEVQRALAGFFTRHDLVLAPNLPFTPPRVDEN
FT                   FDALFASPDPLGAAGNVAGLPAVAVPMGFSGGLPLSMQLVGPPLEEGRLLSVAALFQAR
FT                   TEHHLARPDLSPPAVPMAAVTPR"
FT   gene            575835..576608
FT                   /locus_tag="Anae109_0508"
FT   CDS_pept        575835..576608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0508"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; KEGG: ade:Adeh_3927
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24722"
FT                   /db_xref="GOA:A7H7M6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M6"
FT                   /protein_id="ABS24722.1"
FT                   /translation="MTFAPDHSTVPVIAAIGYFLTGLVILLALPLQLLLFALTFPFDRN
FT                   RAVVGRFSRLAAVAVTRTFPPWRLRVEGRWPAGRQAYVVVANHQSLLDILMLSKLPREM
FT                   KWVAKESLFKVPWVGWIFRISGDIPVRRGDSESGGAALAKARRYLERGMNVMIFPEGTR
FT                   SVSAKLLPFKSGAFRLAIEAGVPVLPVAVHGAAQGMPKGSPWVRPCRAYARILEPVPTA
FT                   GLTIEDTGRLKEEVRRRIAAALPASDVGNGEQRAG"
FT   gene            576725..577984
FT                   /locus_tag="Anae109_0509"
FT   CDS_pept        576725..577984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24723"
FT                   /db_xref="GOA:A7H7M7"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M7"
FT                   /protein_id="ABS24723.1"
FT                   /translation="MRALDFASPLARRRYARDDRPPESYNARVTILLGYGARPLPLPDV
FT                   PGARVLLPPVAPPVAELAAALDAALAHPVGARPLASVATARTRVVVIVSDSSRDEPRSE
FT                   LFSAVRRALAAVPDDHLTVAVANGTHGPKPLERLGLPEEVLRRHRVVNHDARDDASMVE
FT                   MGRTSRGTRIRVNRCVAEADLVVSTGKVKPHYFAGWGGGAKGIFPGLGHDVDIRQNHKL
FT                   KADPASALGRADGNPCREDIEEAVRRIGRDTYLVNVVEAGATILGAVAGDVVYAHREAV
FT                   RLARPWCEVEAAPADIVVVSAPLPVSGSLYQASKLIPPAGLLLREGGVVIVAAECPEGT
FT                   GPLKVVNEGIFELGVRRYLPAGATVLLVSGMDEATVRGTYATYAPDLASAIARARALVA
FT                   KSDPSVLVLPDAGDLVPRAG"
FT   gene            complement(578194..578877)
FT                   /locus_tag="Anae109_0510"
FT   CDS_pept        complement(578194..578877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0510"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: ade:Adeh_3914 bifunctional
FT                   deaminase-reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24724"
FT                   /db_xref="GOA:A7H7M8"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M8"
FT                   /protein_id="ABS24724.1"
FT                   /translation="MSRLRINSFAISIDGYGAGPGQSLDHPMGVGGMALHQWVLGTKTF
FT                   QRMHADFAGSLIGDEVAREDVDDAFAARGFENVGAWILGRNMFGPVRGPWPDDGWKGWW
FT                   GSNPPYHVPVFVLTHHARAPIEMEGGTTFHFVTDGIHAALERAREAARGKDVRLGGGVA
FT                   TIRQYLTAGLIDELHLAISPVLLGRGEHLLAGIDTVSLGYTCTEHASTDLATHVVLTRS
FT                   PRNPR"
FT   gene            complement(578906..579385)
FT                   /locus_tag="Anae109_0511"
FT   CDS_pept        complement(578906..579385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0511"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: rha:RHA1_ro08706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24725"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M9"
FT                   /protein_id="ABS24725.1"
FT                   /translation="MSTVRSLEPESEREMVITRLVQAPRRLVWQAFTSAENLGRWWGPE
FT                   GFRTTTSEFELRPGGRWVHVMHGPDGTDYPNQLTWREVVPPERLTYLHAGDDGHTFESR
FT                   IVLEERGGATLVTMRALFPTRAERDLVVERYRADEGGEQTLGRLAALCEAQVGQT"
FT   gene            complement(579382..579756)
FT                   /locus_tag="Anae109_0512"
FT   CDS_pept        complement(579382..579756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0512"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   rha:RHA1_ro08705 probable transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24726"
FT                   /db_xref="GOA:A7H7N0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N0"
FT                   /protein_id="ABS24726.1"
FT                   /translation="MPIWVYVSPGMARAATTTDAWNAVAEPQRRRILTLLRGGEQPVTE
FT                   LARALRMDQPRASKHLRVLREVGLVRVREQGRQRLYALDARGLRPIHEWVGGFERFWNE
FT                   SFARLDAFVQELAEQEERKR"
FT   gene            complement(580571..581386)
FT                   /locus_tag="Anae109_0513"
FT   CDS_pept        complement(580571..581386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0513"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: ade:Adeh_0471
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24727"
FT                   /db_xref="GOA:A7H7N1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N1"
FT                   /protein_id="ABS24727.1"
FT                   /translation="MCTTCGCGDTELVPVELHEKILAGNDRAARHNREHFLEAGVLALN
FT                   LMGSPGAGKTAVLEATAKAAAAKGWKLGAVSADLATDNDARRLQKAGIPSKAITTGQAC
FT                   HLDAELVHRSLHDFPWRGTDVFFIENVGNLVCPAIYDLGQAANVVVLSVTEGEDKPLKY
FT                   PVMFHAADLVLLTKCDLVPHLDVELAKVHDALARVMPRPHVIEVSARTGQGMDAWVRWV
FT                   EELRNGFGLREVKAHSHSHDHAHAHEHAHHHGHGHEHAAADGRPGKHGR"
FT   gene            complement(581386..581730)
FT                   /locus_tag="Anae109_0514"
FT   CDS_pept        complement(581386..581730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0514"
FT                   /product="hydrogenase expression/synthesis HypA"
FT                   /note="PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   ade:Adeh_0472 hydrogenase expression/synthesis, HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24728"
FT                   /db_xref="GOA:A7H7N2"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N2"
FT                   /protein_id="ABS24728.1"
FT                   /translation="MHEYSLIEALVTRVEAEARKRNALAVHKLSVRVGELSGVDPELFQ
FT                   TAYETFRAGTICADAPLTLTRVAASWSCPRCKTPIARGAILRCPACDAPGKLDDGSDAL
FT                   TLDGIEMEVP"
FT   gene            complement(581737..582759)
FT                   /locus_tag="Anae109_0515"
FT   CDS_pept        complement(581737..582759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0515"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: ade:Adeh_0473
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24729"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N3"
FT                   /protein_id="ABS24729.1"
FT                   /translation="MDKPVAKIGLKHGSGGRAMRQLIEDVFLTLASPVDGIGLSALDDG
FT                   AAIRVGDRWLVVTTDSHVVHPIFFPGGDIGRLSVSGTVNDLAMMGATEPLGLTCAVVLE
FT                   DGFPRADLERVVASMRETAREANAPIVTGDTKVMGKDEVDGIVLNTTGVALAERVVSDA
FT                   GLRAGDLLIVTGTIGDHGMAIMSRRHDLRLEGDLRSDVAPLNGLVREALRAGGEDVVAM
FT                   KDPTRGGVAGVLHEMAAKGKVGIVIDETALPVRDEVRAAGEMIGIDPLLVANEGKAVIA
FT                   VRARAADKVLAALRAHPLGASATVIATAIAERPGAVILDTGFGKRMLAEPEGELLPRIC
FT                   "
FT   gene            complement(582760..583899)
FT                   /locus_tag="Anae109_0516"
FT   CDS_pept        complement(582760..583899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0516"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein; KEGG:
FT                   ade:Adeh_0474 hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24730"
FT                   /db_xref="GOA:A7H7N4"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N4"
FT                   /protein_id="ABS24730.1"
FT                   /translation="MAGKDLFQELKFRDPVRARALAEAIAREVDAIGRTVPVMHVCGSH
FT                   EQAIARFGLRAVLPPGLELIMGPGCPVCVTDGPEVDEAVALALQGARVCTYGDMLRLPG
FT                   TARSLADAQADGAKVEVVYSVSQAVELAQKHPEDEVVFLGSGFETTAVATAAVALASPP
FT                   KNFSILSVHKYVPAAMNVVAESPQTNIEGYIAAGHAAIITGWGIFEPFAARTGKPVVVA
FT                   GFEPLDILAAILQLVELMRQGKAEVANVYPRCVTKEGNLPAQRSLWKVFRPVTGTWRGI
FT                   AEVRDGNLDLRPEYAHLDARKRFRIDTAPVRDEDAEEAAKGCICGSIMLGLANPGDCAL
FT                   FGKTCVPESPVGACMVSSEGQCRIWHTYGGVPDLRKVGT"
FT   gene            complement(583955..584242)
FT                   /locus_tag="Anae109_0517"
FT   CDS_pept        complement(583955..584242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0517"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: ade:Adeh_0475 hydrogenase assembly chaperone
FT                   HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24731"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N5"
FT                   /protein_id="ABS24731.1"
FT                   /translation="MCLGVPGKVVAIDGMSATVDFFGVKKELRLDIVDEPVSVGDYVLN
FT                   HVGFAIRRIPPDEVQETLALFDQILDVTGAKADLMAEDVRGEIAAAKHKA"
FT   gene            complement(584263..586608)
FT                   /locus_tag="Anae109_0518"
FT   CDS_pept        complement(584263..586608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0518"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC domain; zinc finger
FT                   HypF domain protein; KEGG: ade:Adeh_0476 (NiFe) hydrogenase
FT                   maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24732"
FT                   /db_xref="GOA:A7H7N6"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N6"
FT                   /protein_id="ABS24732.1"
FT                   /translation="MTRAARASDGAPPVEGRRVRVTGTVQGVGFRPFVYRLSHAHGLSG
FT                   RVWNDASGVTIEAFGSAGALDRFERALRTDHPPAAVVETLRSEPIAGEPSVGFEIVESG
FT                   ASSERRAAIPPDLATCPACERELRDPHDRRHGYPFTNCTDCGPRFTIAHGAPYDRPATT
FT                   MASFVMCEACAREYADPLDRRFHAQPNACPACGPRVRVVARDGAPVEAADPIGHVGRAL
FT                   AAGAIAAVKGIGGFHLACDATSSAAVATLRARKRREEKPLAVMVRDLDEARRLAEIGEA
FT                   EAALLASVERPIVLCRRRPEARFDGLTVSGSLAPEVAPDSPLVGLLLPYAPLHHLLLGA
FT                   AARPLVMTSGNLSEEPIAFEDDEALRRLGGIADLFLVHDRPIASRCDDSVARTVAGRPL
FT                   VMRRSRGYVPRPVIVHRRFARPVLGVGAQLKNTFCLARGDEAVLGPHVGDLDNLETYAA
FT                   YEGAIARLEGFLALRPEVVACDLHPLYLSTRYARERAAALGVPLVEVQHHHAHAAAAMA
FT                   EHGLDGPVLALAWDGTGLGTDGAAWGGELLLVERDRFERLATFRPLPLAGGDRAIREPW
FT                   RIALAAVLDAFGEDAPLEALPLFRAVPPAELAVVRRLLATGLNAPPAHGAGRAFDAAGA
FT                   LALGRGVSRYEGQVALALDNAATGAAEAPYPFDLDTSRPVTELDLRPLWRALVADVIAG
FT                   APPAAVSSRFHAALARAGAELVRRASRTTGRLPIVLTGGCFQNARLAEGILGELSLSFE
FT                   VYPHGQVPPGDGGIALGQALVADARAHP"
FT   gene            complement(586659..587228)
FT                   /locus_tag="Anae109_0519"
FT   CDS_pept        complement(586659..587228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0519"
FT                   /product="zinc finger HypF domain protein"
FT                   /note="PFAM: zinc finger HypF domain protein; KEGG:
FT                   ade:Adeh_0476 (NiFe) hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24733"
FT                   /db_xref="GOA:A7H7N7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N7"
FT                   /protein_id="ABS24733.1"
FT                   /translation="MASFVMCEACAREYADPCDRRFHAQPNACPACGPRVRVVARDGAP
FT                   VEAADPIGHVGRALAAGAIAAVKGIGGFHLACDGTSSAAVVTLRARKRREEKPLAVMVR
FT                   DLDEARRVAEVGEAEAALLTSVERPIVLNPIARPRVPRLVRGSAARPPGVPPVPSPALR
FT                   ATGSFPPIKGRFSPAVPCGGAAVRRK"
FT   gene            complement(587433..587951)
FT                   /locus_tag="Anae109_0520"
FT   CDS_pept        complement(587433..587951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24734"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N8"
FT                   /protein_id="ABS24734.1"
FT                   /translation="MLNSGPTQCGALGMSVRFGTIGTDHNLAFGASSCIDASKPIAFWD
FT                   SQSTYSFALRLPETSGDPATVRADLFDVTGDGFQDVVVREVPAAGTYPTSTTWSVFPGY
FT                   RDASTGALGFGSALSYVVAGIGAFRGEIAGGTAACLGGVGSGVSEQGLVDINGDGLSDR
FT                   ICFEALRAQ"
FT   gene            588038..589768
FT                   /locus_tag="Anae109_0521"
FT   CDS_pept        588038..589768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0521"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   chu:CHU_3773 4-amino-4-deoxy-L-arabinose transferase (lipid
FT                   A modification)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24735"
FT                   /db_xref="GOA:A7H7N9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N9"
FT                   /protein_id="ABS24735.1"
FT                   /translation="MIPSFWAQRGEHIPSAHIPASRPRLVAALFLALIAIGLLLNLGVR
FT                   PLAFEEPRRGLVALEMQLRGDWVVPTTNGVPYLNKPPLFNWVLLGFMKVFGSTAEWVVR
FT                   LPTVVSFLLTACLVYAVARRHLQRQTALVAAALYLTFGQLLFKATLAGEIDLFFSLVVA
FT                   AQALAIFHFEQSGQLLPLFLVSYLLAAAGVLTKGVPSLAFQGVTLLVWLAHARKLRTLL
FT                   SWQHAAGLCAFALCAGGYFALYARRAELAPFLANVLLESSERTAAGPGHGLAAVLVHAA
FT                   RFPLELLWLLVPWTAFVPLLLAEGFRATLAERPLLKFCVLFTGANLVPYWLSPGTRQRY
FT                   LYMFLPFAALLLAAALERARRDDWYPRLVEWTLGACLAACTLAAAVIPFTRLGAFLSSP
FT                   AAWVVVCGWLLALSVAYGRRPDARVMAALLAIACLRIGYDLLVPNVRRTTSGASYYREV
FT                   ASTLNERYAHEQIALVARTWETARDLPFVGRSVAVRQVEFFPSSLSFYFTAGRRQLLEL
FT                   APELVPSRLYLARSTFRVDRDHEVLEIFRTTLEDTQELKLVRIAASPTTDPARQAAPAR
FT                   "
FT   gene            complement(589710..590243)
FT                   /locus_tag="Anae109_0522"
FT   CDS_pept        complement(589710..590243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0522"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52 hydrogen uptake protein; KEGG: ade:Adeh_0477
FT                   peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24736"
FT                   /db_xref="GOA:A7H7P0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P0"
FT                   /protein_id="ABS24736.1"
FT                   /translation="MSSPRIAVIGIGNVLTGDDAVGPHVVRVFEARYAVPHDVQVMDAG
FT                   TPGYDLTAFIAGLEALVLVDAVKAKAPPGTLRVYDKEELLKKAPLLAMSPHEPGVREAL
FT                   MNAEFMGVSPRIVKLVGVVPASVATGIGLSAEVRAAIPAAVAQVAKELGAVGVVVTERV
FT                   PPVEPDLWWEKPRS"
FT   gene            complement(590370..592106)
FT                   /locus_tag="Anae109_0523"
FT   CDS_pept        complement(590370..592106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0523"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: ade:Adeh_0478 nickel-dependent hydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24737"
FT                   /db_xref="GOA:A7H7P1"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P1"
FT                   /protein_id="ABS24737.1"
FT                   /translation="MGKLITIDPVTRIEGHLRIDVEVDGGAVKNAWSSGTMWRGIETIL
FT                   QGRDPRDAWVFTQRICGVCTTVHAIASVRSVENALGLEIPLNAQLIRNVIMSAHSLHDH
FT                   IVHFYALSALDWVDVVAALKADPEKAADLADSLGLQWAGNSKHALAAAKEKVAGFVQAG
FT                   QLGIFTNGYWGHPAMKLSPEVNLLAVAHYLQALDVQRKANQAVAILGSKTPNIQNLAVG
FT                   GVANAINLDSPAALNMEKLYQVKTLLEEVVTFVQQVYLPDVAAIAASYPDWLKYGAGVT
FT                   NYLAVPDMPTDAKMTQFDLPGGIIWNGDLSNVKPVTSWNDDYLRQNVTESIARAYYEGD
FT                   TVRQPWEGQTNPKYTGDWKAETPAPEKYTWVKAPRLEGKPVQVGPLAQVLVGYANGHES
FT                   IRKWSDWCLGTAGKIAGVKLTPAVLHSTLGRHAARAIRAATMGELALKHWKLLIENIGK
FT                   GDTAIFVDPMKNLKPGTYRGVGFHEAPRGTLSHWAVIETDGKEMKLANYQAVVPSTWNA
FT                   GPRDAKDQLGPYEKSLVGNPIADPKLPLEALRTIHSFDPCLACAIHTVDAEGEEISRVK
FT                   VL"
FT   gene            complement(592125..593375)
FT                   /locus_tag="Anae109_0524"
FT   CDS_pept        complement(592125..593375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0524"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   ade:Adeh_0479 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24738"
FT                   /db_xref="GOA:A7H7P2"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P2"
FT                   /protein_id="ABS24738.1"
FT                   /translation="MSAHEHPKAIGGKLLAPPMKTLLALFGVAAAVMLYRFIVGVGPVS
FT                   NMTDGFTWGIWEPLNVVVFTGIGAGAFSVGLLCYALNKGQYHALVRPAVLVGAIAYTLG
FT                   ASSIVVALGRYWNAYWLPWLPYWNLSSALLEVAVCVIAYVTVLWVEVLPSVLEGAAASR
FT                   HPRFAAIGKRWGPRLHRALPFIIALAIVLPTMHQSSLGGLMLIAETKVHPLWHTALLPT
FT                   LFLVSCLSMGFGAVVALVTLLKLTWNGKHDQKLLAQLSKVNAGLLFFYVALRLGDLAWS
FT                   GKLRYLGANFYTALLLVELALFLAPAVLFLLPRVQANRGRLFGAALLAVLAGAAYRMDT
FT                   YLSVYRPAGFDANGKAIPAGWAYFPSLGETLVTLGMASVGVAIFIVISRLFPVVAVDER
FT                   PKHSKLESGAMKTAASR"
FT   gene            complement(593372..594322)
FT                   /locus_tag="Anae109_0525"
FT   CDS_pept        complement(593372..594322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0525"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ade:Adeh_0480 Fe-S-cluster-containing
FT                   hydrogenase components 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24739"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P3"
FT                   /protein_id="ABS24739.1"
FT                   /translation="MAITRRDLLKGAAVAGAATALAGKAEAREAVQPLPDAVGMLFDAT
FT                   RCVGCRACVTRCKEANELPYDRTPDGQYDAPNDLNGTTKNIIKAHPAGDSQTYMKQQCM
FT                   HCVDPSCVSVCMMGALHKEAQGKRLMKGERSVATGIVLWDKDLCVGCRYCQIGCAFNVP
FT                   KFEWDDAFPKIVKCELCRHRGDPKKEGPLAVANPACCEACPREAVIYGRRAELLAEAKR
FT                   RVAAEPERYEAKVYGEHDGGGTQVLYLAPKGVEFTALGLPVLPERSSAEFSEKVSHAPY
FT                   LHGLTPIALYAGLAFVIHRNRKKEEAAEHGPEGKR"
FT   sig_peptide     complement(594239..594322)
FT                   /locus_tag="Anae109_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.956 at
FT                   residue 28"
FT   gene            complement(594329..595510)
FT                   /locus_tag="Anae109_0526"
FT   CDS_pept        complement(594329..595510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0526"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   Nickel-iron dehydrogenase small subunit domain protein;
FT                   KEGG: ade:Adeh_0481 hydrogenase (NiFe) small subunit
FT                   (HydA)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24740"
FT                   /db_xref="GOA:A7H7P4"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P4"
FT                   /protein_id="ABS24740.1"
FT                   /translation="MLQFKTGAVVFAHPEDGMNDMRSEVLGLGTAKGVSRRDFIKVCTT
FT                   AAAAVGLPAWAGEKMAENVAKGRKPSVIWLHFQECTGCTESLLRTSHPDVGSLILDLVS
FT                   VDYHETLFAAAGLQIEEALEKAMHENEGKFVLVVEGAIPTKDGGIYCQVGGKKAVDTLS
FT                   EVAAKAGAVIAIGSCASWGGIPSAEPNPTGATGVPQLLKGKSVVTLPGCPANPYNLLGT
FT                   VLQYATFGTLPALDDLGRPKFAYGRVIHEDCQRRPHFDAGRFAQAFGDEGHRNGWCLYK
FT                   LGCKGPQTHANCSLLDFCEVPGAWPVAIGHPCVGCTEQGIGFHVPIYTNLPVERPTAPM
FT                   AYPAVHPDHDVLGRGNGAIAIGVGSAIAGAVIGAGVMATRKLTAEAEKEEGKE"
FT   gene            complement(595945..597231)
FT                   /locus_tag="Anae109_0527"
FT   CDS_pept        complement(595945..597231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0527"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   sus:Acid_7416 protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24741"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P5"
FT                   /protein_id="ABS24741.1"
FT                   /translation="MDATALLLLALGLALGAVAGFLARSGDARRAAERAVRIAELEATL
FT                   AAERAGAEEKRALVEDARARLSDAFKALSADALRDSSASFLELARAALGRERAAAEGEL
FT                   ARRQEAIGSLLAPVRDALGRLDGELRAIERAREGAYGALTEQLRQVAEAQAQVRGEAAN
FT                   LVKALRAPQARGRWGELQLRRVVELAGMLDRCDFEEQATVEGDEGRLRPDLVVRLPGGR
FT                   NVVVDAKAPLSAYLEAIEARDDGERRARLADHARQLREHVQQLGRKAYWERLRPAPEFA
FT                   VLFLPGESFYAAALEADPTLLEASAERQVIVATPTTLIALLKAVAHGWRQAEVAENAEA
FT                   VAALGRELYKRIADLGGHFARLGRALGGTVEAYNRAVGSLEARVLPAARRFEALSAAPA
FT                   EAELPELAPLDLVPRDVVAPELADPFAAR"
FT   sig_peptide     complement(597172..597231)
FT                   /locus_tag="Anae109_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.482 at
FT                   residue 20"
FT   gene            597368..599050
FT                   /locus_tag="Anae109_0528"
FT   CDS_pept        597368..599050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0528"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="KEGG: ade:Adeh_0483 MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24742"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P6"
FT                   /protein_id="ABS24742.1"
FT                   /translation="MRIFARSLAAALAFAALPADAASAARFPDAAALRRAEARYAPVDL
FT                   KVDVSRLPESERRALALLVEAARVMDALFLRQAWAGNEPLLLVLAQDRSPLGQARLAAF
FT                   LRNKGPWDRLEHGEPAFLPGVPEKPAAANFYPAGATKEEVERWLAGLAPEAKAEATGFF
FT                   TTVRRAPGGGLVAVPYALEYQGDLARAAELLRAAAAATSDATLRKFLEARAQAFTSNDY
FT                   YASDVAWMELDASVEPTIGPYEVYEDGWFNAKAAFEAFIGVRDDAETAKLQRFAAELQG
FT                   IEDALPIDAALKNPKLGAMAPIRVVNELLAAGDAMKGVQTAAFNLPNDERIVREMGSKR
FT                   VMLKNVQEAKFQRVLLPIAGIALSKADRAAVAFDPFFTHILMHELLHGLGPHELVLGGR
FT                   TTTVRAELGDTYSALEEAKADVAGLFALQKLLDEGKLDRGMQRTLYPTFLASAFRSIRF
FT                   GVGEAHGRGMALQLSWFLDAGAIAPRPDGSFAIDAAKMREAVVSLTREIMTIQGKGDRA
FT                   AAQALLEQKGVVRPEVQRVLDRLRGIPVDIAPRFVTAEALTQR"
FT   sig_peptide     597368..597433
FT                   /locus_tag="Anae109_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            complement(599084..601063)
FT                   /locus_tag="Anae109_0529"
FT   CDS_pept        complement(599084..601063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0529"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: ade:Adeh_3529 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24743"
FT                   /db_xref="GOA:A7H7P7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P7"
FT                   /protein_id="ABS24743.1"
FT                   /translation="MQRRVPLESPAGVTEGDLGERGEGCRDGAVGEDREFRAIFELAGS
FT                   GKAIADPARRRLVRVNRRFCEITGYTAEELLDREVTEITHPADRARDAAAVEAALRGET
FT                   DGWNIEKRYVRKDGLIAWVVVTGNVLRDAAGAPVRTVATVHDITARKRIEEDLRASEAL
FT                   LRLAQRAAHAGVWELDLVAGTAWMSRECHALYGTALAARGPDIASWRRRVVPEDAPAVA
FT                   AALTAAVERAEEYSAEFRIHHPALGERWIWEIGGAEYDASGAPVRVRGIALDVTERKHG
FT                   EQALLAADRRKDHFLAVLSHELRNPLAPMWNALGVLERPDASEDTSRRAQAVLQRQLAH
FT                   LSRLVDDLLDLTRISRGKIQLRPAPLGLTEVVRRAAEDHRPLFAEAGVALDVRLPDAPV
FT                   PVSGDATRLTQIVGNLLLNAVKFTPRGGHVLLELTPGEKDALLRVRDTGVGMDGEMLAR
FT                   LFEPFAQAEVSLERSRGGLGLGLALVRSLAELHGGHVWAHSDGPGAGAEFLVRLPIARV
FT                   EAAAPPVPTSAGAFARRRILVVDDNVDAAETLRDLLVLDGHEVAVAHDGEAAVERIGAL
FT                   RPEIVFCDIGLPKLDGYGVARACRDDPGTRGAYLVALTGYALPDDLRRATEAGFDEHLA
FT                   KPPPLAAIEAAVRRAASRTERSSS"
FT   gene            complement(601103..605242)
FT                   /locus_tag="Anae109_0530"
FT   CDS_pept        complement(601103..605242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0530"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: ade:Adeh_0486
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P8"
FT                   /protein_id="ABS24744.1"
FT                   /translation="MPLTSPRLALAAVVALLSARAAVAAAPWEGAPLSAEPAAMRAAAD
FT                   ALEPPAGVPLDVLLEEGVFRLDARGAVTHTLRVVYRPVVPEASRAAAQVERTWSPWREA
FT                   RPEIRARVVGPDGAVATLEPGALAEGPAADGDGPRSERRQLTGTIPGVRPGAVVEQVTT
FT                   VRELAPLLAGGTVQRFRIGSGSPVRHVRLRLEAPAALPVRWVVRGVELSPVETVANGIR
FT                   SIVFERRDAEPVPPAEPGSPPEVAPAPYVAFAAGQSWGEVAARLRAVFEEAIAGSDLRA
FT                   EARAALGAGKPGRDEAVRRIGAWLAARVRVSAAAVGEAPLAPARPADVLVRGAGDGKDL
FT                   AALWVALLRAARLDADVALAASEWHDPPREVPGLGLLDRALVRVGGKGAPIWIDPSAGL
FT                   APGALPLEAQGRLALVAARGTRDLVRTPASSPADNAAVTVRELHLSQLGRGRVVETRRL
FT                   TGALASSEREFRARVPPDHRDRLDERYALEVLRAGVFLGADVRGLDDPAAPLEVRVEAQ
FT                   ESALAETGDDEALVPVGAAPILEPLPAFLTGEREGEAPRRRRADVVLPLPYRWEMRFRV
FT                   IPPDGFRARPLPADAVERFGPATLSRRYAAGEDGSVTATYAIDTGGRRLAAAEADALAT
FT                   RARAIATGEPERLAFERTAAALLATGQVKEALAELHRLGAARPREAMHPLHLALALLQL
FT                   GDGAGAAVEARRAISLEPGRAWGYRVLGWILEHDAVGRRFGAGFDRDGAVEAYRRAAQL
FT                   DPRHAGGRAALAELLSRGETGTRGAPGADLGAALAEFEALHAELGPGPHDAGLLAVRFA
FT                   AGRHAEALELARALPPSPERNATLLAAAAVTGGAASAEREAAALGEERQEALLGAAGFL
FT                   ARERRYPLAAALAREAARGTREAEEPSAFADLLASLRPWKELVAQGDEAARFVKSLVVT
FT                   AVTSRDPARALERLVSARAAGPARAALLGVPPLPIGAARRPLRDAGVTPDLLLDVALSG
FT                   LELYREGEPASGLRIRARFAFAPGERATSLYLVRERGELRLLATDSAWPILAAEALRAA
FT                   DAGDVAGAARWLAWAREDVPGSPGDPGAPAGVLAVLAPPGARLDAPRARLAAAALGAFV
FT                   DGGEPGLAVLTAARADRDPAVRRAVLLSLARAHRSGERPEAVLAAADALLAEEPASREA
FT                   FAAKAWALRRLRRGAELDRAAEEILARLPEDPEVLSLVATSRLLLGDREGAERAMRRLV
FT                   AAGRATPGVYNDAAWLTLFRGGASSESLGWARRAVEGGQGDAHAALNTLAAVYADLGRP
FT                   AEARDVFLRSLEDGRALEGADWYVHGRIAEGWSLPEAARAAYARVQPELVEGAEDPSGA
FT                   HVLARRRLALLAGGGAAQERAQRGRPGGVAAPPRAQ"
FT   sig_peptide     complement(605168..605242)
FT                   /locus_tag="Anae109_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.948 at
FT                   residue 25"
FT   gene            complement(605315..606052)
FT                   /locus_tag="Anae109_0531"
FT   CDS_pept        complement(605315..606052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0531"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: ade:Adeh_0487
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24745"
FT                   /db_xref="GOA:A7H7P9"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P9"
FT                   /protein_id="ABS24745.1"
FT                   /translation="MRALAEILSAAPIDVLVSRARGDMLVHLLAALVAGGAIGLERSYH
FT                   GRPAGFRTHALVCLASSLLMLVTVYQGEWFAGASETVRVDPTRMAQGIMTGIGFLGAGV
FT                   IFKEGITVRGLTTAASIWITAAIGVLTGTGQYLPALYATVLTLGVLSLFRWLEARMPAL
FT                   KFAHHRIRFERGQAMSEEAVRVLLAEHGFQHYGLAYAVTDDGRSFEYRMMIRTRDERNF
FT                   GRLARDLEALPQVREFRLSPSGD"
FT   gene            complement(606146..606688)
FT                   /locus_tag="Anae109_0532"
FT   CDS_pept        complement(606146..606688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0532"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mxa:MXAN_2367 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24746"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q0"
FT                   /protein_id="ABS24746.1"
FT                   /translation="MSEIEIRPARPDDAPALGRMGATLARLHHRMDARRFFASEGMEEG
FT                   YASWLAKELASRRAVVLAAVTRSRGGEQLVGYAYGRLEGRDWNTLRDPSGVGVDLYVAP
FT                   RARRRGAGRLLLEALLRELVRRGAPQVVIHVAARNARALELFEGMGFRRTVLELAIDAA
FT                   ELPDSPRAEPRRPRRSR"
FT   gene            complement(607018..607581)
FT                   /locus_tag="Anae109_0533"
FT   CDS_pept        complement(607018..607581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0533"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   ade:Adeh_0488 protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24747"
FT                   /db_xref="GOA:A7H7Q1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q1"
FT                   /protein_id="ABS24747.1"
FT                   /translation="MTPILSSFLLVAVSEMGDKTQLLAFSLATRFRKPWPVMAGILVAT
FT                   IANHALASSVGAWISANVPARALAGFLAVTFIGFGVWTLRPDTLDEARGPERFGAFVTT
FT                   TILFFLAEMGDKTQLATVALAARYESIVRVTVGTTLGMLAADGLAVFLGEKVADQVSSR
FT                   KMRWAAASLFFVFGALSLVASLRA"
FT   gene            607770..608591
FT                   /locus_tag="Anae109_0534"
FT   CDS_pept        607770..608591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24748"
FT                   /db_xref="GOA:A7H7Q2"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q2"
FT                   /protein_id="ABS24748.1"
FT                   /translation="MTSTATAQRTTDRPTAAPPRSMLPHEHGAWGQLAMPLLTALAIGR
FT                   PGLAPTALAAGVVLAFIAHEPLLVLLGQRGRRVAEEEGPRARRWLLATGGLAAASGLLG
FT                   IALAPAAARLALALPAALAAVVALLVWRRLEKTTLGEIVVAAALASAGWAVALAGHAPA
FT                   EAALTAALAWIIAFAAATLGVRVILARARSKGARDPGKLHAVLSAALAGVAVALSAAGL
FT                   PAALAWATLPPALLSIVICLARFSPKRLKPLGWAIVASSAVTLVILVAGLR"
FT   gene            complement(608606..610810)
FT                   /locus_tag="Anae109_0535"
FT   CDS_pept        complement(608606..610810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0535"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: ade:Adeh_3599 fimbrial biogenesis outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24749"
FT                   /db_xref="GOA:A7H7Q3"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q3"
FT                   /protein_id="ABS24749.1"
FT                   /translation="MNGVPGDTALVLIAPRDAWISPADLARTGLSGIGGARRELDGRTL
FT                   VSLRSLAPDVRFELDERELALRLEAAPSLLGRGAVDLRAWSRPAGIETGDAPSAFLNYA
FT                   AHATTQEDASGFLEAGVSRDAALLTGSVSATQVAGVVRGLTTLTLDRPERLLRLTAGDA
FT                   LVAPDALSGAPMLAGIGIAREWSLDPYRVRAPLPGATAFAATPSTVDVYVNGALARSLP
FT                   VAPGTYDLSNLPVTTGANDVRLVVRDAFGRTQAIEAAHYQAQGLLAPGLDELGWWAGAL
FT                   RERYGTESFSYGDPVLIGRHRRGFSDRLTGGARLELGPRVQQAGASVTVGSGAGELEAA
FT                   AAASADEGAPGAAGFLAWRYSARRFALGADASVLSSRFAHATLAAGADRALWRAGAHVA
FT                   APLGRVASVELQYVGAEQRDAGASHRVEARTSLRVGGGAWLQLSASVSRDRAADPAAAV
FT                   FAQLVMAAPGGGTLDAGVRSGRAGTSASTGLQRTLPVGPGVGYRLRADSAAGGTVSALA
FT                   QAQPEFGRYELGYDHGRGSEVGSASASGGLVLVGRRLFATRPVEQGFALLRVPGVPGVR
FT                   AYLDRRPVGRTDARGDLLVPGLLPYYGNRLGIEDADVPASYRIGDTERLVASRPRGAAV
FT                   VRFDVERLRAVEGWLRLARREGAVVPAYGTFELDLPGGTRRSPVGADGAFWLEDVPAGE
FT                   HAARVYWNGEVCELPLAVPESGAGVLELGTVTCGPRAPML"
FT   gene            complement(611031..611786)
FT                   /locus_tag="Anae109_0536"
FT   CDS_pept        complement(611031..611786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0536"
FT                   /product="P pilus assembly protein chaperone PapD-like
FT                   protein"
FT                   /note="KEGG: ade:Adeh_3600 P pilus assembly protein
FT                   chaperone PapD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24750"
FT                   /db_xref="GOA:A7H7Q4"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q4"
FT                   /protein_id="ABS24750.1"
FT                   /translation="MRPLRRAARALRVLLAAAALAPAAASGGDLDVSPVNVELSGKVRT
FT                   ALLSLRNGDGAAARYQLRAYGWAQKPDGAMDLTPSRELVVFPPLLELAPGEARNVRIGT
FT                   DAAPAGTERTWRLFIEELPRAEAAEDAARVEVLTRVGVPVFLAPAAPVERGELALLGRD
FT                   GARIRLALRNTGTVRLRPRSVRLALVAADGTSVLERSLDVWYVLAGGERVYEVDVPAEA
FT                   CARAAAVVATAALERGVLEARAAGACRDP"
FT   sig_peptide     complement(611703..611786)
FT                   /locus_tag="Anae109_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.875 at
FT                   residue 28"
FT   gene            611884..612345
FT                   /locus_tag="Anae109_0537"
FT   CDS_pept        611884..612345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0537"
FT                   /product="Spore coat U domain protein"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   ade:Adeh_3601 spore coat U"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24751"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q5"
FT                   /protein_id="ABS24751.1"
FT                   /translation="MLCATLAAAAAGAALAPRAVDAAQPPSPGPSCSVSAGSVAFGAYD
FT                   PLSPTHLDSTGTIGLTCAVRQLVTISLGTGQSGTFARELRGPGGAALRYDLYTDATRTQ
FT                   VWGDGTAGTATWPFETERGRYVPVYARVLAGQDVPAGPYSDTIVVTIQF"
FT   sig_peptide     611884..611952
FT                   /locus_tag="Anae109_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            612518..612979
FT                   /locus_tag="Anae109_0538"
FT   CDS_pept        612518..612979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0538"
FT                   /product="Spore coat U domain protein"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   ade:Adeh_3602 spore coat U"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24752"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q6"
FT                   /protein_id="ABS24752.1"
FT                   /translation="MNRFLRLTLALGAALAAGAAHAETATAQFQVTATVVKKCKISATT
FT                   IAFGNYDPATILSAEGTLTLKCTKGTLYSVALDGGSTGSRQMTQAAEVLDYELYSDAGH
FT                   TAVWPSTAAAPSVAAAGADEALIIFAQVPADQYPAPGAYADTVTATINY"
FT   sig_peptide     612518..612586
FT                   /locus_tag="Anae109_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            613058..615508
FT                   /locus_tag="Anae109_0539"
FT   CDS_pept        613058..615508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0539"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_2956
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24753"
FT                   /db_xref="GOA:A7H7Q7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q7"
FT                   /protein_id="ABS24753.1"
FT                   /translation="MDRWWDLKRSAAPRRPGTTLSPVGALLYGKFPIYLTPVRGPPRER
FT                   ARARPHPDIPNAMESSHPSPAPRPEGERAGPEARGGERNAAAPRDERPAPSRPEGERAV
FT                   SIGEAQPVDVLAVDDDPRNLEATRALLSGSGARIVEARSAEEALRILLTREVALILLDV
FT                   GLPGMSGLEMAKLVRARERTRHTPIIILTASSDPRLLERGYALGAVDFLTTPVPEQALR
FT                   AKVAFFIEAHRKNEALRHNAELLRAAQERELARNVAEARRRWEEEALRREMERDRRLVD
FT                   TLHRANERLKLLSSVRSDLLTAQVVRERLPAICDRVAAHLGLERWSLHLADPDGRLSLA
FT                   ATGGADGAQVARARALDSVEAILGGTAARVAARGEPVPPIGEALGVVCCAARPLHTGDR
FT                   VLAAFAFGSAERDACDPDDPATLELVGYAMAMALERDRLIAELQGRNAELREADRRKDQ
FT                   FLAMLAHELRNPLAPVTNAVRLLQDYGADAHVRERALAAAERQVRHMARLVDDLLEVSR
FT                   VRSGKVCLRKETVELARVVREAVQSVDELVASRGHALALELPDAPLLVEGDAVRLTQVV
FT                   ENLLTNAVKYTDPGGHLRVELRREGREAVLAVRDDGIGIAPELQDTIFELFVQAEQGVD
FT                   RSRGGLGIGLSLVKTLVDMHGGAVGVTSAGPGQGSTFTVRLPALAEDTAVPAAPEPARP
FT                   ARGRRPRDILVIEDNPDIRETLAELLRRRGHAVREAEGGRAALELARDLAPEVALVDIG
FT                   LPELDGFEVAQRLREVAPEVRLVALTGYGRAEDRRRGAAAGFLAHLVKPVDIDELSAVI
FT                   DSLD"
FT   gene            615526..620976
FT                   /locus_tag="Anae109_0540"
FT   CDS_pept        615526..620976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0540"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mxa:MXAN_0712 sensor
FT                   histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24754"
FT                   /db_xref="GOA:A7H7Q8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q8"
FT                   /protein_id="ABS24754.1"
FT                   /translation="MPAKPTTALDAGQLLAVLDAVRKGDFAARMPVDRTGVAGKVCDAL
FT                   NEIVELNAGLAAELARLNRVVGKEGKTSHRGRLAGAKGSWAECVDSVNGLIADLVQPSV
FT                   EVTRVIGAVARGDLGQAMALEIDGRPLQGEFLRTAGIVNTMVAQLSSFASEVTRVAREV
FT                   GTEGKLGGQAVVKGVSGTWKDLTDNVNSMASNLTAQVRAIAEVTTAVANGDLSRKITVD
FT                   VRGEILELKNTINVMVDQLSSFASEVTRVAREVGTEGKLGGQAVVKGVSGTWKDLTDNV
FT                   NSMASNLTAQVRSIAEVTTAVANGDLSKKITVDVKGEILELKNTINVMVDQLSSFASEV
FT                   TRVAREVGTEGKLGGQAVVKGVSGTWKDLTDNVNSMASNLTAQVRAIAEVTTAVATGDL
FT                   SKKITVDVKGEILELKNTINTMVDQLSSFASEVTRVAREVGTEGKLGGQAVVKGVAGTW
FT                   KDLTDNVNSMASNLTVQLRDVSKVATAIANGDLGQKITVAVQGEILQIKDVINKMVDQL
FT                   SSFASEVTRVAREVGTEGKLGGQADVRGVAGTWKDLTDSVNSMASGLTAQVRDIAKVAT
FT                   AVANGDLSQKIAVDVRGEILELKNTINGMVDNLRTFSTEVTRVAREVGTEGKLGGQAVV
FT                   KGVAGTWKDLTDNVNSMASNLTTQVRAIAEVTTAVANGDLSRKIAVDVRGEILELKNTI
FT                   NVMVDQLSSFASEVTRVAREVGTEGKLGGQADVKGVSGTWKDLTDNVNSMASNLTSQVR
FT                   NIAAVTTAVATGDLTKKITVDVRGEMLELKNTINVMVDQLSSFASEVTRVAREVGTEGK
FT                   LGGQADVKGVSGTWKDLTDNVNWMASNLTAQVRGIATVVTAVAAGDLGRKLALEAKGEI
FT                   AALADTINGMIDTLATFADQVTNVAREVGTEGKLGGQARVPGAAGVWRDLTDNVNSLAA
FT                   NLTTQVRAIAEVATAVTKGDLTRSIAVGAQGEVAALKDNINQMISNLRATTQKNTEQDW
FT                   LKTNLARFTRMLQGQRDLEAVGKLILKELAPLVEAQMGVFYLLEEQGGERVLQLLSSFA
FT                   FRERKGLSNRFKPGEGLVGQCVLEKDRILVTDLPEDYTPISSGLGEGKPRSVVVLPILF
FT                   EGEVKAVIELASFHRFGEIHLAFLDQLTESIGIVLNTIAASMRTEELLKQSQSLAEELR
FT                   AQQAELTDSNRRLEQQANSLQASEDRLRNQQEELQRTNEELEERSRLLEVQNVEVERKN
FT                   REIEQAKAALEERAQQLAVASKYKSEFLANMSHELRTPLNSMLVLSKLLSDNADGNLSP
FT                   KQVDFAQTIHSAGADLLALINDILDLSKIESGAMQVDVSECLLAGLQDYIERAFRQLAS
FT                   QKGLRFAVEVDRRTPGAIWTDERRLQQIVRNLLSNAFKFTEHGEVVVRIAPARGGWSRD
FT                   AEGLNAAGSVLALSVRDTGIGIAPEKQRIIFEAFQQADGTTSRKYGGTGLGLSISRELA
FT                   KLLGGELAVESSPGKGSTFTLYLPEARLAVPAAPPNVAVAVPRAASRDGLPPAVPAGAE
FT                   ATSGLQPPASPGLAASVEPLAAKGILVVVPDARLAATVEAVARDRGFAVWQADASDAVR
FT                   TARERRPDGIVIEVGAAAGPEWSVLERLKEDHDTREIPLHVLAAPAPAAEEMAAAGDGA
FT                   SAPPPARAAGEHAADEVALFLHRVDAELPERKRALVRAATADTSLVSKKILIVDDDVRN
FT                   VFAITALLEQHGASVVYAENGRRGLEVLKANPGVDLVLMDVMMPELDGYETMRAIRHLP
FT                   EFERLPIIALTAKAMKGDREKCVESGASDYVTKPVKAEQILSLLRVWLYRRPEPRGEAR
FT                   V"
FT   gene            620978..621814
FT                   /locus_tag="Anae109_0541"
FT   CDS_pept        620978..621814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0541"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   ava:Ava_4781 MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24755"
FT                   /db_xref="GOA:A7H7Q9"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q9"
FT                   /protein_id="ABS24755.1"
FT                   /translation="MRTGADEDAAERGELEALLEAIHRRYGHDFRGYARSSVARRLREV
FT                   LRAERAGSFSELQALVLRDPAAMERMLSTLCVHVTSMFRDPTFYLALRQKVLPALRRAP
FT                   LIRVWHAGCASGEEAYSAAILLDEEGLLERSRIYATDLAPAALETARAGVYPADLVQEY
FT                   TANYLRAGGQRSLSDHYVARYDSVILKERLRRRIVFSRHDLVTGDVFNDFHLVLCRNVL
FT                   IYFEPPLQGRVHRLLLASLRGGGFLGLGRSEALPPDLRDRYEELDAREHLYRRREP"
FT   gene            complement(621818..622483)
FT                   /locus_tag="Anae109_0542"
FT   CDS_pept        complement(621818..622483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24756"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R0"
FT                   /protein_id="ABS24756.1"
FT                   /translation="MRFPRALAVLGAVIVFAGCPDTTRTPFDPADGFQPIEPCTAAFPP
FT                   ATAGDPHPEEIQIVSDWREGRLAYAHGAGYLHATLPEVLEALRDPRVSRIHQTDSWDVT
FT                   PNVEPEYPISFSIRYAAGPAIYKGRWTILYRGGALLGTVEAPQQLGFRYQKVEGIEDIR
FT                   VQSGSLVAYDAGDGVTALELVCHLDTSSRADQGPEDVHGTVNDWFVGLRAKVHGAPVP"
FT   sig_peptide     complement(622430..622483)
FT                   /locus_tag="Anae109_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.702) with cleavage site probability 0.565 at
FT                   residue 18"
FT   gene            622635..623309
FT                   /locus_tag="Anae109_0543"
FT   CDS_pept        622635..623309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24757"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R1"
FT                   /protein_id="ABS24757.1"
FT                   /translation="MRKLLSLTIALAVLAGCGDDDDGGGGPALTGKLHGETFDPAEVVF
FT                   AGPRQSASCEFPGFPITYGIGDALIAFSPEAGGGCALADPCAGRRSFTFVAGLLAHAEV
FT                   PAPAAAPALDGGSYAVYGSLDEAVPALATSGGGSIRTALLAAQQTDAQCAPVAAPPSAS
FT                   GTIRLDAVSATELRGQIDVSFADGQGGFLRGQFTARPCPAVTFDACFSDAGLTCSGTPS
FT                   CQ"
FT   sig_peptide     622635..622691
FT                   /locus_tag="Anae109_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.873 at
FT                   residue 19"
FT   gene            623336..624208
FT                   /locus_tag="Anae109_0544"
FT   CDS_pept        623336..624208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24758"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R2"
FT                   /protein_id="ABS24758.1"
FT                   /translation="MRLLALLLALAAAPAGAAEGPLLGPQFRWSEMPVLQRVVRDVVAI
FT                   PANAPRWSAGDWAQLALWSGAVGALMVPLDDPPDARLDRWMREELDPRLPTVWNDWMQP
FT                   LLWGGLAVGSLGSWWWAASTGNDHVAQGCSLMGEALAVSQVYHLTLKLALGRDGPSDGD
FT                   GTADIKGPANAIRVYPAGTPSGHAATLFSLTTAGLAYFRPPAWFQALGYGVTGGLVAFH
FT                   VIDHRHFLSDSVWGAAMGFYVAQWVVKNRASPLPGDAGRAERAPGGGHVVVVPLAFPGG
FT                   AGLALVGRG"
FT   sig_peptide     623336..623389
FT                   /locus_tag="Anae109_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 18"
FT   gene            624243..625250
FT                   /locus_tag="Anae109_0545"
FT   CDS_pept        624243..625250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0545"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   ade:Adeh_0200 cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24759"
FT                   /db_xref="GOA:A7H7R3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R3"
FT                   /protein_id="ABS24759.1"
FT                   /translation="MPTRAVAERRARWFVCRMRAFTRFAWAVLGYNLLVVAWGAFVRAT
FT                   GSGAGCGKHWPMCNGAVVPRAPAVETVIEFTHRATSGIALLLVVALVAWAVRAFPGGHP
FT                   ARKAAWASLGLMILEALVGAGLVLFGWVAKDTSFARGWVMGVHLTNTFLLLGALTLTAD
FT                   WSARPGGMRFGERGVVAGALWLAFVTVILAGVTGAIAALGDTLFPTTSFAEGLRQELST
FT                   EAHVLLRLRILHPFAAVAAAAVLLLVARMALRHRPDPRVRRAALSLLLLVAIELLAGAV
FT                   NVLLLAPVWLQLVHLLLADLVFVSLVLLAAASLAPGEVEVPAGTPGPLPASLQS"
FT   gene            625386..626003
FT                   /locus_tag="Anae109_0546"
FT   CDS_pept        625386..626003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0546"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; 17 kDa surface
FT                   antigen; KEGG: ade:Adeh_4193 outer membrane protein,
FT                   OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24760"
FT                   /db_xref="GOA:A7H7R4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R4"
FT                   /protein_id="ABS24760.1"
FT                   /translation="MHLRSNRVIALATLVTLIGCGTAGKRTAIGGGAGAALGAGIGALA
FT                   GGKKGALIGAGVGALAGGSVGLYLDKQHKELEKVAETKRTENGILVNMKNDILFDTNSA
FT                   DLKGEAVTQLTQVGDILAKYADDRIRIEGHTDSSGSDSLNEALSRKRADSVRTVLVSRG
FT                   VREEQITVVGNGETKPIADNATKEGRAKNRRVELHIDVPNPS"
FT   sig_peptide     625386..625463
FT                   /locus_tag="Anae109_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.493 at
FT                   residue 26"
FT   gene            626308..627264
FT                   /locus_tag="Anae109_0547"
FT   CDS_pept        626308..627264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24761"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R5"
FT                   /protein_id="ABS24761.1"
FT                   /translation="MRDHIAWPELPLARWRGTCETLHMWTQVIGKVRLASTPLVNHWWN
FT                   VPLYPTARGLTTSLMFHGPTGFEIALDLLDHQLEVTTSDGTFGAMPLVPQTVAQFHARL
FT                   MGMLRDLAIDVPIRTTPVEIPNPIPFEKDDVHASYDAEWAQRFWRVLLASSRVLGEFRA
FT                   RFIGKASPVHFFWGSFDLAVTLFSGRRAPERPGADGITREAYSHEVVSFGFWPGGGVMD
FT                   DAAFYAYAAPEPAAFADAPVRPAEAHYHRALREFILPYAAVRADAEPERRLMEFLETTY
FT                   EAATELGGWDRAALERGEPAAVEAAPRGERPEAPPLH"
FT   gene            627381..627788
FT                   /locus_tag="Anae109_0548"
FT   CDS_pept        627381..627788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0548"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   KEGG: ade:Adeh_0492 hemerythrin-like, metal-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24762"
FT                   /db_xref="GOA:A7H7R6"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R6"
FT                   /protein_id="ABS24762.1"
FT                   /translation="MVETHAWNEKLDVGHEAMDHDHHLQIGLVSAFVDAVERGRPWMAR
FT                   RLADQLLAYSVAHFGSEELLMEGSAFPERDAHAGEHGAFLEQMRELQRSFSSGDEALAT
FT                   TSALELRGALAAHMNGADRRLAAHVSPLTRG"
FT   gene            627908..628924
FT                   /locus_tag="Anae109_0549"
FT   CDS_pept        627908..628924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24763"
FT                   /db_xref="GOA:A7H7R7"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R7"
FT                   /protein_id="ABS24763.1"
FT                   /translation="MCPVLTGWGTLTRRNIDPYHASSRLEEASLLSNRSLLAVALAAAV
FT                   LAGCEGARTDPNLAAEDQALAASRQIRSCGTENPSARDLERVSREVDAKLRTSNAEGAA
FT                   ARAAGSVAVPVWFHVVNRGSGLANGDVPQALIDAQLRVLNDAFAGRTGGTPTAFTFTLA
FT                   GVTRTTNATWFGSCDVSSVEAQMKTALRVGGAGTLNVYSCDPGGGLLGWATFPWSYASS
FT                   PRMDGVVLLYSSLPGGGAAPYDEGDTGTHEVGHWLGLYHTFQGGCPSGDSVTDTNAERS
FT                   AAYGCPTGRDTCNGKRYPGPDPITNFMDYTDDACMFHFTSGQASRADAQAATYRPAP"
FT   gene            629659..630690
FT                   /locus_tag="Anae109_0550"
FT   CDS_pept        629659..630690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0550"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ade:Adeh_2076
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24764"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R8"
FT                   /protein_id="ABS24764.1"
FT                   /translation="MTRREFLELAAAATFVPLAACGGHTQTAHGGVEEGTPDAPAGAGP
FT                   LPERMLGRTGVAVSIVGLGGYHMGTQETEEESVRIVRTAIDGGITFLDNCWDYNDGESE
FT                   RRMGKALQDGYREKVFLMSKIDGRDAVTAARQIDESLQRLRTDRVELMQIHEVIRPTDP
FT                   ERCFAAGGAVEALVAARQAGKIRFIGFTGHKSPRWHLEMLRVAEEHGFAFDTVQMPLNV
FT                   LDAHHDSFERNVLPVLVQKNIGIIGMKPMADARIVKRGIASPEECLGYALSLPASVVVT
FT                   GCDSVERVEQALRVARAFQTFPEERVDELLARTAPAGQGGANELYKTTEEYDGTTQNPH
FT                   WLG"
FT   sig_peptide     629659..629751
FT                   /locus_tag="Anae109_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.642 at
FT                   residue 31"
FT   gene            complement(630702..631559)
FT                   /locus_tag="Anae109_0551"
FT   CDS_pept        complement(630702..631559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0551"
FT                   /product="S1/P1 nuclease"
FT                   /note="PFAM: S1/P1 nuclease; KEGG: xcb:XC_0908
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24765"
FT                   /db_xref="GOA:A7H7R9"
FT                   /db_xref="InterPro:IPR003154"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R9"
FT                   /protein_id="ABS24765.1"
FT                   /translation="MPRTNAALPLLCLAAAAVATAPATAAAWSEPGHRIVAAIAEERLG
FT                   PSARRLVREVLGATPMSNADVAGWADAQRDPATRAWHYVNIPLAAAFDPARDCPREACV
FT                   VAALERAIAELRDGEGAARRADAFRWLVHLVADVHQPLHAGDGRDRGGNDLPTRRERAR
FT                   GQPRPFHRVWDQDVLGPILRRRGTVAAARALARDIGPAEAARWAARPSPAEWADESHAL
FT                   ARALYAELGPLPRDGRIVLLPREYADRQRARTELQLQKAGVRLAALLERIAAARAVRLG
FT                   AAGR"
FT   sig_peptide     complement(631482..631559)
FT                   /locus_tag="Anae109_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.667 at
FT                   residue 26"
FT   gene            complement(631662..632660)
FT                   /locus_tag="Anae109_0552"
FT   CDS_pept        complement(631662..632660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0552"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   ade:Adeh_2249 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24766"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S0"
FT                   /protein_id="ABS24766.1"
FT                   /translation="MEPRVWRFVKTLLAAVAAAALLAPASPRAAYPERPITMIVPFAAG
FT                   GPTDVVARIVADDMSRTLGQQIVIENVAGAGGTTGITRASQAPPDGYTIMMGHMGTHGA
FT                   APAVYPNLKYDPVKDFAPIGLASGTPILIVARKDFPAKDLKEFMAYAKQNGSKLNEAHA
FT                   GVGSVSFSTCTVFNSLVGVKPTRVVYRGTGPALNDLVAGQVDYMCDQIPSLVPQIQAGT
FT                   IKAYAVALPERSPALPNVPTTKEAGLPEFQVSAWNAIFAPKGTPPEVTKKLNGALVKAL
FT                   KDPGTRKRLLDLGGDLSNEDAQTPEGLRKLVESEVARWSKALKGAGSAEAK"
FT   sig_peptide     complement(632568..632660)
FT                   /locus_tag="Anae109_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.538 at
FT                   residue 31"
FT   gene            complement(632695..634197)
FT                   /locus_tag="Anae109_0553"
FT   CDS_pept        complement(632695..634197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0553"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: ade:Adeh_2248 protein of unknown
FT                   function DUF112, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24767"
FT                   /db_xref="GOA:A7H7S1"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S1"
FT                   /protein_id="ABS24767.1"
FT                   /translation="MSDLFQHLALGFSVALSAQNLLLALTGCFVGTLVGVLPGVGPIAT
FT                   ITMLLPVTFGLDPVGAIIMLAGIYYGAQYGGSTTAILVNIPGEVTAVVTTLDGHEMAKQ
FT                   GRAGAALGVAALGSFFAGCVATLVVAAAAVPLTRVALLFGSAEYFSLMAAGLVFAIVLA
FT                   RGSLLKAIGMILVGLLLSTVGTDLETGVERMTFGYAPLADGLDFAVLAMGIFGLAEVLR
FT                   NLEVTEHRDVVKRPIGRVLPSMAELRQSARPIVRGSLLGSALGVLPGNGAVLGPFASYA
FT                   LEKKLAKDPRRFGRGAIEGVAGPESANNAGAQTSFIPLLALGIPPNAVMALMVGAMTIH
FT                   GIVPGPLVMTRNPSLFWGVVASMWIGNLMLLVINLPLVGVWVRLVKVPYRLMYPAILVF
FT                   SCIGIYSVNNSPADVLFTAGLAVIGWALTKLGFETAPLLLGYVLGRLMEENLRRALAIA
FT                   RGDPAVFVQRPVSAALLAVAALVLILAVVPSLRKKRDEVFVE"
FT   gene            complement(634205..634714)
FT                   /locus_tag="Anae109_0554"
FT   CDS_pept        complement(634205..634714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0554"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   ade:Adeh_2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24768"
FT                   /db_xref="GOA:A7H7S2"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S2"
FT                   /protein_id="ABS24768.1"
FT                   /translation="MPERAADVSRGAVTPGGPRVQAPQNLAAGASLVALALFAWWAGAE
FT                   LETGTLRSMGPGMLPRAVTVLVGLTGLALVVLSLVKEGDPLGRWPLRGPFFVALAVVAF
FT                   ALSIRTVGLALAGPLVALVSGAASPETRWKELVVFAIVITAFCIGLFRYALHLPIPILV
FT                   LPGFVI"
FT   gene            635063..635698
FT                   /locus_tag="Anae109_0555"
FT   CDS_pept        635063..635698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24769"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S3"
FT                   /protein_id="ABS24769.1"
FT                   /translation="MLLAAAAGCMPYHRARPGAETWRQGVKTVGVLPAIRILEISPGNV
FT                   EEEHEEWTEQGKRNVVAALSDGLRARGLHPKVMTWKTDDELDDVRLLYAEVAEAIWLYA
FT                   YPPYTFPHKVERFEYGVGPIGKILDRAGADVLLVAAGQDRVGSDGRKLGMLAGMRAMAL
FT                   LTLGLVDRAGNVVWFDVWGGAGIDLRQDADVRESVEKLLSELPGTAAP"
FT   gene            635695..636849
FT                   /locus_tag="Anae109_0556"
FT   CDS_pept        635695..636849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0556"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; Tetratricopeptide TPR_2
FT                   repeat protein; KEGG: dar:Daro_0246 peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24770"
FT                   /db_xref="GOA:A7H7S4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S4"
FT                   /protein_id="ABS24770.1"
FT                   /translation="MTPRAWLIAAAALLSAACAVAPPRAARLPPVSAPSFAMERDERRL
FT                   WKEAAEMDARARKSGAVLGEAPLERYLLGVARRLTPGAALGKLDVRVRVIESPSLSAFV
FT                   SPDGGVFVTMGLLARLENEARLAVVLGHELVHAVNRHAIVEYRTFKHGAALASALPFGL
FT                   GELGTKAAVTGYSRDLEREADEEGLALVAAGGWDVAEATRPFEHLAAWVKEEEIEEPFL
FT                   FSTHPRLEERMESYRTLLATRYAGRSGGDRGRERYQGAIRELVLANARLDLAAGRFGPA
FT                   ERGARAYLALRPKAAEGHALLGDVARQRGGDGAEAGALAHYRKAVELDARCPEAQRGLG
FT                   LALARRNDREGARAALRAYLKLSPDAVDRAWIEGDLAALEGRGP"
FT   sig_peptide     635695..635772
FT                   /locus_tag="Anae109_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.389 at
FT                   residue 26"
FT   gene            636846..637415
FT                   /locus_tag="Anae109_0557"
FT   CDS_pept        636846..637415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24771"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S5"
FT                   /protein_id="ABS24771.1"
FT                   /translation="MRIRLATLACVAALASGCLHDEAPWREVGGKYDSGNWFGPRISMV
FT                   LPDDWMKLNRVEDGLVATRDGFNLQSIKIRRVDPGKPLPHTKKTVAEGMRPHELAEVLL
FT                   DDLRSDGSANGLKVLETRPATIAGAPGFRTTVAFKDAFGLKVKVVLCGVMIEDHAWQIA
FT                   YVAPARHYFEQDLGTFDGALASFRVR"
FT   sig_peptide     636846..636905
FT                   /locus_tag="Anae109_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.812) with cleavage site probability 0.376 at
FT                   residue 20"
FT   gene            637448..638602
FT                   /locus_tag="Anae109_0558"
FT   CDS_pept        637448..638602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0558"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_4017 major facilitator superfamily MFS_1
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24772"
FT                   /db_xref="GOA:A7H7S6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S6"
FT                   /protein_id="ABS24772.1"
FT                   /translation="MDRERLALYAGTVAAYSDMYVTQPILPLLSGEFGVGPARAGLTVS
FT                   AVVLAIAVASSLYGPLSDALGRRRVMAGATALLSLATLACAAAPSFGALVALRAAQGAL
FT                   VPGMTAVSIAYAGDRFPPGELGRVVGGIIAASVVGGLVGRVASGAIAAHLGWRAAFVAF
FT                   AGLTLAAAVVLARGLAPGTRAARHGLVAAYAGMLRHLRDPRLVGAYLVGLSLFFGWIGI
FT                   FTYLPYRLSAPPYALSTGAVSSVYLVYAAGVVASPLAGRLSGRVPPRRLIAVGLAGEGL
FT                   GMALALAGPLPLVVLGLVVLVLGTFTAQAVVPAFVNATARTAKGGASALYLAFYYLGGT
FT                   LGSALPGLAWQAGGWPAVVAACGASVCVGIVANAALCGRAARTG"
FT   gene            complement(638617..639096)
FT                   /locus_tag="Anae109_0559"
FT   CDS_pept        complement(638617..639096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0559"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: mxa:MXAN_0012
FT                   DoxD-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24773"
FT                   /db_xref="GOA:A7H7S7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S7"
FT                   /protein_id="ABS24773.1"
FT                   /translation="MTATIAMTKKAAFVPMRAALGATMLYHGAQKLRGPEEAAGMFESL
FT                   GFKPGERWARVTGLAEVFGGATAILGIGTRLGALAVLATQAMAIAKVHGPKGFSNLSGG
FT                   YEFNLALIGMAATLLAAGPGVISAHELLERRVERPAWALARPRRRRALRFVKLLK"
FT   gene            complement(639241..640110)
FT                   /locus_tag="Anae109_0560"
FT   CDS_pept        complement(639241..640110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0560"
FT                   /product="methyltransferase"
FT                   /note="KEGG: ade:Adeh_2162 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24774"
FT                   /db_xref="GOA:A7H7S8"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S8"
FT                   /protein_id="ABS24774.1"
FT                   /translation="MLSKVLAALRCPLCALALEEEASGTGHALRCPSGHAFDVARQGYA
FT                   SLDTGRRSHPGDSAEMIAAREAFLGAGHYAFVSEAIVAAVRERWGGDGQRLVVDAGAGT
FT                   GQHLAAVLDALPDAVGLALDVSKPALRRAARAHPRAAAAHCDTWGRLPLADGAARLLLN
FT                   VFAPRNGPEFARVLGQDGALVVVTPAPEHLHELVAALGLLSVDPEKAERVAASLGDRFA
FT                   LAREAHVARELALTHAEARTLVAMGPSAWHADPAAVADRLGALREPVRVRAAVTVRTYR
FT                   ALAPGAAR"
FT   sig_peptide     complement(640051..640110)
FT                   /locus_tag="Anae109_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.847) with cleavage site probability 0.467 at
FT                   residue 20"
FT   gene            640291..641505
FT                   /locus_tag="Anae109_0561"
FT   CDS_pept        640291..641505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0561"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sus:Acid_4926 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24775"
FT                   /db_xref="GOA:A7H7S9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S9"
FT                   /protein_id="ABS24775.1"
FT                   /translation="MRAVVWKGPGKVAVEKVEDPRIESATDVLVRITTAGICGSDLHMY
FT                   EGRTVAEPGVVLGHENMGVIEEVGSAVQQLQKGDRVVLPFNVACGTCFNCSRGYTSACL
FT                   VTNEEGAGAAYGYVGMGPYRGGQAELLRVPWGEANCIKLPGEPGDELEDDFLLLSDIFP
FT                   TGYHAAEMAKVQPGSTVAIFGAGPVGLLAAYSAMLRGAAEVYVVDAIPERLEKAQQIGA
FT                   IAIDFRQGSPAEQIRDLRLGNPLVRGSMRRGEEKMAGVMCGIDAVGYQAKDFEDPSKEQ
FT                   PTSLTEQLVEIINPTGALGIIGVFLPQDPGGKDRAAKRGAYTLPWGKLWEKGIQLGMGQ
FT                   TPVKNYSLVLRDLVVAGRAKPSFIVSRRIPLSEAPDAYRRFDRREPGYTKVLIKPGEEA
FT                   TAATH"
FT   gene            complement(641569..642057)
FT                   /locus_tag="Anae109_0562"
FT   CDS_pept        complement(641569..642057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0562"
FT                   /product="cupin 2, conserved barrel"
FT                   /note="KEGG: nha:Nham_0721 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24776"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T0"
FT                   /protein_id="ABS24776.1"
FT                   /translation="MAVSMQEGQQVGAAARGTESGRSSQGEDPALIAKDEMRWGPAPDV
FT                   FPSGCQFCVLHGDPGADRLFSVRLKVGDRYVFAPHSHPFDEHVTVISGRLHLGNGRTLD
FT                   RSAARALEPGDYAFLPKEQFHWAWASTDDTVFQVEAVGPFAITYANPEDDPRNQGTAH"
FT   gene            complement(642189..642935)
FT                   /locus_tag="Anae109_0563"
FT   CDS_pept        complement(642189..642935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0563"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mxa:MXAN_5359 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24777"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T1"
FT                   /protein_id="ABS24777.1"
FT                   /translation="MSALRLVPLGVGDAFSAERYSTCLALGAGDRWLLVDCPHPIRKMM
FT                   REASLRSGLELDVDRVEAVALTHLHADHASGLEGLAYFSHFALGRRARVAAHPEVARRL
FT                   WDGHLAAGMEQVALGSGAPVSARLEDFFELVPLDERGAVRVGPFEIECRFTRHPLPTTA
FT                   FRIAAGGRRVACSADTAFDPALVAWLAEADLVVHEAGFGIHTPLERLAALPPELRARLR
FT                   LAHFPDQLDLSACGIEPLEQGRAYDV"
FT   gene            642992..644266
FT                   /locus_tag="Anae109_0564"
FT   CDS_pept        642992..644266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0564"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   ade:Adeh_2207 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24778"
FT                   /db_xref="GOA:A7H7T2"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR030809"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T2"
FT                   /protein_id="ABS24778.1"
FT                   /translation="MGETLTGWVADARRRTLELASALTEEQLLGPRLAIVNPPLWELGH
FT                   VAWFQERWVLRHGAGRPPLRADGDALYDSFAVAHDTRWSLPLPGLAETIDYLRGVEAGV
FT                   LSLAGRGEADPYLVRLTVFHEDMHFEAMAFTHQTLGYAAPVVSGAAPAEAGGGDLPGDV
FT                   EVPGGTLRLGAERGEGFVFDNEKWAHAVELAPFRISRAPVTQARFAEFVEDGGYRRREW
FT                   WTEEGWRWREATGAGAPAYWERRGGSWFRRDFDRWVPLEPHRPVVNVSWFEAQAFCRWA
FT                   GRRLPTEAEWEAAAAGEPGADGRLAPRKRRFPWGDAPPEPSRAHLGVPALGALDVGALS
FT                   AGDSAFGCRQLLGNVWEWTASDFLPYPGFSPDAYREYSEPWFGTHKVLRGGSFATQPRL
FT                   AWNTFRNFYTPDRRDQWAGFRTCAV"
FT   gene            644275..645246
FT                   /locus_tag="Anae109_0565"
FT   CDS_pept        644275..645246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0565"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ade:Adeh_2208 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24779"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR027627"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T3"
FT                   /protein_id="ABS24779.1"
FT                   /translation="MVTPARRGSHKGNRVTAIRWAGHLRALGHRVALAEGWDGQRCDLL
FT                   VALHATKSHASVVRYRERRPDAPLVVGLAGTDLYQDLPASPEARRSLELATRLTVLQPL
FT                   GIEALPPAVRHKVRTIFQSAHPVRPQPAEDGTLRVCLLAHIREVKDAFLGAEAVRRLPP
FT                   RSRVQLVHLGAALDAGADARARREMEGNPRYRWLGERRRSEALATLAGSALLVVTSRLE
FT                   GGSNAVSEALASGVPVLSTRIAGSIGVLGPDYPGFFPVGDAGALAELLRRAEEDAAFLA
FT                   ALRAGVERVRPLVAPEREREAWRALLAELVPGKPGDAQPNRR"
FT   gene            complement(645253..646500)
FT                   /locus_tag="Anae109_0566"
FT   CDS_pept        complement(645253..646500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0566"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gsu:GSU2744 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24780"
FT                   /db_xref="GOA:A7H7T4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T4"
FT                   /protein_id="ABS24780.1"
FT                   /translation="MSAGEQGEAPVAARAAPEPPAGSKASAALPRAVVGLGLVSLLTDA
FT                   SSEAIFPLLPAFLATLGASNTFIGLVEGAAELVANSLKYATGLLADRRARLKPLVLAGY
FT                   VLSTAARPLVAFAAVPWHVLAVRLVDRVGKGVRTSPRDALIAAAAEPSIRARAYGFHRA
FT                   MDHAGAAVGTLLGAGILWSLGARGAQAATAEQLRTVFLWAAVPGVLAVIALALTPEPRR
FT                   AAPRPRARRDGRLPPALRRALVPLGLFAFANATDAFILVKLARLGGAPILAPLLWLALH
FT                   VVKAATATAGGRLADRYGKRDALALGWTVYAVAWSAIGFAETVPALFVLGAVYGISHGL
FT                   VEGAERALVAELAAGNATGKAFGVYNMLVGLAALAASTTFGFVWDALGSAVAFAGSGAL
FT                   ALLAALALLKLVPRPA"
FT   gene            complement(646497..647948)
FT                   /locus_tag="Anae109_0567"
FT   CDS_pept        complement(646497..647948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0567"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ade:Adeh_0516 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24781"
FT                   /db_xref="GOA:A7H7T5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T5"
FT                   /protein_id="ABS24781.1"
FT                   /translation="MRSAPHARAALGAAAVLLAGCTLAPRYQRPPAPVAEAWEAGSTPA
FT                   AAGPAAADLGWRDVFGDERLRALVALALENNRDLRVAALNVELARAQHRIQRAELLPAV
FT                   GASASVTRQHLGEDLSPTGEAQTTTGYTVGVGVAAFELDLFGRVRSLSAAALERYLATE
FT                   EARRAAHLSLVAEVATQYLSARALDDQVALARQTLETVESALALTRRTFEAGKTSELDL
FT                   RIAEAQVQTSRFNLSRALLLRAQAQNALVLLVGEALPAELPPPQPLETQALLAELPPGV
FT                   PSEVLRRRPDILAAEHALRSANASIGAARAAFFPSISLTAFGGTSSPELSGLFGAGATT
FT                   WSFTPRVNLPLFTGGALRASLDVAHLRKSIEVAQYERAIQGAFREVADALVARAALDEQ
FT                   LEAQRARTEAEQRRYDLSELRYRKGVDSYLGVLDAQRELFAARQLLIQSRLARLVNLVD
FT                   LYRALGGGWRERSAPSGGETATSGT"
FT   gene            complement(647941..651105)
FT                   /locus_tag="Anae109_0568"
FT   CDS_pept        complement(647941..651105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0568"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   ade:Adeh_0517 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24782"
FT                   /db_xref="GOA:A7H7T6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T6"
FT                   /protein_id="ABS24782.1"
FT                   /translation="MAQFFIDRPIFAWVVAIIVMLAGALSILTLPVSQYPAIAPPTVSV
FT                   IASYPGASAKTLEDTVTQVIEQRMTGLDGLRYMSSSSDSSGNAQLTLTFEAGTNPDIAQ
FT                   VQVQNKLQLAMPQLPQDVQRQGVRVVKSAASFLLIIGLVSEDGSMTRNDISDYAYASIQ
FT                   DQISRVNGVGEVQTFGSQYAMRIWLDPDRLTSFRLTPLDVSSAVQSQNAQVSGGQLGGL
FT                   PAVEGQRLTATITAQTRLQTAEEFRNILLRVNPDGSQVRLGDVARVELAGESSEIETFF
FT                   NGRPSSGIGVRLAAGANALDTAGAVRARMDELSKFFPPGLKAVYPVDTSPFVRLSIEEV
FT                   VITLAEAIVLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAAGFSINTLTMFGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLRPKSATRKSMSQITGALVGIALVLSAVFVPMAF
FT                   FGGSVGVIYRQFSITIVASMALSVLVALTLTPALCATLLKPVERGHGLARGGFFGAFNR
FT                   LYDRGAGRYGRVVGFLMRRRVRALIAYGVIVAALAGLFARMPTGFLPAEDQGTAFAQIL
FT                   LPPGSTLQSTREVLEKVSNHLLTEEKDSVESVMSIAGFSFSARGQNTGVAFIRLKPWDE
FT                   REGKHLKADAMAARAMRAFSTLKEANVFVFTPPAVSELGNANGFELQLQDRAGLGHDAL
FT                   MDARNQLLGLAQKDPRLAKVRPAGLEDTAQFKIDVDQQKAAALGISLADVNATIASTWG
FT                   VSYVNDFIDKGRTKRVYLQADAPFRMHPEDVGRWYVRQRGGEMVPFSAFATGSWTMGSP
FT                   KLERFNGLPAVAIQGEPAPGHSSGEAMAALEEIVGQLPSGVAADWSGLSYEERLSGANA
FT                   PALYALSILVVFLCLAALYESWSIPVSVLLAVPLGVIGAVIASSLRGLPNDVYFQVGLL
FT                   TTVGLSAKNAILIVEFARELHDRGRSAPAAALEAARMRLRPILMTSLAFVLGVLPLALA
FT                   SGAGAGSQNAIGFAVIGGMLSATALAILFVPLFFVLIARRAPAPAGVPPEDASGAEDVR
FT                   EDAAHA"
FT   gene            complement(651135..652280)
FT                   /locus_tag="Anae109_0569"
FT   CDS_pept        complement(651135..652280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0569"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_0518 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24783"
FT                   /db_xref="GOA:A7H7T7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T7"
FT                   /protein_id="ABS24783.1"
FT                   /translation="MSTHLSTSLVLGLALLSACGQKSGAKASGGPVEVGVVTLAPTSVT
FT                   LTKELPGRTSAFRVAEVRARVNGIVQKRLFTEGADVKAGQPLFVIDPAQYQASLEGAKA
FT                   QLARAEARVASARMQAQRYTELVAENAVSKQEADDAVAALKAAEADVAAGRAAVQTARI
FT                   NLGYTTVTSPLTGRIGRSAVTEGAYVQQGQATLLATVQQLDPVYVDLTQSSTEALRLRR
FT                   DHAEGKLQRAGQGQAKVQLVLEDGRPYGLDGTLQFADVTVDPSTGSIGLRALFPNPRGE
FT                   LLPGMFVRARLQEGVNPEALLVPQQAVARDQKGQPTALVVNAERKVERRQLVTDRAIGD
FT                   AWLVTSGLSRGEQVIVEGLQKVRPGAEVKPVPVAGPKHAVR"
FT   sig_peptide     complement(652203..652280)
FT                   /locus_tag="Anae109_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.740 at
FT                   residue 26"
FT   gene            652375..653004
FT                   /locus_tag="Anae109_0570"
FT   CDS_pept        652375..653004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0570"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_0519
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24784"
FT                   /db_xref="GOA:A7H7T8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T8"
FT                   /protein_id="ABS24784.1"
FT                   /translation="MSDRADVGEPEAVPAKRRQILVGARRTFGELGFERASVDLIAARA
FT                   GVSKATVYHHFEDKQALFVACALEEAEAMRAGLRACLDQPAGDVEQGLQRIGEKVMRVL
FT                   LSPAVVGLHRHAIAEAGRFPEVGRTIFDRGPRLTQELIAAHLERWDRSGALRIDDPRSA
FT                   AVQFVALCQGDLLARARLAMLEYPADEQVRETVSRAVRTFVRAYRP"
FT   gene            complement(653062..654036)
FT                   /locus_tag="Anae109_0571"
FT   CDS_pept        complement(653062..654036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0571"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   mxa:MXAN_0861 CHAD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24785"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T9"
FT                   /protein_id="ABS24785.1"
FT                   /translation="MAKPAEVPGLAPDTPVSVAAPLLVRSRLEDVRQYEAAVSVDEGEP
FT                   DVEAVHDMRVAARRLRAAMALFGRGDLADLEDEVKALQDALGDVRDPQVQRAWLLERGA
FT                   DGGTRALVRWAEAGLPRAVKRLRRAVRAFDAAVAPEIERAASAAPGKGRLGGRRIAREV
FT                   KDRLRTLKRRLAAARKAPNPRTAHRLRIAAKKLRYVAEVARPGFPAGAERVVEALAPLQ
FT                   ERLGTLHDCDVRIARLSALLRDGARRERREARTLLAWLRHDRARQRRALAEELERWREE
FT                   RVVRSLRRRFTKGRRDRERLGRAGAGVRRANGGAAPAATSSGA"
FT   gene            complement(654039..654632)
FT                   /locus_tag="Anae109_0572"
FT   CDS_pept        complement(654039..654632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0572"
FT                   /product="Inorganic pyrophosphatase"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: ade:Adeh_4099
FT                   inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24786"
FT                   /db_xref="GOA:A7H7U0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U0"
FT                   /protein_id="ABS24786.1"
FT                   /translation="MSQAVRHLGRVARRALASMARGRGESHIRGMPISSVRARTAGGFH
FT                   VVVEAPRGATVKLKHDPALDVMFAHRPLPLGFAYPYDWGFVPGTKAADGDPVDALVYWE
FT                   VASYPGVVIRCRALGVLELEQDAKGGGRERNDRILALPLANPRGAGLHTHADLDRRVLE
FT                   EIEHFFTSSVFFEPKDPRVLGWRGPEAAERLLGG"
FT   gene            654732..656963
FT                   /locus_tag="Anae109_0573"
FT   CDS_pept        654732..656963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0573"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase; KEGG: sus:Acid_3657
FT                   polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24787"
FT                   /db_xref="GOA:A7H7U1"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U1"
FT                   /protein_id="ABS24787.1"
FT                   /translation="MQSPAEPAVPPEVVSPRAGGDGAPAAGVAADAAAAVARDLAADTA
FT                   KLDPGLLVNRELSLLAFQWRVFEEVNDPSNPLLERVRFLSIVAANLDELFMIRVAGLEQ
FT                   QVAAGLTEPSSDGLTPLQQLTELRRETLRLTRALGAAWQDELLPALDAAGIHVLDHPQL
FT                   DPKQASWARTYFDEMVMPVLTPLAFDPGRPFPHISNLSLNLAVLVEDEGIDRFARIKVP
FT                   DTLPRLVPIGRATGGLDGSGTAHRHHAFVWLEQLVAAHVERLFPGVKVKGVHPFHVTRD
FT                   AEMELQELEAADLLASVEHGVRERRFGSVVRLVVTPGMPDHIRDLLVHNLEIQPRNIHV
FT                   VEGPLALSGVSSLASVERSDLKFPPLFPAVPAALRGDDDVFAAIRRRDVLIHHPFESFG
FT                   PVVEFLRAAARDPDVLAIKMTLYRVGRNSPVVEALLEANQNRKQVAVLVELKARFDEES
FT                   NIGWAKALEADGVHVIYGLLGLKTHSKIALVVRREGERLARYVHLSTGNYNPFTAAVYT
FT                   DLGLFTADEEIGEDATQLFNYLTGYAHPREFRRLLVAPVNLRERLVELIERETEHARAG
FT                   RGGHLVFKVNALADERMVEPLVRASRAGVQVDLLVRGICCLRPGVPGATENVRVTSVVG
FT                   RFLEHSRIFWFRNAGAEEVYLGSADLMRRNLSRRVEVLFPVTDPALVRHLRDRVLATYL
FT                   ADNRRARRMRADGEYERIRPADGEPPVDAQARLLASPSAPVPPDGRDGP"
FT   gene            657399..658934
FT                   /locus_tag="Anae109_0574"
FT   CDS_pept        657399..658934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0574"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; metal-dependent
FT                   phosphohydrolase HD sub domain; KEGG: mxa:MXAN_6322
FT                   phosphatase, Ppx/GppA family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24788"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U2"
FT                   /protein_id="ABS24788.1"
FT                   /translation="MKSSHPDVVAAIDVGTNAIRLEIARAGPGESIETLHQERDPIRPG
FT                   EGVFVTGRMPPAVEKRLISTLRRYAALCRRHSARVRAVATSAIREAKNGPDVVRRVRAA
FT                   AGIELEVVSGREEARLICAGVLRGRPPDAPALVLDIGGGSTEVARALGEAPTDLWSVPL
FT                   GAVRLTQIFETRGRVSPARLAALRAYAAEEFREAIPHPPRSVRRALGSSGTIGAAVGFA
FT                   ADQGRSATRGDVSRAVDALAGMSLQQRAREFDPRRAEIIVAGAAILEAAARHLGLESIV
FT                   AVDKGLRDGILVELVRSSSALRDASSAEALVGFGRRFGFDEAHATHVAALALELHDRLA
FT                   PLHRLPPSMRRVLEAAALLHDVGHAVSVHAHHKHTYYLVSNADLPGFSDRERELVALVA
FT                   RYHRRSAPSRGRADLEDLGSGELAAVRKLVAILRVADALDRSHHQPVRRLATSTRNGAV
FT                   RIAITARGPIDLELWDAEREAGLFRRVFAHRLELARATRGSGGAQATRRSRGA"
FT   gene            complement(659045..659677)
FT                   /locus_tag="Anae109_0575"
FT   CDS_pept        complement(659045..659677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0575"
FT                   /product="LigA"
FT                   /note="KEGG: ade:Adeh_3781 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24789"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U3"
FT                   /protein_id="ABS24789.1"
FT                   /translation="MRKLLAAVFALTLLAVPFTSHAQVSLGLRLGYAPALGDAAKDAKM
FT                   SDGVKSQIPIQLDAGYKLTPKLSLGGYASYGFGQSGDEFDAYCDGADCSTRVVRVGVQG
FT                   LYTFDAIGRLQPFAGVGAGYEWGSLTAEAGGQEATLSYRGFELLNLTAGADYAVSPQFA
FT                   IGPYLGFSVGRYSNVSMDLGAEEISGEIDDQAMHEWLQLGIRGRFDL"
FT   sig_peptide     complement(659609..659677)
FT                   /locus_tag="Anae109_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(659879..660310)
FT                   /locus_tag="Anae109_0576"
FT   CDS_pept        complement(659879..660310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0576"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gme:Gmet_0230 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24790"
FT                   /db_xref="GOA:A7H7U4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U4"
FT                   /protein_id="ABS24790.1"
FT                   /translation="MDTRALAATAARLETLAYAALRLVAGAMFAFHGAQKILGWLPAGP
FT                   APALGTQLWFGGIIELVGGTLIALGLFTRAAAFLASGTMAVAYTQFHWKLAVANFAWLP
FT                   SVNKGELAALYCFLFLFVMARGPGPASLDAVLRGGARAR"
FT   gene            660446..660778
FT                   /locus_tag="Anae109_0577"
FT   CDS_pept        660446..660778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0577"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: ade:Adeh_3094
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24791"
FT                   /db_xref="GOA:A7H7U5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U5"
FT                   /protein_id="ABS24791.1"
FT                   /translation="MPVGLTDEEFCDIAKALADPQRCEILERAAAAVELSCSAIVETTE
FT                   LCQSTVSHHLKELVNAQLLERRRDGHFAFYRFRRDVMEAYLDALRARTLSGANRPKPAE
FT                   RRARGR"
FT   gene            660840..661073
FT                   /locus_tag="Anae109_0578"
FT   CDS_pept        660840..661073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24792"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U6"
FT                   /protein_id="ABS24792.1"
FT                   /translation="MNTWSLVPMLLVDPAVPEEARLALHASLLLSDACRAREARALAGR
FT                   VLVQRRRLSVREAAELVGVEAGAIESRLPCAA"
FT   gene            complement(661088..661585)
FT                   /locus_tag="Anae109_0579"
FT   CDS_pept        complement(661088..661585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24793"
FT                   /db_xref="GOA:A7H7U7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U7"
FT                   /protein_id="ABS24793.1"
FT                   /translation="MSARATSIGRSATSGHGAGDASRTRLWAGRILTALPVLFLLFDGT
FT                   IKLLKLDPVVESFARLGYPATIARGIGGLELALIAVTLVPRTSLLGAVLLTGYLGGAVS
FT                   THVRVGDPLFTHVLFPSYVGVLLWSGLYLRDDRLRTLMASRRGRAGSTGAAPSWRSERA
FT                   AS"
FT   gene            complement(661582..662367)
FT                   /locus_tag="Anae109_0580"
FT   CDS_pept        complement(661582..662367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0580"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: bxe:Bxe_B0232
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24794"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U8"
FT                   /protein_id="ABS24794.1"
FT                   /translation="MRVMIMHKVNESTEAGVLPGPEVLAGMGRLIQEMVQAGVFLDAAG
FT                   LKPSSTRVRLNFSRGEREVTKGPLVGRNELIAGFALMKVRSMEEAIAWATRFAQVVGDV
FT                   EIDVGPVTEPWDLGVAPRPPGEVPLRVLAMHKADESSEAFAAPNPETMAEMGKLIEEMT
FT                   KAGVLLATEGLKPSSEGWRLRYGGGKRTVIDGPFAESKELIAGYVMLRVKSREELLDWA
FT                   GRFAAVVGDVELDVRPLFEDSDLAPVEPHGRGAAEGRRA"
FT   gene            662574..663800
FT                   /locus_tag="Anae109_0581"
FT   CDS_pept        662574..663800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0581"
FT                   /product="CHRD domain containing protein"
FT                   /note="PFAM: CHRD domain containing protein; KEGG:
FT                   ade:Adeh_3145 CHRD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24795"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U9"
FT                   /protein_id="ABS24795.1"
FT                   /translation="MEHRVCRRSSRVALVASFVLAACGGSSYGGGGGSGGGDGYGGDGG
FT                   GGGGGTAATALWVIPESAPALTSDGRAAFTAGGLYYNAHTAANTGGEIRGQLDHGGTLR
FT                   LATLDGAQETPPVTTGAFGAGAFTVDTSTGRIRGLVTTSGLVNATAAHVHLGARGSPGG
FT                   IIVPLSGGPEVWVVPDGAAQLTSEQIDAFERNDLFVNVHTSANPAGEIRGQLDKGGTVQ
FT                   VTSLSGGEETPPVTTSGFGAGILVVDDTTGVPGGFIVASGLTGANAAHVHLGAKGTPGG
FT                   VILPLSGGPGLWVVPDGAGALTAEQRTAFAEKNLYYNVHTAANPGGEIRGQLEQRDLVR
FT                   IASLDGGQEVPAVTTTAFGAGLLALDDGTSGEVGGFLLTVGLVAPNAAHVHSGSRGTPG
FT                   GVLVPLSGP"
FT   sig_peptide     662574..662663
FT                   /locus_tag="Anae109_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.947 at
FT                   residue 30"
FT   gene            complement(663837..664646)
FT                   /locus_tag="Anae109_0582"
FT   CDS_pept        complement(663837..664646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0582"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ade:Adeh_3146 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24796"
FT                   /db_xref="GOA:A7H7V0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V0"
FT                   /protein_id="ABS24796.1"
FT                   /translation="MSLTRRRFLVRTAAGAAGAVAGAALPGCAPDASPAPLVDVPAPVG
FT                   GRLSLLVARYPELAKVGGAVRARAPGLDEPVLIARVTEDGFVAMSSVCTHQGCPVGFDG
FT                   AQVVCPCHQSTFDLQGRVTNPPAVQGLTPYAAFYDPSLGELAVDLVAGDEGFPRWDAGV
FT                   VTLPLAQYPQLGQPGGSVAGRPGGAPRPLALLVVALPDLEYAALDAICTHLGCTVGYDA
FT                   GRALVICPCHDSRYTTDGVVQQGPATRKLQRYDVTADAQAVTVRIPA"
FT   sig_peptide     complement(664575..664646)
FT                   /locus_tag="Anae109_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.444 at
FT                   residue 24"
FT   gene            complement(664643..665194)
FT                   /locus_tag="Anae109_0583"
FT   CDS_pept        complement(664643..665194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24797"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V1"
FT                   /protein_id="ABS24797.1"
FT                   /translation="MIASIVAAALLLAAPEAVPRTFSVLPGSTLAYRLVHRFHEVNGVS
FT                   RAVEGKARVLPDGTVQVMVRAPLDSFDSGNSNRDAHMLEATGAAQNPYVEFKGVGRLDA
FT                   PDAHPSEARVALRGVLTLKTPRAVEVALTVRFDSAERAHAEASFPISLEEHHVERPSLM
FT                   FVKVDDRVVIDAKLDLEADR"
FT   gene            665389..665880
FT                   /locus_tag="Anae109_0584"
FT   CDS_pept        665389..665880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0584"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; KEGG: ade:Adeh_3148 sigma-24
FT                   (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24798"
FT                   /db_xref="GOA:A7H7V2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V2"
FT                   /protein_id="ABS24798.1"
FT                   /translation="MPLDEAAAARLYRTYGPAVYRRCLRLLRDRELARDATQDVFVQLL
FT                   RQWTDSTKPEVVLHWIYRVATNHCLNLLRNARRHGEQPLELCPVHAVPGSPAEPQRLVA
FT                   QQVLSRFDAVTQAVAVGVFVDGMEHEELARALGISRRTVSRRLDRFVESAREYLARGEG
FT                   "
FT   gene            665877..666611
FT                   /locus_tag="Anae109_0585"
FT   CDS_pept        665877..666611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24799"
FT                   /db_xref="GOA:A7H7V3"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V3"
FT                   /protein_id="ABS24799.1"
FT                   /translation="MTGCPSDLRLEVLLLEPQAPEAQHVASCPPCQARLAEMRAAGEEF
FT                   QREVYPATVATVTVAVRTPRRAPPARRWVRLAAPLAAAAAVIAFLAARYWTTAAPTLAL
FT                   AVYVADPSRATPVGDGEPVPAAAALRFEVHPSSPCNLWILSVDPTGDIARLYPPKGDRA
FT                   SEAIVHPAEQHLLPTTALLDGRAGPERIFAVCTKSQVPWNTVKQAAAKELEKGDEAVRR
FT                   LRSIGGLPAGSSQTSVLIEKRT"
FT   gene            complement(666650..667282)
FT                   /locus_tag="Anae109_0586"
FT   CDS_pept        complement(666650..667282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24800"
FT                   /db_xref="GOA:A7H7V4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V4"
FT                   /protein_id="ABS24800.1"
FT                   /translation="MRATPRASMVALALALGAGSAGAADDEPRDRKGEEKRPDLSPRAP
FT                   ELDFDLLGKPAKKANPEVQRKLETRRKMLTLHTGIGIATWAALATTTAVGQLDFDDRFR
FT                   GGGDTGKYHGWHTGLAYGTSALFLTTALLGVLAPKPFSEPARLDTALLHKIAMGVATAG
FT                   MITQIVLGVVARGQAGSLSERDLATAHQLVGYSTLGAMTFGMTVLVF"
FT   sig_peptide     complement(667211..667282)
FT                   /locus_tag="Anae109_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 24"
FT   gene            667518..668396
FT                   /locus_tag="Anae109_0587"
FT   CDS_pept        667518..668396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24801"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V5"
FT                   /protein_id="ABS24801.1"
FT                   /translation="MTKRLALASLLLATSALAADPQMKPFVLASRGAGDVEAAASTARQ
FT                   KLQAAGFEIAGSYAPYPGAVVLAVTNETLKAEGAKTGSGGYVAAQRVTITRVGEEVQVA
FT                   FTNPVYMAAAYRLPGDLAPVTASLQGALGRIEEYGPSEGKSAKELRKYHYMVGMEYFDE
FT                   PSKLGHFASHDEAVRAVEAGLAERRGGASKVYRIDLPGGRQTVFGVALTDGCSGDARIM
FT                   KEIDFKPVRSTGHLPYEILVTEGDVRALYARFRIAVNFPDLKMMGSHSFMDIRCAPDAI
FT                   EKALKAVAGAR"
FT   sig_peptide     667518..667574
FT                   /locus_tag="Anae109_0587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 19"
FT   gene            complement(668402..669505)
FT                   /locus_tag="Anae109_0588"
FT   CDS_pept        complement(668402..669505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0588"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   mxa:MXAN_2683 methyl accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24802"
FT                   /db_xref="GOA:A7H7V6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V6"
FT                   /protein_id="ABS24802.1"
FT                   /translation="MFARRYAWYGAAFGACFPVIATVLEAASRHGGVGPAALAAALRSP
FT                   LLWIVALAPLVLALLARVAGVRQDRAVAIDAARREAYVRAAGELAGAARSLAEEATRIR
FT                   GGAAEQAAGAAQQASAIAQTSTSAAEIAQMAVRSAERAEGVIAVTDRSGDLSTEGQRAV
FT                   ERVVSGIEDLAAAVESIAQATAELAADARRIGDIVETVKDVAEQSNVLAVNAALEAARA
FT                   GEHGRGFGTVAVEVRSLAEQSRGAAVEVARIVGGVLARVERTASAASEGRSRADGVIAL
FT                   ARSTATAIDSLGGLVRDSATEAREIALAARQQTLGIDEIVAAMGQISAATSAAVSSAAG
FT                   IEQAAKALAEMSHSLGATVERYRAAAE"
FT   sig_peptide     complement(669440..669505)
FT                   /locus_tag="Anae109_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.839) with cleavage site probability 0.500 at
FT                   residue 22"
FT   gene            669677..670204
FT                   /locus_tag="Anae109_0589"
FT   CDS_pept        669677..670204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0589"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: mmr:Mmar10_2885 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24803"
FT                   /db_xref="GOA:A7H7V7"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V7"
FT                   /protein_id="ABS24803.1"
FT                   /translation="MATTAPETVQRFVEAWGAMGSLWGINRSVARVHALLMATEEPLPL
FT                   EEIAGRLRISKGNASMSLRELRTFGVVRQVEVAGDRRDFYVTEPDVWLMFFRILKERKR
FT                   REFDPALEAIHALVDAPGATGAVRGRLEQMADLLTTVEGVVNRFLQDPQSSRSALAFIA
FT                   GMPFGRKQNGKG"
FT   gene            670296..671210
FT                   /locus_tag="Anae109_0590"
FT   CDS_pept        670296..671210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0590"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: ttj:TTHB098 NADH-ubiquinone oxidoreductase 39 kDa
FT                   subunit related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24804"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR03