(data stored in ACNUC7421 zone)

EMBL: CP000780

ID   CP000780; SV 1; circular; genomic DNA; STD; PRO; 2542943 BP.
XX
AC   CP000780;
XX
PR   Project:PRJNA18505;
XX
DT   28-JUL-2007 (Rel. 92, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 5)
XX
DE   Methanoregula boonei 6A8 chromosome, complete genome.
XX
KW   .
XX
OS   Methanoregula boonei 6A8
OC   Archaea; Euryarchaeota; Stenosarchaea group; Methanomicrobia;
OC   Methanomicrobiales; Methanoregulaceae; Methanoregula.
XX
RN   [1]
RP   1-2542943
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Meincke L., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Tapia R., Gilna P., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Zinder S., Richardson P.;
RT   "Complete sequence of Candidatus Methanoregula boonei 6A8";
RL   Unpublished.
XX
RN   [2]
RP   1-2542943
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Meincke L., Brettin T., Bruce D., Detter J.C., Han C.,
RA   Tapia R., Gilna P., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Zinder S., Richardson P.;
RT   ;
RL   Submitted (24-JUL-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 7012d964fe8235948f1005961dd2d970.
DR   BioSample; SAMN02598409.
DR   EnsemblGenomes-Gn; EBG00001234239.
DR   EnsemblGenomes-Gn; EBG00001234240.
DR   EnsemblGenomes-Gn; EBG00001234241.
DR   EnsemblGenomes-Gn; EBG00001234242.
DR   EnsemblGenomes-Gn; EBG00001234243.
DR   EnsemblGenomes-Gn; EBG00001234244.
DR   EnsemblGenomes-Gn; EBG00001234245.
DR   EnsemblGenomes-Gn; EBG00001234246.
DR   EnsemblGenomes-Gn; EBG00001234247.
DR   EnsemblGenomes-Gn; EBG00001234248.
DR   EnsemblGenomes-Gn; EBG00001234249.
DR   EnsemblGenomes-Gn; EBG00001234251.
DR   EnsemblGenomes-Gn; EBG00001234252.
DR   EnsemblGenomes-Gn; EBG00001234253.
DR   EnsemblGenomes-Gn; EBG00001234254.
DR   EnsemblGenomes-Gn; EBG00001234255.
DR   EnsemblGenomes-Gn; EBG00001234256.
DR   EnsemblGenomes-Gn; EBG00001234257.
DR   EnsemblGenomes-Gn; EBG00001234258.
DR   EnsemblGenomes-Gn; EBG00001234259.
DR   EnsemblGenomes-Gn; EBG00001234260.
DR   EnsemblGenomes-Gn; EBG00001234261.
DR   EnsemblGenomes-Gn; EBG00001234262.
DR   EnsemblGenomes-Gn; EBG00001234263.
DR   EnsemblGenomes-Gn; EBG00001234264.
DR   EnsemblGenomes-Gn; EBG00001234265.
DR   EnsemblGenomes-Gn; EBG00001234266.
DR   EnsemblGenomes-Gn; EBG00001234267.
DR   EnsemblGenomes-Gn; EBG00001234268.
DR   EnsemblGenomes-Gn; EBG00001234269.
DR   EnsemblGenomes-Gn; EBG00001234270.
DR   EnsemblGenomes-Gn; EBG00001234271.
DR   EnsemblGenomes-Gn; EBG00001234272.
DR   EnsemblGenomes-Gn; EBG00001234273.
DR   EnsemblGenomes-Gn; EBG00001234274.
DR   EnsemblGenomes-Gn; EBG00001234275.
DR   EnsemblGenomes-Gn; EBG00001234276.
DR   EnsemblGenomes-Gn; EBG00001234277.
DR   EnsemblGenomes-Gn; EBG00001234278.
DR   EnsemblGenomes-Gn; EBG00001234279.
DR   EnsemblGenomes-Gn; EBG00001234280.
DR   EnsemblGenomes-Gn; EBG00001234281.
DR   EnsemblGenomes-Gn; EBG00001234282.
DR   EnsemblGenomes-Gn; EBG00001234283.
DR   EnsemblGenomes-Gn; EBG00001234284.
DR   EnsemblGenomes-Gn; EBG00001234285.
DR   EnsemblGenomes-Gn; EBG00001234286.
DR   EnsemblGenomes-Gn; EBG00001234287.
DR   EnsemblGenomes-Gn; EBG00001234288.
DR   EnsemblGenomes-Gn; EBG00001234289.
DR   EnsemblGenomes-Gn; EBG00001234290.
DR   EnsemblGenomes-Gn; EBG00001234291.
DR   EnsemblGenomes-Gn; EBG00001234292.
DR   EnsemblGenomes-Gn; EBG00001234293.
DR   EnsemblGenomes-Gn; EBG00001234294.
DR   EnsemblGenomes-Gn; Mboo_R0001.
DR   EnsemblGenomes-Gn; Mboo_R0002.
DR   EnsemblGenomes-Gn; Mboo_R0003.
DR   EnsemblGenomes-Gn; Mboo_R0004.
DR   EnsemblGenomes-Gn; Mboo_R0005.
DR   EnsemblGenomes-Gn; Mboo_R0006.
DR   EnsemblGenomes-Gn; Mboo_R0008.
DR   EnsemblGenomes-Gn; Mboo_R0009.
DR   EnsemblGenomes-Gn; Mboo_R0010.
DR   EnsemblGenomes-Gn; Mboo_R0011.
DR   EnsemblGenomes-Gn; Mboo_R0012.
DR   EnsemblGenomes-Gn; Mboo_R0013.
DR   EnsemblGenomes-Gn; Mboo_R0014.
DR   EnsemblGenomes-Gn; Mboo_R0015.
DR   EnsemblGenomes-Gn; Mboo_R0017.
DR   EnsemblGenomes-Gn; Mboo_R0018.
DR   EnsemblGenomes-Gn; Mboo_R0019.
DR   EnsemblGenomes-Gn; Mboo_R0020.
DR   EnsemblGenomes-Gn; Mboo_R0021.
DR   EnsemblGenomes-Gn; Mboo_R0022.
DR   EnsemblGenomes-Gn; Mboo_R0023.
DR   EnsemblGenomes-Gn; Mboo_R0025.
DR   EnsemblGenomes-Gn; Mboo_R0026.
DR   EnsemblGenomes-Gn; Mboo_R0027.
DR   EnsemblGenomes-Gn; Mboo_R0028.
DR   EnsemblGenomes-Gn; Mboo_R0029.
DR   EnsemblGenomes-Gn; Mboo_R0030.
DR   EnsemblGenomes-Gn; Mboo_R0031.
DR   EnsemblGenomes-Gn; Mboo_R0032.
DR   EnsemblGenomes-Gn; Mboo_R0033.
DR   EnsemblGenomes-Gn; Mboo_R0034.
DR   EnsemblGenomes-Gn; Mboo_R0035.
DR   EnsemblGenomes-Gn; Mboo_R0036.
DR   EnsemblGenomes-Gn; Mboo_R0037.
DR   EnsemblGenomes-Gn; Mboo_R0038.
DR   EnsemblGenomes-Gn; Mboo_R0039.
DR   EnsemblGenomes-Gn; Mboo_R0040.
DR   EnsemblGenomes-Gn; Mboo_R0041.
DR   EnsemblGenomes-Gn; Mboo_R0042.
DR   EnsemblGenomes-Gn; Mboo_R0043.
DR   EnsemblGenomes-Gn; Mboo_R0044.
DR   EnsemblGenomes-Gn; Mboo_R0045.
DR   EnsemblGenomes-Gn; Mboo_R0046.
DR   EnsemblGenomes-Gn; Mboo_R0047.
DR   EnsemblGenomes-Gn; Mboo_R0048.
DR   EnsemblGenomes-Gn; Mboo_R0049.
DR   EnsemblGenomes-Gn; Mboo_R0050.
DR   EnsemblGenomes-Gn; Mboo_R0051.
DR   EnsemblGenomes-Gn; Mboo_R0052.
DR   EnsemblGenomes-Gn; Mboo_R0053.
DR   EnsemblGenomes-Tr; EBT00001579740.
DR   EnsemblGenomes-Tr; EBT00001579741.
DR   EnsemblGenomes-Tr; EBT00001579742.
DR   EnsemblGenomes-Tr; EBT00001579743.
DR   EnsemblGenomes-Tr; EBT00001579744.
DR   EnsemblGenomes-Tr; EBT00001579745.
DR   EnsemblGenomes-Tr; EBT00001579746.
DR   EnsemblGenomes-Tr; EBT00001579747.
DR   EnsemblGenomes-Tr; EBT00001579748.
DR   EnsemblGenomes-Tr; EBT00001579749.
DR   EnsemblGenomes-Tr; EBT00001579750.
DR   EnsemblGenomes-Tr; EBT00001579751.
DR   EnsemblGenomes-Tr; EBT00001579752.
DR   EnsemblGenomes-Tr; EBT00001579753.
DR   EnsemblGenomes-Tr; EBT00001579754.
DR   EnsemblGenomes-Tr; EBT00001579755.
DR   EnsemblGenomes-Tr; EBT00001579756.
DR   EnsemblGenomes-Tr; EBT00001579757.
DR   EnsemblGenomes-Tr; EBT00001579758.
DR   EnsemblGenomes-Tr; EBT00001579759.
DR   EnsemblGenomes-Tr; EBT00001579760.
DR   EnsemblGenomes-Tr; EBT00001579762.
DR   EnsemblGenomes-Tr; EBT00001579763.
DR   EnsemblGenomes-Tr; EBT00001579764.
DR   EnsemblGenomes-Tr; EBT00001579765.
DR   EnsemblGenomes-Tr; EBT00001579766.
DR   EnsemblGenomes-Tr; EBT00001579767.
DR   EnsemblGenomes-Tr; EBT00001579768.
DR   EnsemblGenomes-Tr; EBT00001579769.
DR   EnsemblGenomes-Tr; EBT00001579770.
DR   EnsemblGenomes-Tr; EBT00001579771.
DR   EnsemblGenomes-Tr; EBT00001579772.
DR   EnsemblGenomes-Tr; EBT00001579773.
DR   EnsemblGenomes-Tr; EBT00001579774.
DR   EnsemblGenomes-Tr; EBT00001579775.
DR   EnsemblGenomes-Tr; EBT00001579776.
DR   EnsemblGenomes-Tr; EBT00001579777.
DR   EnsemblGenomes-Tr; EBT00001579778.
DR   EnsemblGenomes-Tr; EBT00001579779.
DR   EnsemblGenomes-Tr; EBT00001579780.
DR   EnsemblGenomes-Tr; EBT00001579781.
DR   EnsemblGenomes-Tr; EBT00001579782.
DR   EnsemblGenomes-Tr; EBT00001579783.
DR   EnsemblGenomes-Tr; EBT00001579784.
DR   EnsemblGenomes-Tr; EBT00001579785.
DR   EnsemblGenomes-Tr; EBT00001579786.
DR   EnsemblGenomes-Tr; EBT00001579787.
DR   EnsemblGenomes-Tr; EBT00001579788.
DR   EnsemblGenomes-Tr; EBT00001579789.
DR   EnsemblGenomes-Tr; EBT00001579790.
DR   EnsemblGenomes-Tr; EBT00001579791.
DR   EnsemblGenomes-Tr; EBT00001579792.
DR   EnsemblGenomes-Tr; EBT00001579793.
DR   EnsemblGenomes-Tr; EBT00001579794.
DR   EnsemblGenomes-Tr; EBT00001579795.
DR   EnsemblGenomes-Tr; Mboo_R0001-1.
DR   EnsemblGenomes-Tr; Mboo_R0002-1.
DR   EnsemblGenomes-Tr; Mboo_R0003-1.
DR   EnsemblGenomes-Tr; Mboo_R0004-1.
DR   EnsemblGenomes-Tr; Mboo_R0005-1.
DR   EnsemblGenomes-Tr; Mboo_R0006-1.
DR   EnsemblGenomes-Tr; Mboo_R0008-1.
DR   EnsemblGenomes-Tr; Mboo_R0009-1.
DR   EnsemblGenomes-Tr; Mboo_R0010-1.
DR   EnsemblGenomes-Tr; Mboo_R0011-1.
DR   EnsemblGenomes-Tr; Mboo_R0012-1.
DR   EnsemblGenomes-Tr; Mboo_R0013-1.
DR   EnsemblGenomes-Tr; Mboo_R0014-1.
DR   EnsemblGenomes-Tr; Mboo_R0015-1.
DR   EnsemblGenomes-Tr; Mboo_R0017-1.
DR   EnsemblGenomes-Tr; Mboo_R0018-1.
DR   EnsemblGenomes-Tr; Mboo_R0019-1.
DR   EnsemblGenomes-Tr; Mboo_R0020-1.
DR   EnsemblGenomes-Tr; Mboo_R0021-1.
DR   EnsemblGenomes-Tr; Mboo_R0022-1.
DR   EnsemblGenomes-Tr; Mboo_R0023-1.
DR   EnsemblGenomes-Tr; Mboo_R0025-1.
DR   EnsemblGenomes-Tr; Mboo_R0026-1.
DR   EnsemblGenomes-Tr; Mboo_R0027-1.
DR   EnsemblGenomes-Tr; Mboo_R0028-1.
DR   EnsemblGenomes-Tr; Mboo_R0029-1.
DR   EnsemblGenomes-Tr; Mboo_R0030-1.
DR   EnsemblGenomes-Tr; Mboo_R0031-1.
DR   EnsemblGenomes-Tr; Mboo_R0032-1.
DR   EnsemblGenomes-Tr; Mboo_R0033-1.
DR   EnsemblGenomes-Tr; Mboo_R0034-1.
DR   EnsemblGenomes-Tr; Mboo_R0035-1.
DR   EnsemblGenomes-Tr; Mboo_R0036-1.
DR   EnsemblGenomes-Tr; Mboo_R0037-1.
DR   EnsemblGenomes-Tr; Mboo_R0038-1.
DR   EnsemblGenomes-Tr; Mboo_R0039-1.
DR   EnsemblGenomes-Tr; Mboo_R0040-1.
DR   EnsemblGenomes-Tr; Mboo_R0041-1.
DR   EnsemblGenomes-Tr; Mboo_R0042-1.
DR   EnsemblGenomes-Tr; Mboo_R0043-1.
DR   EnsemblGenomes-Tr; Mboo_R0044-1.
DR   EnsemblGenomes-Tr; Mboo_R0045-1.
DR   EnsemblGenomes-Tr; Mboo_R0046-1.
DR   EnsemblGenomes-Tr; Mboo_R0047-1.
DR   EnsemblGenomes-Tr; Mboo_R0048-1.
DR   EnsemblGenomes-Tr; Mboo_R0049-1.
DR   EnsemblGenomes-Tr; Mboo_R0050-1.
DR   EnsemblGenomes-Tr; Mboo_R0051-1.
DR   EnsemblGenomes-Tr; Mboo_R0052-1.
DR   EnsemblGenomes-Tr; Mboo_R0053-1.
DR   EuropePMC; PMC3628448; 23364577.
DR   EuropePMC; PMC5054157; 22768985.
DR   EuropePMC; PMC6459918; 30975999.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000780.
DR   SILVA-SSU; CP000780.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002915
CC   Source DNA and archaea available from Stephen Zinder
CC   (shzl@cornell.edu)
CC   Contacts: Stephen Zinder (shzl@cornell.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2542943
FT                   /organism="Methanoregula boonei 6A8"
FT                   /strain="6A8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:456442"
FT                   /type_material="type strain of Methanoregula boonei"
FT   gene            346..1638
FT                   /locus_tag="Mboo_0001"
FT   CDS_pept        346..1638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0001"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mhu:Mhun_2471 AAA ATPase,
FT                   central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54525"
FT                   /db_xref="GOA:A7I464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I464"
FT                   /protein_id="ABS54525.1"
FT                   /translation="MPETEDPATGLFIKYLSNNRIFRDREVLRHSYRPQILPHRQPQID
FT                   TIASILAPSLRNETPSNILIYGKTGTGKTASVRYVGSELEKASSTMGTTCRIVHLNCEV
FT                   IDTQYRVLAQIAKCIDDVDEASSDKAKIHIPMTGWPTDQVYSELKNQLDTGGGVLVIVL
FT                   DEIDKLVKKSGDDTLYNLTRINSDLKNSKVSIIGISNDLSFKDFLDPRVLSSLSEEEIV
FT                   FPPYNAPQLVDILTQRAAGAFLDGAIADGVIPLCSALAAQEHGDARRALDLLRISGELA
FT                   DRDESKQVTDVHVKQAQAKIETDSMIECIATLPTQSKLILFSMLTLEQLGQNIFTSGEV
FT                   SRVYQDIAPEIQLDILTHRRITDLISELNMLGVINTRVVSRGRYGRTKEMWFDANTGKI
FT                   REVVLKDPRLNGLKDLDINQMETKWLKTWFR"
FT   gene            1645..2136
FT                   /locus_tag="Mboo_0002"
FT   CDS_pept        1645..2136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0002"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   mhu:Mhun_2472 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54526"
FT                   /db_xref="GOA:A7I465"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I465"
FT                   /protein_id="ABS54526.1"
FT                   /translation="MDDKDLELLRILEENSRLSAQEIGSMTNLIPAEVEARIHALEESR
FT                   IIRKYTTVINWEKAGNGEVSAIIELKVSPERDFGYDRIAERLSRFRQVRTLRLITGTYD
FT                   LQLMVSGKNVQEVSRFVSEHVAPMDRIRETATHIVMKSYKENGNTLFEQQEAERLPYSF
FT                   "
FT   gene            2146..3303
FT                   /locus_tag="Mboo_0003"
FT   CDS_pept        2146..3303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0003"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mhu:Mhun_2473 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54527"
FT                   /db_xref="GOA:A7I466"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7I466"
FT                   /protein_id="ABS54527.1"
FT                   /translation="MRNFVSDRARDIPPSGIRKFFDLALTMSDVISLGVGEPDFRTPWN
FT                   ICEAGIYSVEQGATSYTPNRGLQTLRRALAIHLANRYQLRYSPDDEMIITTGVSEGLDI
FT                   AIRAIVNPGDEVLIAEPSYVSYAPCVALAGGIPVPVECTEQDHFRLNPDKLQEKITPKS
FT                   KALIVNFPNNPTGAIMRKEDLEPIADIVTDRDLMLISDEVYSELTYESPHVAAATVKDL
FT                   RERTITLNGFSKAYAMTGWRIGYLCAPKEICDAALKIHQYVMLCAPAMGQIGALEALRS
FT                   AEDEKTSMISEYRLRRNSFVAGLNRIGLSCHVPEGAFYAFPSVKGTGLSDVEFAERLLR
FT                   EQRVAVVPGSVFGAGGEYHLRCAYAVSRDELTEALGRMESFINGL"
FT   gene            3422..4435
FT                   /locus_tag="Mboo_0004"
FT   CDS_pept        3422..4435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0004"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   mhu:Mhun_2319 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54528"
FT                   /db_xref="GOA:A7I467"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:A7I467"
FT                   /protein_id="ABS54528.1"
FT                   /translation="MSCSIIVGGFFGDEGKGKIVAHIAHADEPVIISRGGVGPNAGHTV
FT                   QIGDREYGVRMVPSGFVYKKAKLCIGSGVLVDPRVLKHEVETLGVKGRVFVDKRCGIIT
FT                   EDHIARDKGSAHLSKKIGSTGSGCGPANSDRVMRISPQAKDVPELKEYLLDVPKAIDDA
FT                   LKAGNEVLLEGTQGFGISLYYGTYPFVTSKDTSASQIAADNGVGPTKIDDVIVVFKAYP
FT                   TRVGEGPFSTEMSAEKSDAMGIQEFGTVTHRKRRIGGWDGEMARYSAMINGCTQAAITG
FT                   IDRVDKDCFGITEYSKLTRKAREFLKTAEDDIGSPVTLISTGPEMSQIIDIRKEYA"
FT   gene            4432..4611
FT                   /locus_tag="Mboo_0005"
FT   CDS_pept        4432..4611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0005"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   mbu:Mbur_1284 protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54529"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:A7I468"
FT                   /protein_id="ABS54529.1"
FT                   /translation="MKRSLMDILCCPVCKGDLALRVDKEDPQEILEGNLHCAACSADYP
FT                   ITGGIPDLLPPSTR"
FT   gene            4623..5198
FT                   /locus_tag="Mboo_0006"
FT   CDS_pept        4623..5198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54530"
FT                   /db_xref="GOA:A7I469"
FT                   /db_xref="UniProtKB/TrEMBL:A7I469"
FT                   /protein_id="ABS54530.1"
FT                   /translation="MLPSLPLGILVAAGSPDAEGVTTEINLNRSGINTIDLPRENAQVE
FT                   CGGALRVRFRNRGAPIHITATTSNAGMFTDFFHENMYVIDEVVLGIPLRKECAPGFFDI
FT                   EIIAGYGAMKATMRVEVMVRPSREEEQREKEPPIQPEAHGRPHLLMVAMAIGLILYCAW
FT                   YYTKIEVLNLGAFIALIVGILYVWYRQI"
FT   sig_peptide     4623..4679
FT                   /locus_tag="Mboo_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.548 at
FT                   residue 19"
FT   gene            5180..6124
FT                   /locus_tag="Mboo_0007"
FT   CDS_pept        5180..6124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0007"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: mhu:Mhun_2321
FT                   cobalamin biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54531"
FT                   /db_xref="GOA:A7I470"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:A7I470"
FT                   /protein_id="ABS54531.1"
FT                   /translation="MVPTDLILAGATLVLALAIDRAIGDPHSPYHPVALLGRFISLWGR
FT                   PSRYPPVFQRAAGIFFWLVTVCFFALPFFLFGRYVPWLVYLIDAPFLLKCCFAWRSLEE
FT                   HAQEVVAALKNGIDAGREQVGLMVSRDTACLDPEHIRSAAYESVAENLTDSIISPLFYF
FT                   SLLSPFGFGLAGAAGFRAANTMDAMLGYRDERARIGWCPARMDDILNYLPARITTLYLL
FT                   AWFATQGTFGAAWRTMRRDGKKRPGFNGGIVMAAMAGGCGIRFEKPGVYSLGDGGRSLE
FT                   EGGPAIIRAVRVVTLAFAATAASTLILLAWLIQ"
FT   gene            6134..7030
FT                   /locus_tag="Mboo_0008"
FT   CDS_pept        6134..7030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0008"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; KEGG: mhu:Mhun_2322
FT                   vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54532"
FT                   /db_xref="GOA:A7I471"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A7I471"
FT                   /protein_id="ABS54532.1"
FT                   /translation="MKLEELRFGTELLKRGFASMQKGGVIMDVVNAEQAKIAEAAGAVA
FT                   VMSLERVPSDIRKAGGVARMADPEKVTEIIEAVSIPVMGKVRIGHFVEAQVLEVLGVDM
FT                   IDESEVLTPADEEYHIDKKQFKVPFVCGARNLGEALRRVNEGAAMIRTKGEAGTGNVVE
FT                   AVRHMRAITGEIRKIQGMDDQERIAYARSIEAPAELVVESAKRGRLPVVNFSAGGIATP
FT                   SDAALMMQLGADGVFVGSGIFKSSNPEKMAKAIVEAVNHYNDPTVIARISKGLGDAMPG
FT                   LDVHTLRPDEVLQTRGR"
FT   gene            7020..7619
FT                   /locus_tag="Mboo_0009"
FT   CDS_pept        7020..7619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0009"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   mhu:Mhun_2323 SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54533"
FT                   /db_xref="GOA:A7I472"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I472"
FT                   /protein_id="ABS54533.1"
FT                   /translation="MGDKTVKVGVLALQGDVSEHIDAFTAALRKRGYTEDSPVIEVRNP
FT                   EDLAGCAALAIPGGESTTISRLVDKNGLYKPIRDFKGGIFATCAGMILMATDVGDPRVH
FT                   SLGLLDMTVDRNAFGRQRESFEADIRVQGLDGGSFHAVFIRGPVVTEARDGVVVLARTD
FT                   KGIVAVEKGRHMALAFHPELGGDLRLHERFLKNLGV"
FT   gene            7660..8340
FT                   /locus_tag="Mboo_0010"
FT   CDS_pept        7660..8340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0010"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mac:MA1708 uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54534"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I473"
FT                   /protein_id="ABS54534.1"
FT                   /translation="MISESSHFREMARSLGADFVGIADPEGFNNPEYRGNRPQDFAPWI
FT                   RSIMVLGVIIPKGCVDPLPKGRAEYTNTLMAGTVTLRVMGFALVRELEKQGYRAMLVPS
FT                   EGSEFGTWYANKETLKADLSLKYAAWLAGLGEYGLNQLLITRETGPRIRMTAILTDAPI
FT                   EPDHPSGKSFVRPECASCQKCVKICPVKALSADGTIQPHLCRDYLFSTLGGLRCGMCIR
FT                   VCPL"
FT   gene            8438..9136
FT                   /locus_tag="Mboo_0011"
FT   CDS_pept        8438..9136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0011"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel proteins; PFAM: major
FT                   intrinsic protein; KEGG: mxa:MXAN_5069 aquaporin Z"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54535"
FT                   /db_xref="GOA:A7I474"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A7I474"
FT                   /protein_id="ABS54535.1"
FT                   /translation="MCDYKKYLAEFIGTFVLVFIGTGSAVVAGKEIGFLGIALAFGLSV
FT                   LVMVYAIGQISGCHINPAITIAMLANGKIGSKDAAMYIIAQCIGAIIASLVLLSIMTGL
FT                   PGYSLAINGLGQDGYGIASPGGFPLMSGFIAEVVLTFIFLMVVFGATCKKAPAGFAGIA
FT                   IGLSLAMIHMVGIPITGTSVNPARSLGPALVVGGTALAQLWMFILAPIIGALVAAIVWK
FT                   YLFEETMSPA"
FT   gene            complement(9146..9871)
FT                   /locus_tag="Mboo_0012"
FT   CDS_pept        complement(9146..9871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54536"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A7I475"
FT                   /protein_id="ABS54536.1"
FT                   /translation="MDPVIARIRQELEGLADKQTRTTSQRFFKEEISCYGIKTPVVTAL
FT                   AKKYWKEIKNQEKEAIFALCEELYRSGKLEESFVVSTWAYALDDRFEKKDLLVFRRWID
FT                   TYIQNWASCDGFCNHALGAFFERYPECTGELRVWAKSENRWMRRAAAVSLIVPAKHGKF
FT                   LPEAIVIADLLLTDSDDMVQKGYGWLLKEASRKHRDEVFSYIVKNREVMPRTALRYAIE
FT                   LMPEEQRKEAMKKDLRTKK"
FT   gene            complement(9962..10342)
FT                   /locus_tag="Mboo_0013"
FT   CDS_pept        complement(9962..10342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0013"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG:
FT                   mhu:Mhun_1541 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54537"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I476"
FT                   /protein_id="ABS54537.1"
FT                   /translation="MITSKNGKVYHCSVEAALDVIGGKWKPLILWRLGDNVMRFGELQR
FT                   SLPGVNAKMLTKQLRELENDGVIKRTLYPEVPPRVEYSITDFGRTLIPILEALCTWGAT
FT                   YLENGNSPVPECTAKAEKGMKA"
FT   gene            10509..11078
FT                   /locus_tag="Mboo_0014"
FT   CDS_pept        10509..11078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0014"
FT                   /product="flavin reductase domain protein, FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: mac:MA0328 flavoredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54538"
FT                   /db_xref="GOA:A7I477"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A7I477"
FT                   /protein_id="ABS54538.1"
FT                   /translation="MEKIEIPKNFFIPMPVVLVGTMVNGRANFMAVGWCARVNGNPPMI
FT                   ACGISNSHATPGGITATKNFSVNIPSSALLEKTDYCGMVSGKTADKSGVFDVFYGTLKT
FT                   APMIRECPVTLECQLVQVVALPTHTLFIGEIAGAYADSRVIKDGKPDFPAIDPLFLTMP
FT                   DNRYWALGTYAGDAWSAGKHLKSSTG"
FT   gene            11102..11920
FT                   /locus_tag="Mboo_0015"
FT   CDS_pept        11102..11920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0015"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein; KEGG: mac:MA2742 nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54539"
FT                   /db_xref="GOA:A7I478"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A7I478"
FT                   /protein_id="ABS54539.1"
FT                   /translation="MTTILVNQDLCTRCGICAIVCPMGIVSPAGENTLPKVPDEKAGAC
FT                   IRCGHCEIHCPSQALLLNCLIDEKGTLPAGAGAISKEDLGPYLKKRRSVRHFTKELVPQ
FT                   ETVAGILDVARYAASGGNGQPVGWLVILDPKKVHRLAGLVVDWMRTLENSSHPMSGYVP
FT                   GLIAAWDAGMDPVCRGAPHLVVAHIPEGNPIAPVDAIIALTHFDIAAPAFGVGACWAGF
FT                   FSMAARSYEPLKEALALPPGREYSYSLFFGYPQYKTYGIPRRNPVLVEWR"
FT   gene            12008..12793
FT                   /locus_tag="Mboo_0016"
FT   CDS_pept        12008..12793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0016"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sfu:Sfum_2098 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54540"
FT                   /db_xref="GOA:A7I479"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A7I479"
FT                   /protein_id="ABS54540.1"
FT                   /translation="MTDYATIGRKKLEEIDGKAGVAVEERLNAICPDLARYLIEYSFGE
FT                   IYAREGLDNRTKEQAVVAALTAMGTAAPQLKVHIHAALHVGCTPEEIREIIIQMVGYAG
FT                   FPATLNAMGTLMVVLSETGQNLPKDSVHAGSTGRYNRGRELLARIAPDQERVLKETFDP
FT                   INPDITRYVVEFGYGDIYARGILPIRNRQVATIAALAAKGTAPSQLRFHIGGGLRAGLS
FT                   EAEIVEIMLLVSIYAGFPAALNGILATRDVAEALKDEQR"
FT   gene            12825..13409
FT                   /locus_tag="Mboo_0017"
FT   CDS_pept        12825..13409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0017"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mma:MM1582 iron-sulfur flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54541"
FT                   /db_xref="GOA:A7I480"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I480"
FT                   /protein_id="ABS54541.1"
FT                   /translation="MAKVVAFNGSPRKDGNTSILIGHIFAELETEGITTELVQVGKKKI
FT                   RGCTACMKCFEKKDGHCVFDDDIVNTCIDKMVDADGVILGSPVYFLDVTAEMKGLIDRA
FT                   GFVSMANGGLYRRRVGMAVAAVRRSGGSRTIDTLLHFLLAGGMVVPGFPVIGVGREIGD
FT                   VNRDEEGIGRARDAGKNMAWLIKTMEKAKES"
FT   gene            13488..14174
FT                   /locus_tag="Mboo_0018"
FT   CDS_pept        13488..14174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0018"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   gme:Gmet_1442 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54542"
FT                   /db_xref="GOA:A7I481"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I481"
FT                   /protein_id="ABS54542.1"
FT                   /translation="MTNVIAVNGSPRKKWNTATLLEHTLEGAKSLGAQTELVHLYDLEY
FT                   KGCTSCFACKLKGGKSYGECAMKDDLSPVLDRIQDADVLILGSPIYFGLVTGEMRSFME
FT                   RLLFPNLTYTRPPQSLARKNLPTAFVYTMNVSEQIMKEQYCGHIGANAAVLKMIFGQSE
FT                   TLFCNETLQFEDYDKVVFNYFDPEERRERHRTIFPQDCKRAYDLGIRLVQTAKSHSLTT
FT                   IPEKGA"
FT   gene            14181..14771
FT                   /locus_tag="Mboo_0019"
FT   CDS_pept        14181..14771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0019"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: swo:Swol_2164
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54543"
FT                   /db_xref="GOA:A7I482"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A7I482"
FT                   /protein_id="ABS54543.1"
FT                   /translation="MEVFEAIHARRAVRKYLPDPVPKLEILRILDAANWAPSAMNRQQW
FT                   EFVVVTSRDTIREMGENYRAIVEEFTRNWDPSPLRGSLSREEFIRYAESYGNAPVVIVI
FT                   LTDAADSDDLRKANLESASAAMENLLLAATARGFGTCWMTGPLRGEKTLRRILSIPDTK
FT                   EIVAVTPLGFPAGDPAIQPRLDPELMQKVRWVG"
FT   gene            14815..15018
FT                   /locus_tag="Mboo_0020"
FT   CDS_pept        14815..15018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0020"
FT                   /product="YHS domain protein"
FT                   /note="PFAM: YHS domain protein; KEGG: mtp:Mthe_0904 YHS
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54544"
FT                   /db_xref="GOA:A7I483"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:A7I483"
FT                   /protein_id="ABS54544.1"
FT                   /translation="MIPQRRTIMATDPVCYMVVDEEDAQYKSTYRDAEYYFCCAYCKKQ
FT                   FDADPKRYSRIVPDMNIDSVSC"
FT   gene            15018..15443
FT                   /locus_tag="Mboo_0021"
FT   CDS_pept        15018..15443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0021"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; KEGG: ppr:PBPRB1807
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54545"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A7I484"
FT                   /protein_id="ABS54545.1"
FT                   /translation="MPSATGSATIAETLEADGRFSHFIQSIRAAGLYPVLAGKGPLTVC
FT                   APTDAAFGLLPRETLAALTGDPQGRLLRVLQYHILYGNLPCSTIKKLNFPKTRLGITVE
FT                   ITEKDGVVLFGGAPVNVPNIACTNGMIHGIGRVVIPR"
FT   gene            15560..17785
FT                   /locus_tag="Mboo_0022"
FT   CDS_pept        15560..17785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0022"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein; KEGG: mac:MA1665 ribonucleotide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54546"
FT                   /db_xref="GOA:A7I485"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:A7I485"
FT                   /protein_id="ABS54546.1"
FT                   /translation="MNPPSVVDSILSARYLRKGEKDFTDICRRVASALADDENERARFY
FT                   EAMISLRFLPNSPTLMNAGTEIGQLSACFTLPVPDTIDGIFDAMKEGAIIHKTGGGTGY
FT                   NFSHIRPEGSPVQSTDGVASGPISFMRVFNAATDVIKQGGRRRGANMGILNVWHPDILA
FT                   FISAKKKEGEFSNFNISVMVNDKFMDLVAAKSFETVWLTKGGTGEKITVGQIWNGIVEG
FT                   IWKNGEPGILFYDEINRHNPTPQLGEIDTTNPCGEQPLLPYESCVLGSINLAACVREGA
FT                   FDEDLLRDTSRMATRFLDLVIEKNVFPIPQIAEATRKTRKIGLGVMGVHDAMLMLGLSY
FT                   DSEKGRAWCEWVMKVITETAIEESHRLAEKLGTFPAWQGSIWKDYEVRNAAMTTVAPTG
FT                   TISLLAGCSSGIEPIFSFAYTRKNTVGKVFVIVNPVFKEALLHTLTGMGYAGDEREKKA
FT                   GEVISHVHETGSMQDVAWLSAEFRGLFKTALDIPWREHILMQACFQKYVHASISKTINM
FT                   PGSATKDDCAEALLMAWKLGLKGITIYRTGSREDVVLALKEKEKAPASAPAPATVAASP
FT                   MRTVPEKIPSLSIDRPKELAGRTYLCQSGCCRLYVTVNLLDSKPMEVFIRTVGNGGCDA
FT                   NSSALGRAISTGLQNGVPYGKFVKQFAKVNCISAIKNPSSEGHSCADVVGRCIELSAKN
FT                   QSVATLSDWNITKTSEKRLCPECHEPLDFGEGCNQGICKHCGWSGCS"
FT   gene            complement(17997..20057)
FT                   /locus_tag="Mboo_0023"
FT   CDS_pept        complement(17997..20057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0023"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mta:Moth_0418 V-type H(+)-translocating
FT                   pyrophosphatase; TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H+ pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54547"
FT                   /db_xref="GOA:A7I486"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A7I486"
FT                   /protein_id="ABS54547.1"
FT                   /translation="MIETALVVVIVICLIALILAALLARNLLSQDEGTPKMREVSDAIK
FT                   VGAEAFIKRQYSTIAIIAIILAVVIFVVYYFTGQQSLAVYTAVSYIIGATCSAVAGVVA
FT                   MSIAVRTNIRTAAAAQHSDGKALDYSFRGGAISGLIITSMSLLGVSLTYIALGANPQTT
FT                   PFVILGFGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDDVRNPATIADLVG
FT                   DNVGDCAGRGADLFESTAAENIGAMILGVALFPVFGVNGVLFPIVMCSLGLLASMIGIL
FT                   TVKGKDGADPMDALNRGYYITAIISAVFLFFGVQWLLGAATGWLYFFYAGLVGIVLSVC
FT                   FLRVTLYYTDHHYRPVKEIADASETGAATNIITGFSVGLETTAIPAILIAISLLLSYWF
FT                   GSMTGIESGGLYGTAVATVGMLMVCAYVLAMDTFGPIADNAGGIVEMSGAPEEVRKRMD
FT                   SLDAAGNTTKALTKGYAIGSASLAVFLLFNAYMADISKLTAKAFDVVNLASVPVFVGAL
FT                   LGAMLVFLFASFAIRAVSKTAQSVIEAVRIQFKNPGIMAGTQKPDYAAVIDITTQGALR
FT                   NMVLPGVLVIGFPIFIGVTMRHEALAGFLMVATITGILLALILNNSGGAWDNAKKFIES
FT                   GAHGGKKSEAHKAAVIGDTLGDPFKDTAGPSLHVLIKLLATLSLVLAPLFI"
FT   sig_peptide     complement(19968..20057)
FT                   /locus_tag="Mboo_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.823 at
FT                   residue 30"
FT   gene            20562..22469
FT                   /locus_tag="Mboo_0024"
FT   CDS_pept        20562..22469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0024"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mhu:Mhun_1741 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54548"
FT                   /db_xref="GOA:A7I487"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A7I487"
FT                   /protein_id="ABS54548.1"
FT                   /translation="MQFLLFLILFPLISALFMLAVRRDTERVWIVKLSALAIGVVTVLL
FT                   LVTQVGQGTLYFGFNAEPVSLLMFVLEMVISVIILWYAVQFRNYLVIALTLVETALIIW
FT                   FESAATPAVVVKSPLFLDPFSIIMALIIGIIGSLICVYSLGYMRHFYQHHTEIPDRTNT
FT                   FFIIIFVFLSAMFGLVFSNSLIWVFFFWEVTTLCSFLLIGFTRTEEATKNAFTALWMNL
FT                   LGGIAFAGAIVYLTYQPAGMLGLDQVLVSGKALVLIPAALIGFAGLTKAAQMPFSSWLV
FT                   GAMVAPTPVSALLHSSTMVKAGVYILVRFAPVFTGTAVGYTLAFVGGFTFLIASGIAIS
FT                   QTNAKRVLAYSTIANLGLVVACAGIGTYEAIWAAILLIVFHAISKSLMFLSVGTVEHRI
FT                   RSREIEDMNGLIVRMPRIAAMMTIGIAGMFLAPFGMLISKWAAIQAFIDAPFGLVFVVI
FT                   LAFGSALTLFFWAKWMGRLLAITPDAENVEGLVDKNEWIALVSLAGLTVVTCFIFPLIS
FT                   AYLIEPFLLANYGTVAGLAQDNIIIMIMMLFLIVLLPLSILLPHKKARTLPPYMGGVET
FT                   THDMHFQNALGARTEMKLSNYYVGSWFGEARLAMTGICLCSVFIVLMFAAAFIGGGAFL
FT                   "
FT   gene            22466..23323
FT                   /locus_tag="Mboo_0025"
FT   CDS_pept        22466..23323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0025"
FT                   /product="respiratory-chain NADH dehydrogenase, subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: mhu:Mhun_1742 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54549"
FT                   /db_xref="GOA:A7I488"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A7I488"
FT                   /protein_id="ABS54549.1"
FT                   /translation="MISLAWAAAFILLAPAIGGLIAGIDRKVTAHMQGRVGPSIFQPFY
FT                   DVGKLFEKEGAMVNETQRFYVLSYFVFAVFAGAIFFAGGNLLLVIFGLTLAEIFLVLGA
FT                   YSANSPYSHVGAERELIQIMAYEPMLLLTAVGMYVVTRSFDAIDIAGFPTLLVLLLPGV
FT                   FLGFVYILTIKLRKSPFDISTSHHAHQEIVKGVTTEFSGPNLGFIEVAHWYEVVLMLAF
FT                   VFLFFAANWILGIIAIIIVYLLELAIDNTNARVKWQLAVKSSWTIALVLGALNIAVLYL
FT                   IGRA"
FT   sig_peptide     22466..22534
FT                   /locus_tag="Mboo_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.808 at
FT                   residue 23"
FT   gene            23328..23819
FT                   /locus_tag="Mboo_0026"
FT   CDS_pept        23328..23819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0026"
FT                   /product="NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit; KEGG: mhu:Mhun_1743 NADH ubiquinone
FT                   oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54550"
FT                   /db_xref="GOA:A7I489"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:A7I489"
FT                   /protein_id="ABS54550.1"
FT                   /translation="MAYLQKSPWIIHYDASSCNGCDIEILACLTPMYDVERFGIINTGN
FT                   PKHADIFVVTGSVNEQNKYVIRNIYDQMPDPKVVVAIGICATSGGIFRECYNVAGGIDT
FT                   IIPVDVYVPGCAARPESIIDGIVKALGVLEAKKAAMATGAPAKVPASAVAAEKQPAGGT
FT                   "
FT   gene            23820..24188
FT                   /locus_tag="Mboo_0027"
FT   CDS_pept        23820..24188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0027"
FT                   /product="NADH dehydrogenase (ubiquinone), 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 30 kDa
FT                   subunit; KEGG: mhu:Mhun_1744 Ech hydrogenase, subunit EchD,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54551"
FT                   /db_xref="GOA:A7I490"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A7I490"
FT                   /protein_id="ABS54551.1"
FT                   /translation="MVLDQQTTIPISIDELVARTAQLKNDGCRLVQIGCTQVGDDFEIN
FT                   YVFDKDFVLTNLRITVKQDTIIPSVSGVFFGAFVYENEIHDLYGITVKGMNIDFNGHFY
FT                   RTTVKHPFTVTVTKGGEE"
FT   gene            24188..25267
FT                   /locus_tag="Mboo_0028"
FT   CDS_pept        24188..25267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0028"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: mhu:Mhun_1745 NADH-ubiquinone oxidoreductase, chain
FT                   49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54552"
FT                   /db_xref="GOA:A7I491"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A7I491"
FT                   /protein_id="ABS54552.1"
FT                   /translation="MSKQITVPFGPQHPVLPEPIHLDLVLEDERVVDVIPSIGYVHRGL
FT                   EKLVEKREYPEYIYVAERICGICSYIHSNTYAECVEHIMKIEVPERAQYLRTIWTEYSR
FT                   LHSHLLWLGLFADGMGFESVFMNAWKLREHILDDLEATTGGRVIQGVCKIGGVRRDIAP
FT                   EKLDEMVKGLRAMEPAIRDLTNVFLNDASVSHRLKGVGILQKGDAYTLGAVGPTARGSG
FT                   IGIDLRQTGYAAFGKINFKPVVEQSGDCYARCAVRAKELFTSIDIVEQCVKKIPEGPVE
FT                   VKVTGAPDGEYFARAEQPRGEVVHYIKGNGKRNLVRHRVRTPTFTNIPPLVTLLKGCEL
FT                   ADVPMIVLSIDPCVGCAER"
FT   gene            25274..25672
FT                   /locus_tag="Mboo_0029"
FT   CDS_pept        25274..25672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0029"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1746 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54553"
FT                   /db_xref="GOA:A7I492"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I492"
FT                   /protein_id="ABS54553.1"
FT                   /translation="MSYFENTKTVLKSLFSRPATLMYPAKPAKKAALTRGHVTIVPEKC
FT                   IACRTCQRKCPTQAIIVDVKEKTWQIDRLRCIVCNCCVETCPTKCLAMDTQYYESMTAR
FT                   GGIMKVTVAGPKKKEPAPEGAKPPEKKE"
FT   gene            complement(25697..26248)
FT                   /locus_tag="Mboo_0030"
FT   CDS_pept        complement(25697..26248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54554"
FT                   /db_xref="UniProtKB/TrEMBL:A7I493"
FT                   /protein_id="ABS54554.1"
FT                   /translation="MAEITNRKDCSSEEINTLKQFLEPRAPQLVQFIEAGAVVSKGLIT
FT                   SREMLAKTNTEWYNLGGVRSRREYGSKFFRIDQVMTMLKNPQCNDVAHRDRIQELMQEI
FT                   PTNNFKYTITFFEKNNELFIYDGNHSAVAFFEYFSKCGSDNVNIEVFIITDTTKLRIFL
FT                   IRCYNFFWYTLKNKKFQLRW"
FT   gene            26985..27362
FT                   /locus_tag="Mboo_0031"
FT   CDS_pept        26985..27362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0031"
FT                   /product="Large-conductance mechanosensitive channel-like
FT                   protein"
FT                   /note="KEGG: mhu:Mhun_0035 large conductance
FT                   mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54555"
FT                   /db_xref="GOA:A7I494"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:A7I494"
FT                   /protein_id="ABS54555.1"
FT                   /translation="MDRQKIEKEEKILKDDIALAEKDAMGFKEEFLLFLKQYQVIGLAV
FT                   AFVIGTAATAMVNALVKDIIMPVVSVLTPGGQWQTAVLAVGPINLLAGDFLSAVLDFLI
FT                   IALVVFFLVKYVMKGDVTKKV"
FT   gene            complement(27388..27843)
FT                   /locus_tag="Mboo_0032"
FT   CDS_pept        complement(27388..27843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54556"
FT                   /db_xref="UniProtKB/TrEMBL:A7I495"
FT                   /protein_id="ABS54556.1"
FT                   /translation="MPHGKNEFSNERPERQETLIRFMEISENTKPGDRVAALEQKTDEM
FT                   EALLKGLMAEMLDFKAIAMKLAQQNDAQARQEPARGHIVQGTIHATPETPDTDSGDSGE
FT                   THTVIIQHSSSKPEVPAAPPEPEMVRIMQPDGTMKMEVRRGDKGLHR"
FT   gene            28158..28325
FT                   /locus_tag="Mboo_0033"
FT   CDS_pept        28158..28325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2365 DNA-directed RNA polymerase I,
FT                   II, and III, 7.3 kDa polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54557"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:A7I496"
FT                   /protein_id="ABS54557.1"
FT                   /translation="MERRGFGGPRNFGPREMTKAVCSDCGKECEVPFKPTEGRPVYCRD
FT                   CLPKHQKPRF"
FT   gene            28486..30906
FT                   /locus_tag="Mboo_0034"
FT   CDS_pept        28486..30906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0034"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="KEGG: mac:MA3408 pyruvate water dikinase; TIGRFAM:
FT                   phosphoenolpyruvate synthase; PFAM: PEP-utilizing enzyme;
FT                   pyruvate phosphate dikinase, PEP/pyruvate-binding;
FT                   PEP-utilising enzyme, mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54558"
FT                   /db_xref="GOA:A7I497"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7I497"
FT                   /protein_id="ABS54558.1"
FT                   /translation="MSGAKYIRWFEEIRNEDVASVGGKNASLGEMYQDLTKVGVKIPNG
FT                   FAITADAYWRVVKTGNVLGQLKTTLADLDKTSVTNLEGRGKQARDLILGAGIPDDIWNE
FT                   ISAAYDTLCEEYGPDTDVAVRSSATAEDLPTASFAGQQETYLNIRGYPALREACSKCFA
FT                   SLFTDRAISYRIDQNFDHFRVALSIGVMKMVRSDLASSGVIFTLDTETGFREVVFITGS
FT                   YGLGENIVQGAVNPDEFYVFKPTVRTGHRAIIRKNLGDKKIKMIYGQGTSKVLTRNVEV
FT                   PESDGRRFCITDDEILELAQFAIKIEDHYSGKARQTVPMDIEWAKDGITGELFIVQARP
FT                   ETVHSQEAMDILVTYHLEKRGPVLATGKGVGEKIATGRVRVIADVSRLGEFRPGEILVA
FT                   DTTNPDWEPVMKTAAAIITNRGGRTCHAAIVSRELGVAAVVGTNDATEKIKTGQNVTVN
FT                   CSEGDEGVVYDGILQFHVEKVSLKDLRRPKTKIMMNLGEPDQAFALSMIPNDGIGLARM
FT                   EFVINNYIKIHPMALVHPEKVTDETVKAKIAGLTYGYASPEDYFVGKLSQGIGTIAAAF
FT                   YPKPVVVRMSDFKTNEYADLLGGKSFEPEESNPMLGFRGASRYYDEKYREGFALECRAM
FT                   KQVLEEMGLTNLVIMIPFCRTVDEGEKVLAEMAKNGLVRGKNGLSVYVMCEIPNNILLI
FT                   DEFSRLFDGFSIGSNDLTQLTLGVDRDSVVVAHDFDERDPGVMKFISLAVQGAKRNGRH
FT                   SGLCGQAPSDYPEFAEFLVREGIESISLNPDSVMKITQKVVALEERLAGRKTT"
FT   gene            complement(30951..32348)
FT                   /locus_tag="Mboo_0035"
FT   CDS_pept        complement(30951..32348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0035"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; metallophosphoesterase; DNA polymerase
FT                   epsilon subunit B; KEGG: mhu:Mhun_2412 DNA-directed DNA
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54559"
FT                   /db_xref="GOA:A7I498"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A7I498"
FT                   /protein_id="ABS54559.1"
FT                   /translation="MLDAQEIAIRFLDTRLQVHPDVVRYIQEQDNPDLIERIIAGVPAD
FT                   TVVVSAKHIPGMNATRDGMRFLTDPTVEIVSGGPGTSGSINSSADYLHYFRDRYSKLGG
FT                   MIRNRCSSMPIEGLTRSPRYRQEECTVIGMVSEVKTTTNGHRIAEIEDSTANLSVLFRK
FT                   DRPVFADAERLIPDEVIGVKGKLSTDGRLFFAEQMFRPDIRIDNKPYLSDKPGKAVFIS
FT                   DVHVGSNTFLEDSWLRFVDWIGESGASYLLIAGDLVDGIGVFPGQDQELTIKNIYEQYD
FT                   AFGEMISGIPHRIKIIVAPGNHDVVRGAEPQPVIPEQFTRKFPENCMLVENPALVNLQG
FT                   VRVLMYHGRSIDDMIGLIPGASYEQSGKMMEEMLQRRHLAPAYGRRTPIAAGKSDHLII
FT                   DPLPEILHTGHVHITGLTQYRGVLGINAGTWQSQTAFQKQMNVNPTPAQAVMVDLQTLV
FT                   PETFTFL"
FT   gene            32459..33088
FT                   /locus_tag="Mboo_0036"
FT   CDS_pept        32459..33088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0036"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mtp:Mthe_1638 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54560"
FT                   /db_xref="GOA:A7I499"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7I499"
FT                   /protein_id="ABS54560.1"
FT                   /translation="MLDTLQMFLFAFVVGLTGALAPGPTLVATINASVAGGWTVGPRVT
FT                   FGHMLSELIIVILIISGLSTVALRYTTAVAVIGGVALIAFGLLTLAGSRHVSLAGNRST
FT                   EATVTSSPFFAGFVTSVANPHFWIWWLTVGGAMVIAGLAGGIFLACVFMAGHWCADLGW
FT                   YTVVSTGIAKGRTILTDTAYRWIMTACGIFLVIFGAYYLVHLVIPA"
FT   sig_peptide     32459..32542
FT                   /locus_tag="Mboo_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.857 at
FT                   residue 28"
FT   gene            33146..34111
FT                   /locus_tag="Mboo_0037"
FT   CDS_pept        33146..34111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2411 peptidase S26B, signal
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54561"
FT                   /db_xref="GOA:A7I4A0"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A0"
FT                   /protein_id="ABS54561.1"
FT                   /translation="MADNQDPQGIRAQIQAFRTSDHWAVSLARDILWVVAVVGCIALAL
FT                   YLICGTWPAVVTVESGSMEPHMNIGDLVVVVAPDRFGPLQTWDEAHATGYQKFGDYGDV
FT                   IIYRPNGQTDFWAQIGLLPLSSQHPIIHRAMTWVDAGSPEPTYINPYGGEATPLRYTPI
FT                   TVSNTTTYGYYILYPQDNATALQNLSASAQGMGFGDAAGTKYFLPQQYITNGSGFVMYG
FT                   DATTHGGYITKGDNNPVSDEGYITVDNQAIEPVEKQWVVGKALFTVPYVGLLPLHIWWV
FT                   IIIVIIGMVAWDWYAKKKEEGPAKKGGKQKAAGKGSRKNK"
FT   gene            34139..35227
FT                   /locus_tag="Mboo_0038"
FT   CDS_pept        34139..35227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0038"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mhu:Mhun_2410 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54562"
FT                   /db_xref="GOA:A7I4A1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A1"
FT                   /protein_id="ABS54562.1"
FT                   /translation="MAPALIPLLNDCLAGHRLTPEEGEILMKATGRDIFRITAAADELR
FT                   EKKVGDIVTYVRNQNLHVTNICKNLCGFCGFGKKATDPGAYCLDRDTIQAGVRLAEKRK
FT                   VTEICFLSGVHPGFGLENYTDLIAAVHEIAPEIHIHAFSPDEVAHAAKRGKLTTAEVLA
FT                   ALRDAGLGSLQGTAAEILIEPVRKVICPRKVSGQEWARIIKEAHKLGIRSSATIMYGSY
FT                   ESARDQVDHLAIIREIQDETHGFTEFIPMSYIHPNTPLFTEGIARAGATGREDLLMIAV
FT                   SRLFLDNFDNVQVSWGKLGLKMTQLALLCGGNDLAGTMFTDEVSVDAGAGDASYLAPET
FT                   MERMTSDLGRTLRQRTTLYELV"
FT   gene            complement(35295..35594)
FT                   /locus_tag="Mboo_0039"
FT   CDS_pept        complement(35295..35594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtp:Mthe_0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54563"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A2"
FT                   /protein_id="ABS54563.1"
FT                   /translation="MEKVTVQLAHKVAEGYVIPLGPANLVAIITDVGLVGCGAFDVAAL
FT                   DSFSYPAAKVRPATGPSIVNTTDILTGIVKETNRAAMSRGIKNGMTGRQALEQL"
FT   gene            35710..36798
FT                   /locus_tag="Mboo_0040"
FT   CDS_pept        35710..36798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0040"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54564"
FT                   /db_xref="GOA:A7I4A3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019940"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A3"
FT                   /protein_id="ABS54564.1"
FT                   /translation="MDRDRATLLSGAVEGDRISEKDALRLFSTRDRDVWKIAAAADEKR
FT                   EQVVGDAVTYVRNQNINVTNLCVNACGFCGFGKKPGDEGIYFHDEAVIREKAALAKSRN
FT                   VTEICTVSGLHPAFTAQSYIDVYRWIGEAAPGVHLHASNPMEVAYAARKSGMSTKEVLA
FT                   AMKDAGLASMCGTASEILVDSVREKICAQKIPTAEWVRIIREAHQLAIPTTATIMYGHC
FT                   ETDADRVRHLAILREIQDETKGFTEFVPLSFIHMNTPIFRNGTARAGATGREDLLMVAV
FT                   ARLFLDNFANIQVSWVKEGIKMAQLGLLAGANDLGGTMFEESISKGAGATNTDYLDPAE
FT                   MQRVAEDLGRTLCRRTTLYKPV"
FT   gene            36864..37322
FT                   /locus_tag="Mboo_0041"
FT   CDS_pept        36864..37322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0041"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: pca:Pcar_0166 nitroimidazole resistance
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54565"
FT                   /db_xref="GOA:A7I4A4"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A4"
FT                   /protein_id="ABS54565.1"
FT                   /translation="MRRKDREITDRGAMEAILTSAEVCRIGLADGGEPYVVPVCFAYRD
FT                   NAIYFHSAQAGKKMEMLLKNPRCCVEVDHSTGPIPDKNPCSWEMRYRSVICTGTAKNLT
FT                   WYEEKREAMNAILRHYGIPDHPFTEKELEKVCLVKISLDGMTAKQHGY"
FT   gene            complement(37349..37789)
FT                   /locus_tag="Mboo_0042"
FT   CDS_pept        complement(37349..37789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0042"
FT                   /product="protein of unknown function DUF123"
FT                   /note="PFAM: protein of unknown function DUF123; KEGG:
FT                   mba:Mbar_A0396 endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54566"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A5"
FT                   /protein_id="ABS54566.1"
FT                   /translation="MDKGIYCLVVKNPACTVEVGALGPVSFAAGWHGYIGSALGPGGLV
FT                   RLERHLRLAEHRDKRPKWHIDYLLSDLRFSVAYAMSAPTAERLECRLAALLAQGGTGVD
FT                   RFGCSDCDCPSHLLHWHRDPKKEIIAAFSSLGLTPGTRTRDT"
FT   gene            complement(37782..38384)
FT                   /locus_tag="Mboo_0043"
FT   CDS_pept        complement(37782..38384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0043"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mhu:Mhun_2460 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54567"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A6"
FT                   /protein_id="ABS54567.1"
FT                   /translation="MQVRWIPEQGALANSYIFGTVLVDAGLLPMAIQPFKDTIDTIVLT
FT                   HCHFDHTAHVKEIAHMCKAKVAIHRADAMGLFEDAQSLSMHFGARSPGIAPDIKLNDGD
FT                   TIGGLTVIHTPGHTPGSICLWSEADKVLISGDTVFTDGAFGRYDFPGGSRQALEESLDR
FT                   LSALDVEGLYPGHGEPVDCGGKRHIAAARQLMKGGYG"
FT   gene            38425..39702
FT                   /locus_tag="Mboo_0044"
FT   CDS_pept        38425..39702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0044"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   mhu:Mhun_2459 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54568"
FT                   /db_xref="GOA:A7I4A7"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A7"
FT                   /protein_id="ABS54568.1"
FT                   /translation="MLIRSCSSGIPAVVAEAARAEGMDAERMARRIAAGRIVIPANPAR
FT                   RHRPCAIGQGCTVKVNVNVGTSGSRCEYALEEKKAKAALDNGADAIMDLSTGGDLVAIR
FT                   KKMLALDTTVGTVPVYEAVRRAGNAADVDADLLFKVIREHCKQGVDFLTLHCGVNRQAL
FT                   DALKLDPRLMGVVSRGGTFHCAMMMLRDEENPLFSEFDYLLEILAEHDVTISLGDGMRP
FT                   GCLQDAGKLAKSVEYVTLGTLAQRALAAGVQRMIEGPGHMPYDQVGYNVRMIKEITAHA
FT                   PLYLLGPIVTDIAPGYDHVVAAIGGAEACRNGADFLCMVSPSEHLALPDVEDIIEGTRI
FT                   AKIAAHVGDTVRRHEGYRMEREVQMAEARHDLDWDAQFRLALYGDHAKAIHVRDGDTDT
FT                   CSMCGDLCAIKMVRELFEGAASKKKE"
FT   sig_peptide     38425..38487
FT                   /locus_tag="Mboo_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.897 at
FT                   residue 21"
FT   gene            complement(39752..41386)
FT                   /locus_tag="Mboo_0045"
FT   CDS_pept        complement(39752..41386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54569"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A8"
FT                   /protein_id="ABS54569.1"
FT                   /translation="MYPDQATFRRMVEEEPDLSGAAKETLLTLYDGPLHLRQILERVNL
FT                   PEAAGEQEGHKDRAITESALRKRLELLIGRGILARAGSERTNPYYYIRRPWIFNKYILI
FT                   KCRDKPHEGLLDLTVLLHELSRMGDGENAALPHPRFISAVGERTERSHQIEAAYSAFQK
FT                   ILGNSNAIGDYLEGIYDDIYAGKIPESDIDSMVARNFLRFVATGPVEEREARFFLWYAD
FT                   FFTILNQYQEAYEAFVRGVALAEQQGLALPALLSESRITKGRILLHLNDLTGAKEAYLE
FT                   LLRIRDADPLLRAKGLLGAGEVELLCGDYAPTSSPARFVQALELCGKADPARTNPDVAE
FT                   LRADILRRTGTACRLSGKSDEASGYYDTAEEIYRNGMMRGLVMLLPERAELFRARAFLS
FT                   GPAEAEKACAQAAAAYDEAKTVAQRVRSVNWFAHCLIGECECARVAFQKCKKPFPRDLD
FT                   TKFQNAFEIYCQISSHWGIVQTFLSEALLFHAAPDSFPDRYASTADKLEQAERFSRELG
FT                   LRNELAIIQRIKSGCGQESELHPLIFL"
FT   gene            41557..41910
FT                   /locus_tag="Mboo_0046"
FT   CDS_pept        41557..41910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0046"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   dvu:DVU1995 anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54570"
FT                   /db_xref="GOA:A7I4A9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4A9"
FT                   /protein_id="ABS54570.1"
FT                   /translation="MEISQTVSQGIIIVTPAGWLDTASSEEFLKYCTALPKAPVILDLS
FT                   GLSYVSSIGLRALLQFGKEQRQRGADVVIAGSKGFVHSVLRMSGFDQLFLMYSSAADAI
FT                   QAIAGPATKVPDA"
FT   gene            41975..42478
FT                   /locus_tag="Mboo_0047"
FT   CDS_pept        41975..42478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0047"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54571"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B0"
FT                   /protein_id="ABS54571.1"
FT                   /translation="MARHPNVVFRDIFRQLEKISLFFSNFPAILYSPVRCSLAIVQVIE
FT                   MEIHHEISRGIVIVTFSGWLDTTSAGKFLEYCVLLPPATPIIFDLSRLSFLSRTGLRAL
FT                   LRFRNMRASTGSVVVIAGSRGFVDTALKMNRFNRLFPMYLSVADAIPAIATAAAPIPRV
FT                   WGGA"
FT   gene            42481..43509
FT                   /locus_tag="Mboo_0048"
FT   CDS_pept        42481..43509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0048"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rpe:RPE_3904 putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54572"
FT                   /db_xref="GOA:A7I4B1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B1"
FT                   /protein_id="ABS54572.1"
FT                   /translation="MDHDFHVSAGAIGDNTHIHPLEADEAQGVSQLMHEAYRDTYPEKF
FT                   LYSPSDLLNKTENGELFSAVATDPEGRVIGHGTLRAYPGFPEIGLLGSLVVTPACRNRH
FT                   LGRALARYLTAYGEKRGFFALTAGVFLSSPPSRKTFGGLGYTPSAIILGAYPQEISLVG
FT                   IAERLSQRESLGFCTKLRSSVQYGPQYLPERYREMVDELCRGLGIRYIPGAEEDSGPGP
FT                   TILEEGFSDESRVGRILVRGSGYNFRQAVAQTLWNLRARGAQSIWMHLDAGDPRTPAAA
FT                   MAAEDSGFVFSGILPGKKGLILLHEFSREKISCDQIHLSDPAGSRLLAYIGSQRKPDLQ
FT                   KR"
FT   gene            complement(43523..44047)
FT                   /locus_tag="Mboo_0049"
FT   CDS_pept        complement(43523..44047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0049"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="PFAM: protein of unknown function DUF1697; KEGG:
FT                   ret:RHE_CH01225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54573"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B2"
FT                   /protein_id="ABS54573.1"
FT                   /translation="MTTFVAFLRGINVGGNNLIPKKELAVIGERAGLAGICTYINSGNI
FT                   LFTSNRSEEELAAALEKVLAGTTGKEIRVVIRSAEELDGIVRSNPFPDAIPSQVGVMLV
FT                   TVPVGKDILAEFVIPGREIAAAGKREVYVYYPDGMGRSKLKWPPLLKTGTMRNITTLTN
FT                   LAGLAGEKDGM"
FT   gene            complement(44104..44541)
FT                   /locus_tag="Mboo_0050"
FT   CDS_pept        complement(44104..44541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0050"
FT                   /product="Water Stress and Hypersensitive response"
FT                   /note="SMART: Water Stress and Hypersensitive response;
FT                   KEGG: mhu:Mhun_1540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54574"
FT                   /db_xref="GOA:A7I4B3"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B3"
FT                   /protein_id="ABS54574.1"
FT                   /translation="MPVLSDPVVTLEGVSLRNVSLSSIGLEVAIRVENPNPLGADLQEC
FT                   LFTVIYPNGGADNRIATGNTGGAKIPARGSAVLRVPVSSDNAALIGALAAFVTHGGIEL
FT                   TIKGTAVLKFLMITKPVPFSRTMSVSIGEIADIVTGQNKKE"
FT   gene            44724..46250
FT                   /locus_tag="Mboo_0051"
FT   CDS_pept        44724..46250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54575"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B4"
FT                   /protein_id="ABS54575.1"
FT                   /translation="MNYRFFTIASVMLLLAVVILAGCTSTTGATQAGGTSTSSGNPGPG
FT                   GGNVTSMQNGPPSGMSFNGTAPGGAGPGGQPGPGGNSTTMGNAPSGSAPSGGMGAGGSG
FT                   GPGSNSGASAYTFNGTYTLNGGTATKTGQTYTSATKDVSGVYVTNSGVLTLINPTITTS
FT                   GDSSSNDASSFYGLNAAVLVNQGSTMTIKGGTIASTGSGANGVISTGTGSSATLSDVTI
FT                   TASGGGAHGVMATLGGNITLTDVNIATTGESGAPLATDRGGGVITVTRGTFESTGLRSP
FT                   GIYSTGIISVKDATIDAEPGAAVIEGFNSISLDNTSLSGGSSTSDCVMIYQSMSGDASE
FT                   GTGTFTMNGGSLTATGGPLFFVTNTHGVVNLKGATVTTSGSLIRAAASQWGTTGENGGI
FT                   VTFSADGETLAGNVTADSISSIDVNLENGSTLTGAINPAALTLDATSTWTVTGDSVLTS
FT                   LSDAGGISGTNITNINGNGHMVTYDASLAANSALDGKTYTLSGSGMLKPA"
FT   sig_peptide     44724..44822
FT                   /locus_tag="Mboo_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.618 at
FT                   residue 33"
FT   gene            complement(46377..46769)
FT                   /locus_tag="Mboo_0052"
FT   CDS_pept        complement(46377..46769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0052"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: mhu:Mhun_2474
FT                   phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54576"
FT                   /db_xref="GOA:A7I4B5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B5"
FT                   /protein_id="ABS54576.1"
FT                   /translation="MADVSIICGSASDAAIADKAKKILDEHKITWDYQVISAHRDPDKL
FT                   DAYIKNCPSGIYIAIAGLSAALPGVIASKTDKPVIGVPVSGTLNGLDALLSIVQMPKGV
FT                   PVACVGVDNGDNAAHLAIRILKLAKN"
FT   gene            46826..47956
FT                   /locus_tag="Mboo_0053"
FT   CDS_pept        46826..47956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0053"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   mhu:Mhun_2475 serine--glyoxylate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54577"
FT                   /db_xref="GOA:A7I4B6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B6"
FT                   /protein_id="ABS54577.1"
FT                   /translation="MEKESLLMLPGPVPMPERVRFAMSRQAINHRSAEFGAVYADCVRV
FT                   LKTTFGTTNDVFVISGSGTAGMEAAVANFGRDKEIACFVNGKFGERLYKISQRYGKAHE
FT                   IKSEWGTPLDLAALEAQLEAGAQVVTLVHNETSAGIKNPAAEIGKLARKHDALFVMDGI
FT                   TSVGGDLVETDKWGVDVAIVGSQKCLAAPAGLAAVSVSARAWERLTKNPPYYLDLAAYK
FT                   KSAAGKPMETPYTPAVPLFLALREACLIVEEEGLANRIARHQKMAKAVRAAAQAWGLSL
FT                   FPKLDAKHEYATTVTAVSYPDGISDDAVRATIKKLGITIAGGQDHLKGKIFRIGTMGAV
FT                   SAPEILATLAATQHGLVKAGYKIKGNGVEAAAEVLE"
FT   gene            47953..48414
FT                   /locus_tag="Mboo_0054"
FT   CDS_pept        47953..48414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0054"
FT                   /product="riboflavin synthase"
FT                   /note="TIGRFAM: riboflavin synthase; PFAM:
FT                   6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   mhu:Mhun_2476 riboflavin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54578"
FT                   /db_xref="GOA:A7I4B7"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B7"
FT                   /protein_id="ABS54578.1"
FT                   /translation="MKVGVADTTFSRVNMGAIAIDELKKHASVAIERVTVPGMKDLPVA
FT                   CKKLIEERRCDIVMALGMPGGKEKDKTCAHEASQGLIMCQLMTNHHIIEVFVHEDEAKD
FT                   DAELAWLAEQRTREHAVNAVKLVLHPEALTKDAGTGQRQGFSDAGPARR"
FT   gene            48459..48878
FT                   /locus_tag="Mboo_0055"
FT   CDS_pept        48459..48878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0055"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   mhu:Mhun_2477 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54579"
FT                   /db_xref="GOA:A7I4B8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B8"
FT                   /protein_id="ABS54579.1"
FT                   /translation="MCDTKPIKLGFVVAEFNRDITYMMEIEAREHAAFLGAEVTECLYV
FT                   PGAFDMPLAIKKMLAAGKVDAVVTVGCVIEGATQHDEIVVQHAARKIIDLSLEFGKPVT
FT                   LGISGPGMSRLEANERIDYAKRAVESAVKLVKRLQ"
FT   gene            48875..50014
FT                   /locus_tag="Mboo_0056"
FT   CDS_pept        48875..50014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0056"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mhu:Mhun_2478 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54580"
FT                   /db_xref="GOA:A7I4B9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4B9"
FT                   /protein_id="ABS54580.1"
FT                   /translation="MKQLSEKVAAIAPSATIEISNKAKKMQREGIDVISLSIGEPDFDT
FT                   PKHITDACIDALKRGETHYAPSDGIPELLSAISEKIAKENRFACAPDQVIVTCGAKDAI
FT                   YEGMEAVLNPGDEVLLLTPAWVSYEPCVQMAGGKIVKHAVNQESFQLDDSLLEKVNKKT
FT                   KMIVVNSPSNPSGAVFDKKSMKLAADLCEDHDLYAMSDEIYEKLIYGKEHISLASLGDM
FT                   AQRTITINGFSKAYAMTGWRLGYAIAPKPIIKAMSKVQQHSVSQATTFSMWGAVAALKG
FT                   DQRCVEEMRTEFDKRRQYIIKELGHMGYICAPADGAFYAFIKVAGDDMKIATDWLEKAH
FT                   VAATPGSSFDAPGWIRLSYAASLDRLKEAMGRIKKFGGN"
FT   gene            50211..51647
FT                   /locus_tag="Mboo_0057"
FT   CDS_pept        50211..51647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0057"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sai:Saci_2084 conserved membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54581"
FT                   /db_xref="GOA:A7I4C0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C0"
FT                   /protein_id="ABS54581.1"
FT                   /translation="MDTKQKIIIAILMLGTLMGSLDSTIVILAFPTISDSLHAEFVTTL
FT                   WIILIYLLVVAICTTQLGRIGDIYGRSRMFNAGFGIFTVGSLFCGLSPGISWLIASRGV
FT                   QAVGGALMQANSGAIVADTFPPNVRGTAFGYISLGWTSGAMLGIVLGGIITTFVGWEYI
FT                   FFVNIPIGIIATILGFRYLTDNSRVHAELDLVGMLLLGAALTFISYAGVDFATEGTAFA
FT                   NIASLCIGFVILLLFIVFERRTSHPIIDFSALRNRILRYSIMATFFLSLGYLSVVFLIT
FT                   MYLQGIRALSPLDAALLLTPGYVVGSLLSPRMGRLSDKYGARVLATAGTAVLIVATLIY
FT                   LVCGIDTPLWEVLVASGVSGLGTAMFFPSNNSAVMANAPQGSYGGISGILRTMQNIGIL
FT                   GSFVIAITVSAASIPRDVAFEVFIGTTNLVGGVSEAFIKGIDAALWVSIMLIGIAGALS
FT                   WMRGRETRGSAPRPEEKQDT"
FT   gene            complement(51669..52532)
FT                   /locus_tag="Mboo_0058"
FT   CDS_pept        complement(51669..52532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0058"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mbu:Mbur_1090 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54582"
FT                   /db_xref="GOA:A7I4C1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C1"
FT                   /protein_id="ABS54582.1"
FT                   /translation="MAEPALSCEYGDIDWNEVWKARQDQHETARIALDTSHDWDKKENA
FT                   TRYAAQSVGEFETRIRMTLDDLVVNSSTRVLDIGAGPGTLAIPLAPKVKEITAVEPGAG
FT                   MIIALEERAGKEGINNITCVRKTWEEVDPTRDIEGPYDLVIASLSLTMHDIREAIRKMD
FT                   AVSRGEICLYWFVDLPFWERMYADLMIPLHGRPYYSGPKADCLWNVLYQEGIYADVNML
FT                   PLDKEYRFSFREEMSAFFKKRFGVTTPAQERVLENYLSGLARTEGNDVVISGTSTFAKI
FT                   RWKKKS"
FT   gene            complement(52587..53780)
FT                   /locus_tag="Mboo_0059"
FT   CDS_pept        complement(52587..53780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0059"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mhu:Mhun_2932 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54583"
FT                   /db_xref="GOA:A7I4C2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C2"
FT                   /protein_id="ABS54583.1"
FT                   /translation="MSTIFWEISKRNIRIHMLRSSLAMLGIIIGVVAIASMGILGNSIV
FT                   QAVSSSLSSVGDSVIVMPYAGGSGFGGGASSANLMLTEQEYQQIKRAVAPNIAIPVHST
FT                   SEYMTMGVGSDDIVATIYGLPPDQTKDLLPDLTAGDYSNGNSGCLVGATFATDHNVKVG
FT                   SRISVGNDGQYGTLRVTGIIKERGMSFDISTDNSIVVTQDWFESTYNDQYQYNEVVVKV
FT                   ANGDTADVKTTIENQLNRNTREKSVTVIDSKATLATIMDTFGMVTTFVTAIGGISMLVA
FT                   GVSIFNIMMMSVNERIKEIGIMRSIGTQKREVMSMFIYEAAIIGVTGSLIGGALSLLGG
FT                   YAISALMLKTTQYLFTLPTVFSVVEGVGFGIIICILCGLYPAWQAANLNPIDALRHE"
FT   sig_peptide     complement(53637..53780)
FT                   /locus_tag="Mboo_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.766 at
FT                   residue 48"
FT   gene            complement(53777..54475)
FT                   /locus_tag="Mboo_0060"
FT   CDS_pept        complement(53777..54475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0060"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_2931 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54584"
FT                   /db_xref="GOA:A7I4C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C3"
FT                   /protein_id="ABS54584.1"
FT                   /translation="MTPEALPGEDQPVLVFHDVVKVYPLKAGDVTALNHISFAVNRGEF
FT                   ISIMGPSGSGKSTLLNLMGCLDTPTSGDIFIGGIRIGDMSDVELTNLRRDHIGFIFQYF
FT                   NLFPLLNVIENVNFPQMLKSRAKVDEKKAVAVLRAVKLDEHLYVHTPLELSGGQQQRVA
FT                   VARALINDPDILLCDEPTGNLDSKTGASIMELMAELNRNGTTIIVVTHDPRVASYTNRT
FT                   IQIVDGRIES"
FT   gene            complement(54480..55640)
FT                   /locus_tag="Mboo_0061"
FT   CDS_pept        complement(54480..55640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54585"
FT                   /db_xref="GOA:A7I4C4"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C4"
FT                   /protein_id="ABS54585.1"
FT                   /translation="MKILIRLILLTLALLALTGEATALATSAEINAANNVYVSNVTYDP
FT                   GSFFTGDAGTVTVAVTNGNANQSIVANHATFGFDNNFQLTSGSYDTSSTVGPLQTRTYT
FT                   FSVITQSADGSYYPTFSLNIGDATSIYYRGLVKVDNTPIVATLIDKPDAFTPATKNTLS
FT                   LQLANPREDDVKNVIVDVDGGSGADILPATQYIGVLSSGASTVVNFTVTPNVETTLNVT
FT                   VKYDNGDNHHSVDLKIPVAFTTDKMQADPVMSNIVIALTNGTCDVTGDITNAGLSNANG
FT                   VTVTSLSPAIPQEPDRNYVIGTLKPDDFGSFEITFTVPDGTTSVPLQLSYKDSDGNILS
FT                   SVQNIDLTQTTAQPNSQPSMLPVLVVVIIAVIFVGGWYVYLRRHKE"
FT   sig_peptide     complement(55569..55640)
FT                   /locus_tag="Mboo_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.317 at
FT                   residue 24"
FT   gene            complement(55641..56309)
FT                   /locus_tag="Mboo_0062"
FT   CDS_pept        complement(55641..56309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54586"
FT                   /db_xref="GOA:A7I4C5"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C5"
FT                   /protein_id="ABS54586.1"
FT                   /translation="MGINIKDLMINPERFFRQALGEKEELRLPGLIIFLGAAIAAVSGY
FT                   LAGSLSARMMEPVLQGMTPFIMAVAVIAAFFGTFVAWVIWAGVLYLLSRAFKGSGSFSR
FT                   CLEVVGYGFVPQIIGMLVTVIAALVYLPKVIVPPLTSAAMQDPQVIKEATSALMHDPAM
FT                   MAFTEITAVVSIIFLLWSASIWIFGLKQARNLSLKNAAICVMIPVILFIVFQAYSLAGA
FT                   "
FT   gene            56578..57936
FT                   /locus_tag="Mboo_0063"
FT   CDS_pept        56578..57936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0063"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mhu:Mhun_0558 tryptophan synthase, beta
FT                   chain-like; TIGRFAM: pyridoxal-phosphate dependent
FT                   TrpB-like enzyme; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54587"
FT                   /db_xref="GOA:A7I4C6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C6"
FT                   /protein_id="ABS54587.1"
FT                   /translation="MQTKILLDEEQIPKKWYNVQADLPSPLDPPLHPQTHKPVGPADLS
FT                   AIFPMELIRQEVTTDRYVDIPEEVREVFRLYRPSPLYRAHRLEKALKTPAKIYYKWEGV
FT                   SPAGSHKTNTSIPQAYYNMKAGIERIATETGAGQWGSAMSFATMLYDLECTVYMVRSSY
FT                   TQKPYRKSMMQVWGAECIPSPSTKTKSGQAVLAKDPDTPGALGIAISEAVEDAASHSNT
FT                   NYALGSVLNHVCLHQTVIGLECREQLASVDAYPDVVIGCVGGGSNFAGISFPFAGDKLV
FT                   GKHKDVDILGVEPASCPSLTKGLYTYDFGDEAGYTPLMKMFTLGHDFVPPSMHAGGLRY
FT                   HGDSPIVSRLVHDGVMRAVAYHQSEVFEAAQTFARAEGIIVAPETSHAVKGAIDEALAC
FT                   KKTGEEKTILFNCTGHGNFDMSAYDAFYSGNLVDYEYPDRLIKEALGRIPKIA"
FT   gene            57953..59050
FT                   /locus_tag="Mboo_0064"
FT   CDS_pept        57953..59050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0064"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: mtp:Mthe_1276
FT                   ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54588"
FT                   /db_xref="GOA:A7I4C7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011386"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR039065"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C7"
FT                   /protein_id="ABS54588.1"
FT                   /translation="MPVIGFLVNPVAGMGGSVGLKGTDGKANEARLLGAVPRAKNRAGI
FT                   TLALLKNIPDLTFLSSGGEMGKAVLEQCGISRYRVVYAARSESTAEDTQEAVRAFIAQG
FT                   ADLILFCGGDGTARDVFAAAGREVPILGIPAGVKMYSAVFAVDPAAAAGVLAGPYGITD
FT                   GEVVDVDETAYRAGTLATRLYGIARVPARAGMTQPAKQVFEEADEERAKEEIARFIVEV
FT                   MLPDTIYILGAGTTTEAIARRLGIKKTLLGVDAVLDGKIVAADADEKTLLSLTGKYPGA
FT                   RIIVSPIGAQGFILGRGSQQISPAVVQNVGVSQVIVIATPHKLRETPELYVDSGDPKID
FT                   TGFDASVQVISGYRIAQRKKIHRAL"
FT   gene            complement(59086..59676)
FT                   /locus_tag="Mboo_0065"
FT   CDS_pept        complement(59086..59676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0065"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein; KEGG:
FT                   gme:Gmet_1126 GPR1/FUN34/YaaH"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54589"
FT                   /db_xref="GOA:A7I4C8"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C8"
FT                   /protein_id="ABS54589.1"
FT                   /translation="MQTETTQTATAVKNLDMTANPAPLGLLGFGMTTVLLNLHNAGFFA
FT                   LGSMILAMGIFYGGLAQVIAGIEEWKKNNTFGATAFTSYGFFWLTLVALLVLPKLGLAA
FT                   APDGASMAAYLAMWGIFTLVMFVGSLKANRALQLVFGTLTVLFFLLAIGEATGSSTITV
FT                   VAGYEGILCGFLAIYAGLAQVLNEMYKKTVAPL"
FT   gene            complement(59744..61642)
FT                   /locus_tag="Mboo_0066"
FT   CDS_pept        complement(59744..61642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0066"
FT                   /product="acetate--CoA ligase"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: mhu:Mhun_0352 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54590"
FT                   /db_xref="GOA:A7I4C9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4C9"
FT                   /protein_id="ABS54590.1"
FT                   /translation="MKENFDVKLVENAKYYTPDAEYKRSSWIGDYQEAYRRFLADPDAF
FT                   WETIARELEWIRPWDRVCEWTYPYARWFVNAQLNITANCLDRHVAGDRRNKVALIWRGE
FT                   DGKERVYSYQRLLGEVSRFANGLKKLGVKKGDRVCIYMPMVPEQLIAMLACARIGAVHS
FT                   VVFAGFGTSALNLRINDAEAKVVITADISIRRGKAIPLITIVQEAIVHAPSVEHVVIYR
FT                   RRKEPPVELHPGREHDFYGIMEDVPAECPCETMDAEDPLFVLYTSGSTGTPKGVVHTCG
FT                   GYMVGAYYSTKTVFDLKERDIYWCTADPGWITGHTYIVYGPLAVGATVFITEITPDYPD
FT                   PGSWWKLIQEQQISVFYTAPTAIRTFMKVGEDWPNRYNLSSLRIIGSVGEPLNPEAFEW
FT                   YYRVIGKSRCPIVDTWWQTETGMQMITTMVGEPMRPGFVGKPIPGVEVDVTDKNGNPVP
FT                   PGTGGFLVIKRPWPSMLRTVYKNDARYRQYWETISGVYAAGDLAVKGSDGYIMVIGRAD
FT                   DIIIVSGHNIGTAEVESALVSHHAVAEAAVIGKPDAIKGNAIKAFVILRVGNTPSEKLT
FT                   QDLIYHVRMTLGPVAVPHEIEFVDKLPKTRSGKIMRRVLKAKELGMDPGDISTLEE"
FT   gene            61883..62770
FT                   /locus_tag="Mboo_0067"
FT   CDS_pept        61883..62770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0067"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   afu:AF1724 dinitrogenase reductase activating
FT                   glycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54591"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D0"
FT                   /protein_id="ABS54591.1"
FT                   /translation="MLGAAVGDALGMPNESTMPGLTKMRYGFRKAYKGHPNDGLSPGQY
FT                   TDDTQIMILVATLLADGKYNDERYGLALKELYAREVLRFPDGSISAACDHMISGQATSC
FT                   GVKSTTAGCLPASLPFALVYPDIHEATGRAVRACSITHTHPAAHAAVSTFVTLVYSAIH
FT                   GHADPVEKALAQAQNEDEVLGGKIHNAIELEKEGIETDTAILKIGNDVSLYQTLPISFF
FT                   LIRRYQRPADLLTVAAYVGGNTDTIGFLCGAYLGASKGAGAIPADLLEGLEDRQRIEIL
FT                   GQRIFDIYTRKLER"
FT   gene            62879..63865
FT                   /locus_tag="Mboo_0068"
FT   CDS_pept        62879..63865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0068"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: mhu:Mhun_3227
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; oxidoreductase
FT                   domain protein; Semialdehyde dehydrogenase, dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54592"
FT                   /db_xref="GOA:A7I4D1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4D1"
FT                   /protein_id="ABS54592.1"
FT                   /translation="MKVAIVGASGYAGGELVRLLYHHSSAEVTCVTSRSLAGIPLSEVH
FT                   PQLTGFSDLRFENPAPDAIDADVAFLAVPHTAAMTIAGKLLSRGIKVVDLSADYRLPKD
FT                   TFEKVYGVTHTDYFPAPYGIPELHRKECINAKFVANPGCFPTGATLAAAPIASRAHTII
FT                   FDSKTGVSGAGDNPSATTHYPNVGDNVSPYKWTSHRHLAEMKQELSKLGSKAACYFTPH
FT                   LVPVNRGILTTAHILLNEPLETKEVEKLYREYYKDEFFVRYQKPMLSAVRGSNFCDIMV
FT                   ESEGKRVVVVSAIDNLVKGASGQAIQNMNLMCGFKETDGLDAPGLLP"
FT   gene            63883..64359
FT                   /locus_tag="Mboo_0069"
FT   CDS_pept        63883..64359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0069"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mhu:Mhun_3228 putative transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54593"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D2"
FT                   /protein_id="ABS54593.1"
FT                   /translation="MLVSEAMTKNPLTCTVNTPLRDAVAILREHHIGGLPVLDGESLAG
FT                   IITESDILAQLATHKLSDDLWLPSPLEIIEVPIREYINWEKTKDALRNIGDLPVKKVMT
FT                   HPVITATGDMDIEDAAALMLKERIARLPVTDGKKLIGILTRADIVQAVGASRSL"
FT   gene            64402..65559
FT                   /locus_tag="Mboo_0070"
FT   CDS_pept        64402..65559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0070"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.35"
FT                   /note="KEGG: mhu:Mhun_3229 arginine biosynthesis
FT                   bifunctional protein ArgJ; TIGRFAM: arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54594"
FT                   /db_xref="GOA:A7I4D3"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D3"
FT                   /protein_id="ABS54594.1"
FT                   /translation="MAYKSLCAVKGVTANGIKEGKFGLALIRASGTSAGVFTANLARAA
FT                   PIELMRKQIRKGRLEAVIANSGCANAYTGRRGYDDAVSMTEYAGSALGVDTSSVGVAST
FT                   GVIGRYLDLPLIRRQCADVALNLTSSPAAEDLTVKAIMTTDLYPKHALVEKEDFTIGAI
FT                   AKGSGMIAPNMGTMLAFIYTDAEIAAQPLREALRAATRRTFNRVVVDGDTSTNDIALCT
FT                   ATGESGKVNTTEFSAALEACCRSLAQQIAADGEGASKLLEVTVRGAPKEEAAAKVARVV
FT                   IESPLVKTAVYGEDPNWGRVIAAAGRAGVKFDPNAVSLWISDGNEKYPLVKSGEIIADL
FT                   TKAKAAMHGKKVIFILDLGAGKEEATAWGCDLTEKYVEINGRYTT"
FT   gene            65556..66431
FT                   /locus_tag="Mboo_0071"
FT   CDS_pept        65556..66431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0071"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: mhu:Mhun_3230 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54595"
FT                   /db_xref="GOA:A7I4D4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4D4"
FT                   /protein_id="ABS54595.1"
FT                   /translation="MMKREDVLMEALPYIQQFHGKTIVIKLGGHAMVDPEVLENAIKDA
FT                   VLLHYVGIRVVLVHGGGPEITEKMKALGKESVFVGGLRVTDQETLEIAQMVLVGKINKG
FT                   IISLIAKCGAKGVGLSGSDGNIILAKKMDLQKVNVQGVEQEVDLGHVGEIEWIDPSLLT
FT                   TLLDRDYIPVISPIAIDRYGGSLNINADTAAGDIAIALKAYKLINMTDVDGVMDAKRTH
FT                   VFRKLSITEANALLASGAIGEGMIPKVSSVIKAVENGVKYSHIINGNVEHNLILELFTH
FT                   EGVGTMISLQ"
FT   gene            66506..66910
FT                   /locus_tag="Mboo_0072"
FT   CDS_pept        66506..66910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0072"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: gme:Gmet_1779
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54596"
FT                   /db_xref="GOA:A7I4D5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D5"
FT                   /protein_id="ABS54596.1"
FT                   /translation="MDRIIKFVIALLVVIAAASVAYLVFAASPAPSSSSSGVNDSIVYY
FT                   FYGNGCPHCAAVEPFMENMTKKYPDVDIRMLEVWYNQTNQQIDDQVNAEAGITSPPGVP
FT                   EIVIGKTVLVGEVDIPAKLEGYLQAIEKKK"
FT   sig_peptide     66506..66586
FT                   /locus_tag="Mboo_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.784 at
FT                   residue 27"
FT   gene            67132..67992
FT                   /locus_tag="Mboo_0073"
FT   CDS_pept        67132..67992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0073"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: mhu:Mhun_3231 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54597"
FT                   /db_xref="GOA:A7I4D6"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D6"
FT                   /protein_id="ABS54597.1"
FT                   /translation="MDQNLGIASPGVPTIIIGNHTLVGEDQIRDQLEQVILAEQATSGG
FT                   PAQGNLTVAENSPGTFSHLTVPLVIVAAGIDSLNPCAFTVLIILLLSIIALQSRRQVLI
FT                   VGVTYIAAVFLFYFISGIGVLSFVHLSGISSLIALAAAVIAIVLGVVNIIEAAVKKDGF
FT                   FLAIPESKKPVIERYITTATLPAAFVLGVLVGIFELPCTGGIYLTILGLISNTLTFTEG
FT                   IPYLLLYNLIFVLPLIVILLAVVLGIPPERVNTWRLENRRKLRFAIGVAMILVGAFILI
FT                   GPRLL"
FT   gene            complement(68066..68443)
FT                   /locus_tag="Mboo_0074"
FT   CDS_pept        complement(68066..68443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0074"
FT                   /product="Chorismate mutase"
FT                   /note="PFAM: Chorismate mutase; KEGG: nph:NP3980A
FT                   chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54598"
FT                   /db_xref="GOA:A7I4D7"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D7"
FT                   /protein_id="ABS54598.1"
FT                   /translation="MCLPRTEIQTNYCQHVYPFFRRLYFPMTIEEIRAEITQIDEEIIH
FT                   LIARRQSLAGKIAAIKKESGIPVHDNQRKNDVLDYVMKLAKAEHVDPVPIRGIFETLIS
FT                   MNEKAQRAAMDPPATRKSTRK"
FT   gene            68478..69116
FT                   /locus_tag="Mboo_0075"
FT   CDS_pept        68478..69116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0075"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mhu:Mhun_2536 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54599"
FT                   /db_xref="GOA:A7I4D8"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D8"
FT                   /protein_id="ABS54599.1"
FT                   /translation="MLGNITRREEYDLFAAWLAVSLSFAIIKLAPYGVLGPIQPVNPAT
FT                   ALTYLVIALLTAGIGLVLHELAHKFAAIKFGFWAEFHKNNFMLLVAVALAALVGFVFAA
FT                   PGATVIYSTRPDGRTINREENGMISAAGPVTNLVLCIPFAVLIFATAPQSLLYQIGIFG
FT                   VQINAMIAAFNMLPISILDGNKVLSWNIPAFVLLIAASFAVLVSSFYIL"
FT   gene            complement(69145..69753)
FT                   /locus_tag="Mboo_0076"
FT   CDS_pept        complement(69145..69753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0076"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: mhu:Mhun_2732
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54600"
FT                   /db_xref="GOA:A7I4D9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4D9"
FT                   /protein_id="ABS54600.1"
FT                   /translation="MTVKVLGISGSPRRHGNTETLLDSFLEGAKAAGATVEKVVLREID
FT                   YSPCRGCNACHKTGECIVKDDAPGLYDRILATDILAVASPIYSMGITAQLKGFIDRAQY
FT                   LWARKFILKTLTFSEDHIRRHKGVFISTAGQNLDRVFDSAFPAITALFHGTGFDYTENI
FT                   VANNMDAYNGIKNHPTALKEAYEKGQQIVRDLEKTAGSS"
FT   gene            complement(69750..70376)
FT                   /locus_tag="Mboo_0077"
FT   CDS_pept        complement(69750..70376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0077"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mhu:Mhun_2733 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54601"
FT                   /db_xref="GOA:A7I4E0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E0"
FT                   /protein_id="ABS54601.1"
FT                   /translation="MPVKVLAFAGSPRRSGNSETLLDWMLASMAQEKDVTIEKIPLTEA
FT                   DINPCRGCNACEKLNRCIQRDGMDRWHDKIIEADCIVLSSPIFCMGLASQVKALVDRAQ
FT                   VFRSRKYVLKLPVVPPERKGKRLGVFLATAGQTWPHVFDGAVPSVKCFYHVIEIRDADI
FT                   SYLMINGVDEKGAITHHPTAKADAEKLGISVIAELKKRLSEGIIP"
FT   gene            complement(70547..70954)
FT                   /locus_tag="Mboo_0078"
FT   CDS_pept        complement(70547..70954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0078"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mhu:Mhun_2735 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54602"
FT                   /db_xref="GOA:A7I4E1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E1"
FT                   /protein_id="ABS54602.1"
FT                   /translation="MSMVVKKPVAKPVAKKPVAKKTVKELKGLEKKIGKVPKFFKELTT
FT                   NDPGMYDLVIKMEDHIWDDGKLTRKTKKLIAIAIAASLRDQHAVRAQLMGAANLGVTKA
FT                   EVEEALRVSFLLAGMPAYVYGKAQLDEVMKK"
FT   gene            complement(70951..71079)
FT                   /locus_tag="Mboo_0079"
FT   CDS_pept        complement(70951..71079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0079"
FT                   /product="Desulfoferrodoxin Dfx domain protein"
FT                   /note="PFAM: Desulfoferrodoxin Dfx domain protein; KEGG:
FT                   mhu:Mhun_2736 desulfoferrodoxin Fes4 iron-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54603"
FT                   /db_xref="GOA:A7I4E2"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="InterPro:IPR012002"
FT                   /db_xref="InterPro:IPR038094"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E2"
FT                   /protein_id="ABS54603.1"
FT                   /translation="MVNVSTEGQIFKCEICGNVVIVKEAGGGELVCCGEPMILESE"
FT   gene            71569..72174
FT                   /locus_tag="Mboo_0080"
FT   CDS_pept        71569..72174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0080"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mhu:Mhun_2738 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54604"
FT                   /db_xref="GOA:A7I4E3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E3"
FT                   /protein_id="ABS54604.1"
FT                   /translation="MAPTIIGLLGSPLHEGNTAQLMARAVQGARDAGCTVELIPVTSLD
FT                   FQGCQEMFFCRDHETCILDDDMQQVYPKFKGMDGLILATPVMTMGIPGTLKAFMDRFQV
FT                   FFMAKYHRHESFIPRDRKPARAGIFISISGMDIPEVFVGAKLTTRAFFDIIDCRYQDEL
FT                   LVNGMDGILDITTRPDLLDAAYRKGFALGQSLAAPAGK"
FT   gene            complement(72197..72859)
FT                   /locus_tag="Mboo_0081"
FT   CDS_pept        complement(72197..72859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0081"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: mhu:Mhun_2739
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54605"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E4"
FT                   /protein_id="ABS54605.1"
FT                   /translation="MKKMKDLPALDRPREKIAHKGVQALNDAELIEAIIGRGLPGRDVR
FT                   AIARDIVLLLSDPARQVRYEDLLEIDGAGPARAAQIMACLELGRRRYGPSDAVKIRTPE
FT                   DVLPLVGQYRDKPQEHFICISLSGAGEVITSRVITIGILNHSLVHPREVFAGAITDRAA
FT                   SVVCVHNHPSGSLEASPQDIAITRQLQEAGALLGIQLLDHIIVTRTGFSSLKEKGLI"
FT   gene            73044..73547
FT                   /locus_tag="Mboo_0082"
FT   CDS_pept        73044..73547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0082"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: mhu:Mhun_2740 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54606"
FT                   /db_xref="GOA:A7I4E5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E5"
FT                   /protein_id="ABS54606.1"
FT                   /translation="MTTEKNAQEAFAGESQASRKYLAFSEKAAAEGFTTIATLYKAASE
FT                   AETVHAKKLLKVLGAVGPTEKNLEGSIAGETHEYTVMYPGFIKEAEAEKKSEAVLAFTH
FT                   AMKAEEIHAGLYKKALAAIKAGHDLGKEKIYLCPVCGNIEIGKAPDKCPVCGVFGKQFR
FT                   EITL"
FT   gene            complement(73615..74907)
FT                   /locus_tag="Mboo_0083"
FT   CDS_pept        complement(73615..74907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0083"
FT                   /product="LamG domain protein jellyroll fold domain
FT                   protein"
FT                   /note="SMART: LamG domain protein jellyroll fold domain
FT                   protein; KEGG: mbu:Mbur_1976 protein of unknown function
FT                   DUF1628"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54607"
FT                   /db_xref="GOA:A7I4E6"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E6"
FT                   /protein_id="ABS54607.1"
FT                   /translation="MPAVTRRTCFWGIFWCGILVLLLCTAGAAAALDTAAGPVVYLTFN
FT                   EGSGALALDASGHGNTGTIHGNAYRIDNSGCVRALVLSGNGSYVSVPYTPANHPTEAIT
FT                   VSAWFYVNDTSPQTLVSTYADGGGYRLGFDEGNDLWWTLGLDNVRGSASVVIPHEAITP
FT                   GQWHQVTGSYDGQVARIYLDGILKNQINATGTIRYSDSNDILIGANAGPNDLPDPDAPE
FT                   YLNGAIDEVRIYNRSLSYGDEMDDRYACSAATGTGILSLPAPLPPVYLTSGSVSLAPGE
FT                   TATRRLTFTNQSEQGTWQVTVSPGSRLSVDASDAYPDVYTDEWYVELKDQDTRLSRIVA
FT                   FPVTYNAPAAGVIESGNATVLVHYFGGPGRFPASVILTFTSSAAPESPVSTLPKEMLEY
FT                   PIIVFYSASWVTLIALVVVIVWAHRRHTKKE"
FT   sig_peptide     complement(74812..74907)
FT                   /locus_tag="Mboo_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.674 at
FT                   residue 32"
FT   gene            75022..76176
FT                   /locus_tag="Mboo_0084"
FT   CDS_pept        75022..76176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0084"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glutaredoxin; KEGG: mhu:Mhun_3049
FT                   glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54608"
FT                   /db_xref="GOA:A7I4E7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E7"
FT                   /protein_id="ABS54608.1"
FT                   /translation="MMSTVTVYSTKNCPYCRMAKAFLEKYGVPYTAIDVGADTAAAHKM
FT                   IALSGQRGVPVITVDDEVIVGFDSQRLNELFGTHAAGETYDVIIVGAGPGGLTAAVYCA
FT                   RKLLKTLVVSESIGGQALESWAIENYMGYRMITGEDLMKKFEEQVRTLDVRLELDRVNG
FT                   VTMEENLFVVTTVSGLSVKAKSLILTPGKQPRKLGVENEEKYLGRGLSICSTCDGPLFK
FT                   DKKIAVVGGGNSALQTAVEMSSIASSVSLLVRSTIKADPVYAKKLEGLKNITVHLHTQI
FT                   TALAGDPFLQHITIATEGQGEQRIDVDGVFIEVGWTPNTEIFDGLVELNGKKEIVVDVD
FT                   GHTSRPGVFAAGDVTSVKSKQIIIAAGEGAKAALEAYDYLMSLA"
FT   gene            complement(76738..78207)
FT                   /locus_tag="Mboo_0085"
FT   CDS_pept        complement(76738..78207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0085"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein; protein of
FT                   unknown function DUF224, cysteine-rich region domain
FT                   protein; KEGG: mhu:Mhun_3052 succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54609"
FT                   /db_xref="GOA:A7I4E8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E8"
FT                   /protein_id="ABS54609.1"
FT                   /translation="MRELRVTILRFDPKKDPAPHAETYAVNVSEGARVLHVLHAIHDEI
FT                   DPTLSYRYCCGSGQCGSCAVRVNGEPVLACMKEATDGITIAPLNLPVKKDLVVDLLPKI
FT                   AAIASLVPSGEADARLPTKAQIDEIKPLRDCIECLACVSVCPAMTVTEFLGPTAMRQEM
FT                   RLALDPRDTGTRVPDAVRDGLFTCTSCQACYLACPKKIKIPAKAIEKLRALANRQGLTL
FT                   PRHQEVAALIEKTGRSVPQTSESLLEKVSEVIEPYGPVKGTIGFFVGCMYNLRQQQSAL
FT                   DALEVLKRNGIRVIIPKEQICCGSPLIRTGQLSYVDTLRKRNIDTFQSRGIVTVMTMCA
FT                   GCGSTLKHDYVTPFKVMDINEVLVQYGIEPPARLPIRATYHDPCHLMRGQGVKDEPRQL
FT                   IRQAVDLIEMPAICCGSGGGVKSGLPDEAAALGEKRREEIRKTGAEIVITSCPFCEFHI
FT                   ASHSDKPVKNIMTVLLEGYREKDRLAGKKNE"
FT   gene            complement(78204..79832)
FT                   /locus_tag="Mboo_0086"
FT   CDS_pept        complement(78204..79832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0086"
FT                   /product="Succinate dehydrogenase"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: mhu:Mhun_3053
FT                   succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54610"
FT                   /db_xref="GOA:A7I4E9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4E9"
FT                   /protein_id="ABS54610.1"
FT                   /translation="MRADGVVDCHVLVIGSGGAGVRAAIGAARYGTTLLLSKTLAGKGG
FT                   CTPMAEGGYNAVLREADSCEIHYEDTLRGGAFLNEPELVRILVQESPERVNELVGWGAV
FT                   FDFTNECEIAQRPFGGQRFPRTCYAGDRTGHEMMMTLMERFDSSGATKMEEVTAIDLLK
FT                   ESGRVIGAFALDENGDEVIITADSTILATGGGSRVYDISTNSSSGTGDGFAMGYRAGAE
FT                   LIDMEMVQFHPTGAVYPYDARGRLITEAVRGEGGILKNSLGERFMKRYDPVRMELSTRD
FT                   VVARAIATEIAAGRSTPHGGVYLDVTHLPKEQIETRLPLMLEQFLTYGVDIRTQPMEVA
FT                   PTAHHIMGGIRITPKCATTVPGLFACGETAGGVQGANRLGGNALAETQVFGKRAGEAAG
FT                   QGERRVKKIDPAQLAEIRARTEGFLSGTKNPAHVRKELQKTMWQDAGIFRDEAGLKRAL
FT                   ATAEHLLTAPIRAASPAGIVECCIVQNMCLTAALICRSALARPESRGANMRVDLAQEWD
FT                   AEHSPYGHTYISKHRQGISRHGVPA"
FT   gene            79894..81291
FT                   /locus_tag="Mboo_0087"
FT   CDS_pept        79894..81291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0087"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: mhu:Mhun_3054 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54611"
FT                   /db_xref="GOA:A7I4F0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F0"
FT                   /protein_id="ABS54611.1"
FT                   /translation="MKYLMKFGGTSVADAQCIGRVVDILEHHRRAGDEIAVVVSAQRGV
FT                   TDQLIDIAEKLPNAKDCTAVLPLIAALRERHVKTLEGAAPDFSAETEKVIEKRLASLQH
FT                   ILVAVYNLRELTPRSKDYIISFGERLLAPIVSAALRQRGIPSNVFDGCEAGILTTPQHG
FT                   EATALCESDERIKKKIDPLLKNEIPVIMGFMGCTENGIITTLGRSGSDYSASIVGAGID
FT                   ADEIWIWTDVDGIMTSDPRVINDARVLKSVSYIEVMELSYFGAKVMHPRSIDPAMRKNI
FT                   LVRVKNTFNPTHPGTMIVRNGHRDSRVVKALTYIDKVASININGAQMIGRPGVAKMIFS
FT                   ALADKEVNVMMITQGSSEANISLIVDESHLPIAVAALEFLVKDGIVREVTHNKDVCAVA
FT                   VVGAGMAGAAGSGGRIFTALGRAGINVMMISQGSSEANISFVVKQADGPRAVRVLHDEF
FT                   RLSEECA"
FT   gene            81288..82280
FT                   /locus_tag="Mboo_0088"
FT   CDS_pept        81288..82280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0088"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: mhu:Mhun_3055
FT                   phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54612"
FT                   /db_xref="GOA:A7I4F1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F1"
FT                   /protein_id="ABS54612.1"
FT                   /translation="MTQNAYSEAGVDIDLEATAIKALIKNLTYRRKGNYTMLGNVGHFA
FT                   GLIDFGPKALALTTDGVGTKMLIADKLGDWSTVGIDCIAMNVNDLYVMHMEPVAFVDYI
FT                   ATDKLSVEKMAQIGIGLNEGARQANIDIVGGETASLKGLVNGLDLAGTCFGIQDKGKIV
FT                   TGDKIRPGDKIVGVPSTGIHSNGLSLARMVVEKYADYDEKISTGKTLGRELLTPTRIYH
FT                   ESLNVADTCTVHGMCHVTGGGLLNFLRLSRYGFRFDTLLQPPAIFSWIQETGKISDVEM
FT                   YRTFNMGMGYAYVVPPASVDAVTALLPGAQAVGEVTEKPGAWLGNVQVT"
FT   gene            82330..82755
FT                   /locus_tag="Mboo_0089"
FT   CDS_pept        82330..82755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54613"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F2"
FT                   /protein_id="ABS54613.1"
FT                   /translation="MAEGFGSGDNASRRSRIILSSKTKMQVRDLVGKCEYCGCMSDELE
FT                   VFLLGMLSSSLHRPEENPAHLLVVLCPEHFREATKGKLLKPALRSKIAKRPDKLKKALR
FT                   SLLQKHDRTYEGTNVRETHDPNRFTVGAFLKENQKDR"
FT   gene            complement(82797..83336)
FT                   /locus_tag="Mboo_0090"
FT   CDS_pept        complement(82797..83336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0090"
FT                   /product="ZPR1-related zinc finger protein"
FT                   /note="TIGRFAM: ZPR1-like zinc finger protein; ZPR1-related
FT                   zinc finger protein; PFAM: Zinc finger, ZPR1-type; KEGG:
FT                   mhu:Mhun_3056 ZPR1-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54614"
FT                   /db_xref="GOA:A7I4F3"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="InterPro:IPR042452"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F3"
FT                   /protein_id="ABS54614.1"
FT                   /translation="MRTVVPGPCPYCNTEIEYLYQTENIPYFSDILIISAICPACGYRY
FT                   VDTQLLKNADPTRYELAVETRDDLDVRVVRSMTAHLEVPELGVRIDPGPACEGFVSNVE
FT                   GVLDRIAQAIHAGIRDGDETEKENGRVLLERIASIKAGKLPMTLILQDPMGNSMIVSDK
FT                   AVKKPVAEDEPEECEP"
FT   gene            complement(83341..83709)
FT                   /locus_tag="Mboo_0091"
FT   CDS_pept        complement(83341..83709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0091"
FT                   /product="Protein of unknown function DUF1621"
FT                   /note="PFAM: Protein of unknown function DUF1621; KEGG:
FT                   mhu:Mhun_3057 protein of unknown function DUF1621"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54615"
FT                   /db_xref="GOA:A7I4F4"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR012426"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F4"
FT                   /protein_id="ABS54615.1"
FT                   /translation="MVKIFDTLLGKNSTSSDDEYMELDLSSYEEHGRDAPALLVKIATI
FT                   GDLKDTPRVKDEVYNGNIVIVDISRLKMDKISYERVLKDLKEVAKDVNGDIIGLGDQRY
FT                   VVLTPMSVKISRDKIGGA"
FT   gene            complement(83802..84314)
FT                   /locus_tag="Mboo_0092"
FT   CDS_pept        complement(83802..84314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0092"
FT                   /product="PUA domain containing protein"
FT                   /note="PFAM: PUA domain containing protein; KEGG:
FT                   mhu:Mhun_3058 uncharacterized domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54616"
FT                   /db_xref="GOA:A7I4F5"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F5"
FT                   /protein_id="ABS54616.1"
FT                   /translation="MVERTMKKIIAKKRHSIRKSQVEDLFSRLTLQIGPSAALFRSDMI
FT                   EILETSSDIAIFLVNKKPLLMDTGEWAFPTLKGAVQCPFPERMVTVDAGAIPYVVNGAD
FT                   VMRPGIVAVSDDVAAGGPVQIVDERHKKPLAIGVALLDGAAIRASAQGKMCKNFHHVGD
FT                   ELWNLEL"
FT   gene            84470..84700
FT                   /locus_tag="Mboo_0093"
FT   CDS_pept        84470..84700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0093"
FT                   /product="Like-Sm ribonucleoprotein, core"
FT                   /note="PFAM: Like-Sm ribonucleoprotein, core; SMART:
FT                   Like-Sm ribonucleoprotein, eukaryotic and archaea-type,
FT                   core; KEGG: mhu:Mhun_3059 like-Sm ribonucleoprotein, core"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54617"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F6"
FT                   /protein_id="ABS54617.1"
FT                   /translation="MTKRPLDILDLVLNRQPVIVSLKGGREIRGVLQGYDVHMNLVLDK
FT                   AEETENGQVVKVGTLIVRGDNVIYISPSLES"
FT   gene            84712..84894
FT                   /locus_tag="Mboo_0094"
FT   CDS_pept        84712..84894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0094"
FT                   /product="Ribosomal protein L37e"
FT                   /note="PFAM: Ribosomal protein L37e; KEGG: mhu:Mhun_3060
FT                   ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54618"
FT                   /db_xref="GOA:A7I4F7"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4F7"
FT                   /protein_id="ABS54618.1"
FT                   /translation="MSKGTPSMGKMNKMTHIACRRCGRISFHAQKKVCSSCGFGRSTKM
FT                   QSFKWDTKRPKTPTH"
FT   gene            84905..86335
FT                   /locus_tag="Mboo_0095"
FT   CDS_pept        84905..86335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0095"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase; KEGG: mhu:Mhun_3061
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54619"
FT                   /db_xref="GOA:A7I4F8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F8"
FT                   /protein_id="ABS54619.1"
FT                   /translation="MCGIVGIVDAGGVSIQLYYALYALQHRGQESAGISTFDGTSLRKF
FT                   KGQGLVADVFSPAVLKDLKGTAGVGHVRYPTTGSNLPENIQPLNFQFQEHFISVAHNGN
FT                   LVNTCDIRREYEQAGQIFTTTTDTEIIAKILIQEISTSGSVEDAVQLCMKRMQGSYSVV
FT                   IMIDGVIYAFRDPLGIKPFCLGKIEHGYIVASESVAIDALGGKFLRDIRPGELIRMDGD
FT                   GVKCTQIAVAGRCAHCIFEYIYFARADAVIDGVLVYDVRRTIGQKLHEEAPVSADSVCS
FT                   VPDSGTAYAIGYAERSRIPFVESLMKNRYMGRTFIMPTQKERERAVRIKLNPIPAHLKD
FT                   KSIVLVDDSIVRGTTSKRIIEMMRDAGAQEIHMRIGSPAIKAPCYLGVDMPTRKELIAS
FT                   DKIEEEVRRSITATSLHHISLDALVKAIGFDREDLCTGCLTGCYPLLIDGETANPRLVN
FT                   FVDVTFQSRLESFEAETT"
FT   gene            86435..87112
FT                   /locus_tag="Mboo_0096"
FT   CDS_pept        86435..87112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0096"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mac:MA1733
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54620"
FT                   /db_xref="GOA:A7I4F9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4F9"
FT                   /protein_id="ABS54620.1"
FT                   /translation="MEHIKKAFDAVATEYDAQREHVIPDMRNYYGAAVWAAESPSQAPA
FT                   ILDVGAGTGLLSALLLEKYPGAAITLLDISEKMLAVAEERFSKKENVSFRTGDYAQADL
FT                   GGPYDLVCSALSIHHLEPGDKRRLFLKIYRALSPGGIFVNADQAEGETPYFSERYLAYW
FT                   NDFLANGPLSAHEHAEILKRRNTLDKNEKLSVQLAWLREAGFSDVDVVYRNRTFIVTVA
FT                   GKA"
FT   gene            complement(87352..87426)
FT                   /locus_tag="Mboo_R0001"
FT                   /note="tRNA-Met2"
FT   tRNA            complement(87352..87426)
FT                   /locus_tag="Mboo_R0001"
FT                   /product="tRNA-Met"
FT   gene            87498..87947
FT                   /locus_tag="Mboo_0097"
FT   CDS_pept        87498..87947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0097"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mhu:Mhun_2493 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54621"
FT                   /db_xref="GOA:A7I4G0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G0"
FT                   /protein_id="ABS54621.1"
FT                   /translation="MSRSLDSISSAALFTSMDDNELERVREKRMAELKGKLERQGAGGR
FT                   VIPVDQLHMEELLKTHPALVIDFWAEWCGPCRKIAPAIEELAGEFAGKVTFGKCNTDEN
FT                   QQLAMQLNISAIPNIVFFSHGKMVDRVIGAYPKEAIREKVIRNFP"
FT   gene            complement(88008..88307)
FT                   /locus_tag="Mboo_0098"
FT   CDS_pept        complement(88008..88307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54622"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G1"
FT                   /protein_id="ABS54622.1"
FT                   /translation="MAEETHAEQPQQQHHNRRPFRHHRPDHRPQQQPRPAQEERPPQQA
FT                   PPGAGAEGAAGAAADEDEEDREESRQRQNRGGHHRGGKPPKKVYEEFINDPYCE"
FT   gene            complement(88395..88958)
FT                   /locus_tag="Mboo_0099"
FT   CDS_pept        complement(88395..88958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54623"
FT                   /db_xref="GOA:A7I4G2"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G2"
FT                   /protein_id="ABS54623.1"
FT                   /translation="MTDIRNFIGFAQNETLIKEYDGLRMYFPVRAKIGIAVTNKRLIAY
FT                   STVRSFFNPQSESIYQHAAIADIKGVGVVQSARSRPAAVVLGVFLLLAGALATVIGLTG
FT                   GSLPALGGGVACVILGIILVIAGLLWKKNLFRFEVWGNAWTLCIGEFDTIRPSVVSGPE
FT                   LLKVVEELGALIVEIQEGTLYTGE"
FT   gene            89083..90642
FT                   /locus_tag="Mboo_0100"
FT   CDS_pept        89083..90642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0100"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mhu:Mhun_2450 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54624"
FT                   /db_xref="GOA:A7I4G3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G3"
FT                   /protein_id="ABS54624.1"
FT                   /translation="MSNVTTLLDAKSVPEAKAALVCPLRNETYSYRELRDEMNRIGCGL
FT                   SGLGIQKGDRVCIYLDSSPEYLISYFAIWRIGAVAVPANSVYQAEELLHVVRDAGARAI
FT                   ITDIRGAPVAGAVQEKAPGLAHIICVAGPGNTDAMPGDAVAWSSFPAVPASVRAANCAM
FT                   DDLCHIQYTAGTTGKPKGAMLSHGNWMTALDAEREALRLRPDDVYLGIYPMGHVGLSWG
FT                   LAVLRAGGTFVMMERFNPAEYLALAGRYKVTVLAGMPPVIHTLVHAEPGIEEHLRTVRV
FT                   IISGGGQLLPSVWAAFDKRFHIPVANSYGLSETIVIGSGTTTLPEYPHLTKNYQSVGVA
FT                   VGYTEVRIVDVDDPEKELGPGEAGEIALRGPSVAKGYWNLPEATATVFRHDGWFLTGDI
FT                   GYIDEEGILYITDRKKDMIIMSGWKIYPTEVENVIVQHPAVADVAVFGVPDERRGESPV
FT                   AAVVLKAGAALAEPEFETFCRQHLAGYKVPRTLVIVDDLPRVHGWKLLRRTLREKFGKM
FT                   PA"
FT   gene            90740..91360
FT                   /locus_tag="Mboo_0101"
FT   CDS_pept        90740..91360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_3171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54625"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G4"
FT                   /protein_id="ABS54625.1"
FT                   /translation="MDTKSQIVDIPISVKPKKRSTGIVGLNLLLDGGFPAGTIVMVYGT
FT                   PISGVELAAMQFWKVEGEEGTYLMNDGDVEVGMQDVAELHPDMYLPQMVGGRIVIDSYS
FT                   AIVIRYGIDAALKFLKHARESMRERGANMMFIVYTNVHTPVEITRIMRAADIVIELKTD
FT                   VHQSEIERTLAVHKIRDAAAPQRLLPFIITERGIEASTTSRVV"
FT   gene            92442..92726
FT                   /locus_tag="Mboo_0102"
FT   CDS_pept        92442..92726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54626"
FT                   /db_xref="GOA:A7I4G5"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G5"
FT                   /protein_id="ABS54626.1"
FT                   /translation="MSSNGIKNGLNVPQKIDEITRKKQIEQITLELNLESMVLTGVSVA
FT                   SAVEVGFIGILGPSDIRTICISIGFIILMCVIYYQYKCKLAKIKEIFRN"
FT   gene            94035..94319
FT                   /locus_tag="Mboo_0103"
FT   CDS_pept        94035..94319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54627"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G6"
FT                   /protein_id="ABS54627.1"
FT                   /translation="MTDVMDKRAELTEKVMVSAEIKQVLYSYKKPGERLGDVVDRLIRD
FT                   RKRDEFIEHLDRIAREGDFVPLDSDPEIAAIKKEAARAGKHRQKSIAVH"
FT   gene            complement(94686..95588)
FT                   /locus_tag="Mboo_0104"
FT   CDS_pept        complement(94686..95588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0104"
FT                   /product="Methionine synthase, vitamin-B12 independent"
FT                   /note="PFAM: Methionine synthase, vitamin-B12 independent;
FT                   Cobalamin-independent synthase MetE, N-terminal domain
FT                   protein; KEGG: mhu:Mhun_2447 methionine synthase,
FT                   vitamin-B12 independent"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54628"
FT                   /db_xref="GOA:A7I4G7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G7"
FT                   /protein_id="ABS54628.1"
FT                   /translation="MKAYFVNKVLATTVVGSYPVVKGSGISSFFDPFKAAVETAVADQV
FT                   NAGIDIISDGQVRNDMIPLFTARLPGIKGQDVVGKVQPASGAITAGDAKYARSKSPYVK
FT                   GVLTGPSSIAHGLHIGTPMYRNKEELVPDLAAALAVEAKHLEAAGVTLLQIDEPIFSTG
FT                   VADLAVGKQAIEAIAGAVKIPTCMHVCGGLGNVIDDILKINVHVLDFEFSKNPANLALF
FT                   GSRDLAGRMIGYGCVDSTSEAVETVAEIKKRIEKGVEIFGAKAMLVDPDCGLRMRSRES
FT                   AFWKLKNMAEAAREVRLAL"
FT   gene            complement(95585..96877)
FT                   /locus_tag="Mboo_0105"
FT   CDS_pept        complement(95585..96877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0105"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="KEGG: mhu:Mhun_2446 aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA synthetase,
FT                   class II (D, K and N); nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54629"
FT                   /db_xref="GOA:A7I4G8"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G8"
FT                   /protein_id="ABS54629.1"
FT                   /translation="MHIPIQSVTPQSGHAEICGWVHEERDLGGLAFFLIRDRTGIIQVT
FT                   IPKKKVSEEVLLAAKKVSRESVVRIAGTVKAVEKAPGGREIVPDKFEIINLAETPLPLD
FT                   VSEKVGVELDTRLDARFLDVRRPRVAAVFQIRSAALFAVNEFLHKEGFISITTPKIVAA
FT                   ATEGGTELFPIAYFDKEAFLNQSPQLYKQMMMAGGFEKVYEIGPIFRAEEHNTTKHLNE
FT                   ATSIDIEVSFADHHDVMKTLEHLIVTTYEYVNKTCSTQIANLEIDNFAVPKAPFTRLPY
FT                   GEAIGIAQKKSGEPIKYGDDISAAAEHAIGDEMGAHYFIVDWPTEIRPYYAMPYEDDPS
FT                   ICKAFDLMHPRMELSSGAQRVHQYDLLVQQIKKKGLNPESFEFYLRPFRYGMPPHAGWG
FT                   LGAERLIMTMLGLSNVREAVLFPRDMHRLVP"
FT   gene            97057..97566
FT                   /locus_tag="Mboo_0106"
FT   CDS_pept        97057..97566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54630"
FT                   /db_xref="GOA:A7I4G9"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4G9"
FT                   /protein_id="ABS54630.1"
FT                   /translation="MSDPSPHAPGHKPGGTAPHAKLLLGIIAGLVIVIAVVGLLTFTMS
FT                   VSTDTTGVSLPFANHYSVSLPDGNAVTIGSSRIAVMAYNDSVTTDVDGNREQLAVGQTR
FT                   VISPRHATISIFGIPIFSADFQLTLQYLGSSGSLDNFDLTVASSQKIPSFLLDRLIPSS
FT                   VKATQA"
FT   gene            97676..99031
FT                   /locus_tag="Mboo_0107"
FT   CDS_pept        97676..99031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0107"
FT                   /product="coenzyme F390 synthetase/phenylacetyl-CoA ligase"
FT                   /note="KEGG: mma:MM0843 coenzyme F390
FT                   synthetase/phenylacetyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54631"
FT                   /db_xref="GOA:A7I4H0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017720"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H0"
FT                   /protein_id="ABS54631.1"
FT                   /translation="MPGYHNTATETMGRADLDALIDERIRYTVQYANEHSPFYRHWFRE
FT                   NGIDPAGIRVHEDLLTLPVITGKTIREHQPPATPDFSFLSSGWGDIFTIQETSGTSGTP
FT                   KSFFLAWDDWRRYAEKYSRSFVSQGLGAGDRVVVCASYGMNVGANTMTLAARRIGMTII
FT                   PFGKCSFSSRVITAYRPTAIVGSVFKLLRLARRLEAEGLDPKETSLTRLIVGGESFADE
FT                   SREYLAGVWDCPVYNTYGSTEGTMCGECTAVSGLHVPEDLVHLDMYDPQMQDFVSDGSP
FT                   GRAVLTTLLPKGAKAGMLLLNYDTEDTTTILSRTTCACGRTHMRITPPQREAEIVRIFG
FT                   TPVNRVDIEASVFQHGNMEALTGEYEAFVYGGSAPGKVIIKTAMECPDPEKIDQRQVAE
FT                   TFTACLTRRRRTLAPFLADQSLVLEFSFVRPGGLELQVAKGRPRRLTDRRTA"
FT   gene            complement(99033..100103)
FT                   /locus_tag="Mboo_0108"
FT   CDS_pept        complement(99033..100103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0108"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   mth:MTH124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54632"
FT                   /db_xref="GOA:A7I4H1"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H1"
FT                   /protein_id="ABS54632.1"
FT                   /translation="MSQARPLAVYHPVKLDRAGLSKEAFDRLRKDSPALFKESSAYQLA
FT                   RAEEDLADHLGALQDSLSTGRPALFLDYVRRACIFFSIRHLSPHYLPDSLLALREVIDE
FT                   HLTGDLRVNADAFLKKGIAAARETPIVPPDCFDDRDPLSGTAREYLDALVKADRAPATT
FT                   ILADAAASGVSADDLSLRVLVPVLEETGRRWLVQETSVAEEHYISAAAAADLFRLNERA
FT                   RAEHPTVPRGKSVIVAAAEQDLHAIGMQMVAGFFERDGWDTYYIGPNTPAQSLIHAARD
FT                   RKADVIALSCSMPAYLSALSYLIRSLRADPATAHAKILVGGRPFATDPPLWHQIGADGY
FT                   AKDAAAAVAEAHRLTG"
FT   gene            complement(100231..101145)
FT                   /locus_tag="Mboo_0109"
FT   CDS_pept        complement(100231..101145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0109"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ava:Ava_3133 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54633"
FT                   /db_xref="GOA:A7I4H2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H2"
FT                   /protein_id="ABS54633.1"
FT                   /translation="MDVSGPRVRKYLRQFVADPTKKIRLKKYDTARVPRKELSAESDDE
FT                   AKALLKDLLDKNRQELARAQDLLAASAQYSILIVLQGMDTSGKDGTIRHVMSGINPQGC
FT                   AVHSFKVPGAEEHAHDFLWRYEKVLPERGMIGIFNRSYYEDVLVVHVHPDRMESLPAAI
FT                   GPENAGFWEGRYKDINAFEKHLVRNGTVVLKFFLHISRDEQKRRLLDRLSHQEKFWKFS
FT                   FTDIAERQYWDQYQVAYEEMLSATSTEYAPWFIVPADHKWVARTVVAEVIASAIEGLHL
FT                   CYPVFPDEKIRQLEKAKAALERE"
FT   gene            complement(101194..101787)
FT                   /locus_tag="Mboo_0110"
FT   CDS_pept        complement(101194..101787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54634"
FT                   /db_xref="GOA:A7I4H3"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H3"
FT                   /protein_id="ABS54634.1"
FT                   /translation="MKNVSRPTYSYLILVIGLIVIDTLLAWVSAGISHLISPTLPAGVA
FT                   VIALAAAFMVIFTLWFGMYGAIAAYVGGLFGASIFGGMSGSVALYLSLANLWMVLVPLA
FT                   AFRIFEANAAIESRRDLFHLVLFGAILNNIIAAAWGSISLAVGGVIGWNGIMAAFVPWF
FT                   AGNAIFTIIIAPLVLSRYTPRAEKSKVFVRNFWF"
FT   gene            101924..102394
FT                   /locus_tag="Mboo_0111"
FT   CDS_pept        101924..102394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0111"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   KEGG: mhu:Mhun_0890 crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54635"
FT                   /db_xref="GOA:A7I4H4"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H4"
FT                   /protein_id="ABS54635.1"
FT                   /translation="MMVIGIDPGLARLGYGVIRAERGTAVPLCYGCLETRAGARPGERL
FT                   LEISRGLASLFERYPPDALAVEKLFFSKNVTSAMGVSEVRGIVLLAAEERGIPVTEYTP
FT                   NQVKQAVTGSGRADKAQVQQMITRLLRLHEVPQPDDAADALSIALCHIHVMR"
FT   gene            102399..103004
FT                   /locus_tag="Mboo_0112"
FT   CDS_pept        102399..103004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0112"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: sth:STH1160 Holliday junction DNA helicase
FT                   RuvA; TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA, domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54636"
FT                   /db_xref="GOA:A7I4H5"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H5"
FT                   /protein_id="ABS54636.1"
FT                   /translation="MIAYLEGTPAATGDRWVVLDVNGIGYRVHVPEPEVREIAGAGTKV
FT                   KLHTYMAVREDAITLYGFLHESELELFTVIIGVSGIGPQIALNILSQISLEDFVLAILS
FT                   GDEKSLTRISGIGPKGAKRLILELRDKMKKVQDAMTHTPAGRQDATLRDAASALVSLGF
FT                   AEAASYDAVASAARGLAAPTVQEIVKAALRLLKEGEHR"
FT   gene            103001..104008
FT                   /locus_tag="Mboo_0113"
FT   CDS_pept        103001..104008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0113"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: mhu:Mhun_0892 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   magnesium chelatase, ChlI subunit; AAA ATPase, central
FT                   domain protein; Holliday junction DNA helicase RuvB,
FT                   C-terminal domain; Holliday junction DNA helicase RuvB,
FT                   N-terminal domain; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54637"
FT                   /db_xref="GOA:A7I4H6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4H6"
FT                   /protein_id="ABS54637.1"
FT                   /translation="MSERVISPEPVPDDADEITLRPSTLEAFVGQEPAKNALRIAIAAA
FT                   RKRGEPIDHILFAGPPGLGKTTLAHIIAREMGAAIRTTTGPVLEKTGDMAAIATALQNG
FT                   DVLFIDEIHRMNPVVEEILYPAMEDFFIDVMIGEGPSARSIKLTLERFTLIGATTRQGL
FT                   LSSPFRDRFGLLIRLNLYSPEDLEKIVTRSAEILRIPITPKGAAVIASRSRGTPRIANR
FT                   LLRRVRDYAVVEGDGTITAEIAGAGLALLQIDELGLDDIDRRILSVIAGDFGGGPVGAK
FT                   TIAISVGEEVRTIEEVYEPYLIQIGFVKRTPQGRETTPAALAHLKLNHSQKTLF"
FT   gene            complement(104069..104728)
FT                   /locus_tag="Mboo_0114"
FT   CDS_pept        complement(104069..104728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0114"
FT                   /product="protein of unknown function DUF1211"
FT                   /note="PFAM: protein of unknown function DUF1211; KEGG:
FT                   mth:MTH1490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54638"
FT                   /db_xref="GOA:A7I4H7"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H7"
FT                   /protein_id="ABS54638.1"
FT                   /translation="MESEEILSDTLISKNRLEALVDGVFAFAMTLLVVGLSVPTIPKAE
FT                   AATELPAYVASMFPQFLSFLIAFFILASLWIVHHEHFHFLRSVDKIVLWLNILILIFVV
FT                   LVPFSTNLSGDYPHVPIAPLIFHANMLILSTLFLIHWQYIIRQPALLTGPIHPDRILDA
FT                   VMDRVPIIVAALVGMAVVLANGPISSMYMYLIFPLLMRIVMWYIHSRRAAKRASPA"
FT   gene            complement(104946..106133)
FT                   /locus_tag="Mboo_0115"
FT   CDS_pept        complement(104946..106133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0115"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: HEAT domain containing protein; PBS lyase HEAT
FT                   domain protein repeat-containing protein; KEGG:
FT                   mba:Mbar_A1826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54639"
FT                   /db_xref="GOA:A7I4H8"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H8"
FT                   /protein_id="ABS54639.1"
FT                   /translation="MAIIKKILNIFKSGNREEEEARLRAQKERYENFLRALTSGDLDTR
FT                   WNAVRSVGDLGEPFIEPLIGGLKDEFWIIRRGSADTLGKIGAPAVVPLIGALAEPGDDV
FT                   RQETIRALQLIGEPAVTPLIQALKHNHPFIRRGAVQALGVMGETRAVPNIVETLRDADP
FT                   WVRHEAAVALGRIGDPRAVTPLIEALNDPLEHVRMAAMATLCSLGQVSIEPLIQALVDK
FT                   NEDVSRRAALALTTIGESAVEPLIAALASQNAGIRKEAAGILGQIGNTTAIPALIEKLS
FT                   DPERQVRIEVVRALAALGVPAIAPLMQVFREGDVRMRTGAMEALWMLGQPATTPLIMVL
FT                   KDDQSDVRKRAALLLGEIGDAKAADHLNGLLSDENVSVRREAFEALEMIKKRNNP"
FT   gene            complement(106282..107214)
FT                   /locus_tag="Mboo_0116"
FT   CDS_pept        complement(106282..107214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0116"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: mhu:Mhun_3131
FT                   peptidase C1A, papain"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54640"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4H9"
FT                   /protein_id="ABS54640.1"
FT                   /translation="MKRLLIVLALIACILIAGCTSIPAPAQEKGTLQFSSSPAGAQIYL
FT                   DNQYQGTTPSTLTGVATGSHILEFRDAGYQSYITNITVASGTSNYYAALTLLASQTVQP
FT                   TSAVTGGSVSQGSTSGIQPTLTIQAGQKTMTIGTAQAFTGTCTGSDTVLLYLSGPGAYT
FT                   NGVLLAQVPVSVVNTWNYTWNPGYRIISGSYTLVALDKNKTVSATAPFSVVGGGSVSVI
FT                   ATPITTSPGGTVTLTGLCTTGSSGITLTLYGPGQLASGIQLATLTLNPDNTYSYSYTFD
FT                   ISRPAGTYTMTVSDLQHTASASTNIQLNN"
FT   sig_peptide     complement(107128..107214)
FT                   /locus_tag="Mboo_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.780 at
FT                   residue 29"
FT   gene            complement(107330..108238)
FT                   /locus_tag="Mboo_0117"
FT   CDS_pept        complement(107330..108238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0117"
FT                   /product="LPPG"
FT                   /note="TIGRFAM: LPPG; PFAM: protein of unknown function
FT                   UPF0052 and CofD; KEGG: mhu:Mhun_2444 LPPG:Fo
FT                   2-phospho-L-lactate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54641"
FT                   /db_xref="GOA:A7I4I0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4I0"
FT                   /protein_id="ABS54641.1"
FT                   /translation="MITFLSGGTGTPKLLRGMQKVTDRHEISVVVNTAEDIWISGNHIS
FT                   PDVDTVMYLFAGVLNTDTWWGIRNDTFVTHEEILHLGLGEYIAIGDRDRAVHIARGNML
FT                   REGMRLTNATRTLCERFGVRENVLPMSDTEVTTRVKTELGLIHYQEYWIRSRGQIRIED
FT                   VVRCSKVPPESSEEVIQAVEASDVVVIGPSNPITSITPILECKGIREAMEDKYVIAVSP
FT                   FIGNVPVSGPAAALMQASGFEPTSAGTAACYKDLVDLFIHDIRDPVEMREAIRLDTLMT
FT                   GEEKSIGLAEQILALAKRAKA"
FT   gene            108281..109486
FT                   /locus_tag="Mboo_0118"
FT   CDS_pept        108281..109486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0118"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: mhu:Mhun_2443 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54642"
FT                   /db_xref="GOA:A7I4I1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I1"
FT                   /protein_id="ABS54642.1"
FT                   /translation="MSPKIIKDPVHGYVEVDEDILPLLDAPGIQRLRYIRQLGFSYLVY
FT                   PGATHTRFEHSVGTMHLAGIACREFDLADDERRLVVAAALLHDVGHGPFSHASEPLMEA
FT                   WLGRTHDDIAGIVEVQFGSLLEPLGISPGEIGDVVRGRHRLSGIIHGDLDVDRMDYLLR
FT                   DAYYTGAPYGTVDAHRLIMNLHLTPDGVVLDENGINAAESLLIARTLMRPTVYYHHVSR
FT                   IGECMFQLALLSHMATDPAGGFERICALDDGECMLDLRRSQSTLAREIAGRLYERRLYK
FT                   RAVYAGQDQVNAAAFQTGWTLDRARDVAREIAETAGCRENDVLVDIPPPPGEMTLEVQV
FT                   KNRDTTTGFAEFSPRLQMLNETRREQWRLGVYTLPEHRAAVADAATEILHVKKPTRQGT
FT                   LF"
FT   gene            109559..110047
FT                   /locus_tag="Mboo_0119"
FT   CDS_pept        109559..110047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54643"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I2"
FT                   /protein_id="ABS54643.1"
FT                   /translation="MNRYLIPSMILVIFALFCAGCTETGSQGTGITATPTPLPLTTAVP
FT                   SVSPSAITTLPTLSLGNQYLSRSYAFSGLNNTYSEQIRIADPSWAISYKVTELTNTSQD
FT                   CQFAIKVTNLDSMNSQTYTWTYLNDSFQQYPMYTPGLYKFALTGSLVKVDLTVAQRLP"
FT   sig_peptide     109559..109621
FT                   /locus_tag="Mboo_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.593 at
FT                   residue 21"
FT   gene            110062..110514
FT                   /locus_tag="Mboo_0120"
FT   CDS_pept        110062..110514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54644"
FT                   /db_xref="GOA:A7I4I3"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I3"
FT                   /protein_id="ABS54644.1"
FT                   /translation="MADITGDTLVITGGFILVIIIVAITFLRLRTAERRMHESSYKLRT
FT                   YTDLLNAVTDINLAGNDSYKLDIAKRNLALTLNRLNLIASSGVLKSVSDLLDFLNEHKE
FT                   KDFDTLRLHNILNTLVIEARRDLNPSHARNIEESKVRYRFFGPVRK"
FT   gene            110616..111170
FT                   /locus_tag="Mboo_0121"
FT   CDS_pept        110616..111170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0121"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: mhu:Mhun_2439
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54645"
FT                   /db_xref="GOA:A7I4I4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I4"
FT                   /protein_id="ABS54645.1"
FT                   /translation="MKKEYVVGVTGASGICYARRLLEVLCQNAQVHLIISDVAREISRH
FT                   ERIDLTGFDAIYHDADAISADIASGSHPHNGMVIIPCSAKTLSAIATGYADNLITRTAD
FT                   VCLKERRKCILVTREMPLSRIHLQNMLTAHDAGATIMPASPGFYHHPQKIDDLVDMVVA
FT                   RVLDHLGVAHTLSERWSGYDA"
FT   gene            111163..112404
FT                   /locus_tag="Mboo_0122"
FT   CDS_pept        111163..112404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0122"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylases; PFAM:
FT                   Carboxylyase-related protein; KEGG: mhu:Mhun_2438
FT                   carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54646"
FT                   /db_xref="GOA:A7I4I5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I5"
FT                   /protein_id="ABS54646.1"
FT                   /translation="MREFIERMRRKGLVIDITEPSSPDDMKAAQHAAGTDKLLFFHNVG
FT                   GARAVMNVTADRQALALALGMDEKEMVKKLADAAFDGKIVHDGKLSMKKPDLSLIPVMH
FT                   FFPKDAGRYFTAGIVFSKWDGVENASIHRMLVLDDTRVAARLVEGRHTHVMHKKALACG
FT                   ERLPIAVVVGVHPAVTFASCTRVPAGKELAYAAELMGGTIHVKECSNGVLVPADAEIVL
FT                   EGFIGPDVTDEGPFVDITGTYDPVRRQPVIEFTGMHVKPDFIYHSILPGGDEHKILMGC
FT                   PYEPKIYRAVAGVTEVRNVVLTKGGCGYLHAVIQVKKSTQGDGKNAIMAAFAAHTSLKH
FT                   VVVVDEDIDPSDPSEVEYAIATRVSGDRDVMVVTGVRGSSLDPCQKEDGTNVKIGVDAT
FT                   MVMGHEDEFRRATW"
FT   gene            112398..113576
FT                   /locus_tag="Mboo_0123"
FT   CDS_pept        112398..113576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0123"
FT                   /product="protein of unknown function DUF521"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   mhu:Mhun_2437 protein of unknown function DUF521"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54647"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I6"
FT                   /protein_id="ABS54647.1"
FT                   /translation="MVAGMHLDQEDEQILAGEQGETRQKMLELLVALGKVFGAERLVPI
FT                   KSAQVSGASYKTIGKYGLEWLSSLDAKAVVPAVLNPIGMPRGRWEEMGIDPDFAEKQQA
FT                   VVAAYERLGIRLDCTCTPYYLYETRYGDHLAWSESSAVSYANSVLGARTNREGGPSALA
FT                   AALVGKTPCYGLHLDKNRVPQMVIDVHADTAGWGIAEYGALGFHAGKLAGNRIPYFRGI
FT                   RPEPDQLKAIGAAMAATGAVALYHVEGVTPEAQKIGYDLSGLDTVPVEQAEIASVFSEI
FT                   PVDAVAVGCPHCSPAELAEIARLLTGKVVTKPLYVFAAQGVIEQNARVVDSIEKSGARV
FT                   FADTCMVVSPAMEQYRSIMVNSGKALAYVPNMCGGQARIGTIADCIRVATEW"
FT   gene            113627..114745
FT                   /locus_tag="Mboo_0124"
FT   CDS_pept        113627..114745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0124"
FT                   /product="protein of unknown function DUF1646"
FT                   /note="PFAM: protein of unknown function DUF1646; KEGG:
FT                   mba:Mbar_A0903 cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54648"
FT                   /db_xref="GOA:A7I4I7"
FT                   /db_xref="InterPro:IPR012443"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I7"
FT                   /protein_id="ABS54648.1"
FT                   /translation="MDGVVTLGLFAIFCAVLILPFTVKKIEENLEIFLFCCGVLALTLS
FT                   GFALLPGEETGWSLSIVTEALTSPLDIASIGGIPIGIVQIVLVVGLLIYFFHHHVERGI
FT                   NRMVESFSLKLIVPLLIIILGLVSSIISAIIAAIILVEIVNALPLVKEARIEITVIACF
FT                   AIGIGAGLTPLGEPLTTIVISKLSGDPYHADFLFLADKLAIYIVPAVIFLGILGLLALK
FT                   KRQTDETNLKCVVEREEIRNVVIRAGKVYLFIMALVFLGDGFKPLILNYVVLIPSWGLY
FT                   WINMVSAVLDNATLAAAEISPALSLSQITSALLALLISGGMLIPGNIPNIIAAGKTGIT
FT                   SREWARRGIPLGLGLMAVFFCILFVPAFAGLA"
FT   gene            114830..115366
FT                   /locus_tag="Mboo_0125"
FT   CDS_pept        114830..115366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0125"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: mba:Mbar_A0933
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54649"
FT                   /db_xref="GOA:A7I4I8"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I8"
FT                   /protein_id="ABS54649.1"
FT                   /translation="MTPDTPADGSDNIAFQIGQLDDPSIDNRHHAILVLAEAGEAAIGP
FT                   LIQSLADADSDDSRWYRAVALARIGVPAIAPVIAAMKGNTGFEFRRYAASALGELGEPA
FT                   VEPLIDAMGSDDKELRGFLSKALCRIGKPAVAPLTRRLSDADEIIRSCATLTLWQMGET
FT                   GLPSVIDQIHKEKPD"
FT   gene            115449..119372
FT                   /locus_tag="Mboo_0126"
FT   CDS_pept        115449..119372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0126"
FT                   /product="DNA polymerase II, large subunit DP2"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mhu:Mhun_2435 DNA polymerase II, large subunit
FT                   DP2; TIGRFAM: DNA polymerase II, large subunit DP2; PFAM:
FT                   DNA polymerase II large subunit DP2; SMART: Hedgehog/intein
FT                   hint domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54650"
FT                   /db_xref="GOA:A7I4I9"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004475"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR016033"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4I9"
FT                   /protein_id="ABS54650.1"
FT                   /translation="MLKISPEMEQYGNGLMDGLNRAIALAKEARARGLDPSMEVEIPIA
FT                   SDLADRVEVLVGIKGVAARIRELESQMSREEAALKIGDDFVAKMFGEKNNNEILDHSIR
FT                   TAMALLTEGVVSAPTEGIAKVGLGKNDDGSQYLMIYYAGPIRSAGGTAQALSVLVGDYV
FT                   RAKLGIGRYRPRPVEVERYIEEIRQYNTIMSLQYLPSEAEIRLIVENCPVCIDGEATEK
FT                   EEVSGHRNLERVETNAVRGGMALVLAEGIAGKARKLKSKVEKMNMAGWDWLDKLIAGAG
FT                   KPSADDESHAPGVKPLDKYLRDLIGGRPVFSYPMRKGGFRLRYGRSRNTGFATAGFNPA
FT                   TLHILGGFLAVGTQMKLERPGKACGVVPVDTIEGPTVRLTGGEVIRVDDEKTALAVASK
FT                   VERILDVGEILIAYGEFLENNHPLVPAGYCEEWWLLEVPPGTKPPQDESEALVQAKKGA
FT                   YLYPAYTWFWDDISVDQIRLLADAVSGTGAIEEETLVFPLDSTAKEALELLLIPHKVNG
FT                   GMIRIKTFRAFIAGLGLDGNLKKCETWKTAPADAQPLALVMHLSGLLLRSRSGLRIGGR
FT                   MGRPGKSKPRKMSPPPHGLFPLGESGGARRSFQEASIHTEESDAHATEIDFEKEGGIIE
FT                   IEVGRRRCPGCGEITYLNRCQKCGTHTTPINTCPKCGHEVPGERCPNCDVPATCSQRIT
FT                   LNVKAEYAQAMERLGIKKESIALVKGVKGVISREKTVEAMEKGILRAQQDIYVFKDGTT
FT                   RFDMIDLPLTHIRPDEVRVPVEKMRELGYVQDINGYDLQNGKQVIELHAQDILLSDSCA
FT                   DYMIKVTQFIDDELTRLYGLPTFYNVKTRDDLVGHLVIGLAPHTSAGVLARIVGFTRAN
FT                   VGYAHPFFHAAKRRNCFYGETKIEIFDGRSWATFPIRKFVMENFDVSRPGLDRLGTYYS
FT                   DPVRPYYTRTVDTNGGMHLRRITSVSIHRSPASMIRFVTARNRELTVTPDHAMVVWDTG
FT                   YLRKIKALEIKAGDAVPILEGGVVIADRIVTAETVASLEDRVYCLTVAEDHTLVANGVF
FT                   TGQCDGDEDCIMLLMDGLLNFSRSFLPQNRGGTMDAPLVLTSRIDPAEIDKESLNVDVG
FT                   KSYPKELYEAGLVYAKAKDVEPLIDRVERRLGTPRQLEGFFFTHDTSDISAGPLESTYT
FT                   QLKTMAEKLEAELDLAEKIRAVDADDVAERVLNTHFIRDLMGNLSAFSKQKFRCTKCNT
FT                   SYRRMPLAGKCTKFKGKGICNGNIIPTVHEGSVKKYLEVSRAMVKKYKVSEYCRQRVEV
FT                   LDLAIESTFGEEKQEQLGLADFM"
FT   gene            119615..119700
FT                   /locus_tag="Mboo_R0002"
FT                   /note="tRNA-Leu1"
FT   tRNA            119615..119700
FT                   /locus_tag="Mboo_R0002"
FT                   /product="tRNA-Leu"
FT   gene            complement(119909..123154)
FT                   /locus_tag="Mboo_0127"
FT   CDS_pept        complement(119909..123154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0127"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG:
FT                   rfr:Rfer_2924 Ig-like, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54651"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J0"
FT                   /protein_id="ABS54651.1"
FT                   /translation="MQIYRFMILIIGLFLLAGAGSAAAIPDQNSTITSSTSWVVVNHQA
FT                   TITITALNTTSSIPVPGASVTATLNSTTLGSLTVSSGTTDTTGQVNFPFLAGTKTGAVN
FT                   ITATITYNDNGNLVSVTKVYTQNIDHDVAQNAVFDFQNEVTVGTETPFNISFTDQYGNP
FT                   IDNRNPYNPPIISLWISASSDNMAAFNISGSHVQYTSQELDANGNISVSVVTDTAPGEN
FT                   EILLSHFGNVGIPWGLPQFIYGINNGVPYSIDESVLPSSLTQPADNGVDHVFTINNTVY
FT                   DKYGNPTENQGILVQSNWAGDPSATMLSNPYGQIMYTYGPHSASGYVVLTATSVANSSV
FT                   SISKTVQFYNTAPVNMLFSATPQVMPSLDAKSGQTAQLVAKVVDTMGNPVANQTVTFSL
FT                   GTPTYTYANSSLAGPQLLNTTAVTNINGTATVLFVPGRFDTNKENVSYDATDSGYVTAT
FT                   ATWSSISQPLQLSWKNYPYLSELTTISSQNVNVNGKFYVTVSLTADGWNLTGTPADVVI
FT                   VSDLAAGIGGATRLTHTKAAEVGFIKNATDNTYVALASFGSAPNAGSTPYDSSDTQNLW
FT                   NLQLSKSNTTYTYRPFNPYGNVWDYNLVNPANWNSISSSTAYCFNSSSQKNPSSQSLGL
FT                   RACVNATSPYGYTYLNPWSDSKIDADLMNAGPTYKTTNQNALVNTVNAYTAYGGTDYAA
FT                   GINAALQELQSKGNPSHNQTIIIMGDGVNMMAPIAPGSFESYWPSDWNPRNGTGISEGP
FT                   NLWYLDESDVGKAAALNASTTAKNLGITIYGIQFPTPDNYGHNINDTAFFQQMVSSPTS
FT                   TWYYAPDPTTMTGIFQQIEGQIQNTAGVNTTMAFNLQSVAVNYNNVSTTYPGNEVFSYV
FT                   YDANDTPSSTQVIDQNGITTVINQTDQWNNNQTLIFNIGKMTVGQTWSTTFELQLLKPG
FT                   TVNVPGNLSTICFNTGECMSPNQGTINGVYNYSNTGFSMPTISITDLQAFEESQSTNIV
FT                   PLQWNISYPGSQYATETLYYNSQADPTWRYIYQQPVNPGNWTQAYDWNVGGLPAGTYSV
FT                   ELIAYAHDANSGKEIIPTGIQLGLSPKAFIRLQ"
FT   sig_peptide     complement(123080..123154)
FT                   /locus_tag="Mboo_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.676 at
FT                   residue 25"
FT   gene            complement(123412..124266)
FT                   /locus_tag="Mboo_0128"
FT   CDS_pept        complement(123412..124266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54652"
FT                   /db_xref="GOA:A7I4J1"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J1"
FT                   /protein_id="ABS54652.1"
FT                   /translation="MQQKRKRTHDSNRAVSEAIGFIIVFGIIIAGIGMVTMYGYPMLVQ
FT                   QQVSSDEQIMEKNMIVLQNDLKSIAYKTVPYTETSLKVGSGALTVYNMTYDNATESNFS
FT                   VYSDDTDINTCIKNSLGNCAVAGAPLLFPSGDLRYESTSAQSGISLENGAVIKRMVAES
FT                   GSAMLAPPRWYYDSQTNTAVIYLIGFTTPTTDIASQAGVGTVRMVLGLTNYTSYNLPAG
FT                   NMLYVKYLPNNNADYSAAWENYFTGTLNLASTATPFEYKWPLDSTRPTNVVIYQYQVSV
FT                   ESV"
FT   gene            complement(124271..124726)
FT                   /locus_tag="Mboo_0129"
FT   CDS_pept        complement(124271..124726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54653"
FT                   /db_xref="GOA:A7I4J2"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J2"
FT                   /protein_id="ABS54653.1"
FT                   /translation="MKPGCHRNNQTEAGVSALIEYVMITTIVVILFVVVLLSVNANFMQ
FT                   GPEETLQYNAFTDIGNGVSTRIVDLYAIAPDTGNITSSFNLPDDVGGQNYFVEIYTGST
FT                   PADQFVLVSQGTISSNISLAGISSTRNVSGNTTGNGINQISYDSEGF"
FT   gene            complement(124704..125093)
FT                   /locus_tag="Mboo_0130"
FT   CDS_pept        complement(124704..125093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54654"
FT                   /db_xref="GOA:A7I4J3"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J3"
FT                   /protein_id="ABS54654.1"
FT                   /translation="MAGLKDDAQWIVMMGFVVSFSLFFLAMVLNQSTVVGQTTAESVLD
FT                   FPKNDIRDVRSVIIDAAILNSTGNISASQTAVILNDTRVIELSRKEAVISYQITPPNPP
FT                   ADSHTYVNIHYNNGVTAYNETWVSS"
FT   gene            complement(125081..125581)
FT                   /locus_tag="Mboo_0131"
FT   CDS_pept        complement(125081..125581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54655"
FT                   /db_xref="GOA:A7I4J4"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J4"
FT                   /protein_id="ABS54655.1"
FT                   /translation="MVNDRGQLYTIEGIAAGMIMLFTTYLVLGATSVYTPGDSHISDMQ
FT                   LEQTGTDALQMMNTPANGTSESQLQQIVENNEGNTFNTVFLDYVNNKTGSKADNLHYTA
FT                   SVTYYDILNKTTVTLPPFAFNRNLSGVEHPVRVTELVIANKQFPGGSGTPRAVLVEVLL
FT                   WRD"
FT   gene            complement(125575..126744)
FT                   /locus_tag="Mboo_0132"
FT   CDS_pept        complement(125575..126744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54656"
FT                   /db_xref="GOA:A7I4J5"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J5"
FT                   /protein_id="ABS54656.1"
FT                   /translation="MADDAGNLSIDFLAGFTIFMITFIYVATLIPGLFIGLQSSSIDYD
FT                   AVAYRTGVVLTEDPGMPYNPSWESPSVADSQILRFGLALSKDTPNILSYEKINRFFCTT
FT                   EFVYPQDYQSRAVFGDYPYLFNISLQMAGSNVTQSVGDVLPEDYGYSRRVIKVKEHSNA
FT                   TLDFSNCNLLSCPSPLAQYALTGSQAGNATIQAFSLYFNYADLLDNGPANNNPAYQINP
FT                   LSPSGTGQITGGEGVLVNLTGLGSLPQDNNTRVNLSSISVYRSVSLAPLGTGQSPFEGP
FT                   VLNATNPSQFELFIDGTPVTTLPQPVTNNATLFIPPGLLSFLGQGDSSTLLNVTMQFSL
FT                   TNVTTGNPQPDRYLNTTQVAPYGAFQYNYTNPNITQPYLQNGVMEVAVW"
FT   gene            complement(126737..127312)
FT                   /locus_tag="Mboo_0133"
FT   CDS_pept        complement(126737..127312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54657"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J6"
FT                   /protein_id="ABS54657.1"
FT                   /translation="MRIPFLSGTAAGLLVLLLFCAACTSGQSNQTPATENATVATGGFS
FT                   AVAIANGSQVERFTLEEAESAALQANQSFFYLRGEHVDSSGKAERWIFGVHEGNTSSMQ
FT                   VYDKNGVSTVAMPPGLPIQGDVPVGGLSLTDALKIADSSSGAGAVDLTDGMATLQLMNG
FT                   EYTITGPSSSSLGITINATTGELSSTHG"
FT   sig_peptide     complement(127226..127312)
FT                   /locus_tag="Mboo_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.363 at
FT                   residue 29"
FT   gene            complement(127427..128299)
FT                   /locus_tag="Mboo_0134"
FT   CDS_pept        complement(127427..128299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0134"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: mhu:Mhun_2050 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: Histidine
FT                   biosynthesis HisG, C-terminal domain; ATP
FT                   phosphoribosyltransferase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54658"
FT                   /db_xref="GOA:A7I4J7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J7"
FT                   /protein_id="ABS54658.1"
FT                   /translation="MITLALPKGSLEEQTLQLFKEADLEVRRTDRDYNPAIADHRIGKI
FT                   KILRPQEIPTYVDKGYFDLGISGLDWVRETGADVVEVAALTYSKTGEGNVKIVIAVHRD
FT                   EPIENAAQIRPGSRVTTEYPELTKQYFEEKKIPVQLFHSYGASEAKVPDLMDVVVDLTE
FT                   TGTTLRKNGLKIIGQIMESHTVIIANRAAWADPEKRREIEEIKTLLFGVLDARHRVLLS
FT                   MNVPTAALEKIVTALPAMKKPTISRLHGIDYYSVQTVVQKNAVNGLIPKLKACGAEDIL
FT                   EIPIAKIVP"
FT   gene            complement(128369..129679)
FT                   /locus_tag="Mboo_0135"
FT   CDS_pept        complement(128369..129679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0135"
FT                   /product="Uncharacterised conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: mhu:Mhun_2554 uncharacterised conserved protein
FT                   UCP033563"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54659"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J8"
FT                   /protein_id="ABS54659.1"
FT                   /translation="MYQKRRLFLQAPVGTMVSVYRFAGVRPAPGEAQSIAAVPYDVVTA
FT                   DEARAIIAQNPKSFLTVSRSDAELPGLSPHDDQVYERARENFSALLSNGRLVKDRQPAM
FT                   YVYRIRQDNDTFVGIFCALDTEDYRANRIRRHELTRYDKEEDRTRHIEAVQAHDGPVVL
FT                   LYRDPGTLFSFIESLVATRKNPDAEAHTPQGGIHQIYAVTDPEALDEIERRFRDIPSLY
FT                   IADGHHRAKAAVNLADRLRAAGKPADGEVGRFMGVLFSYERVKIHGYSRLLTDLGSYTT
FT                   ETFLAGLGKLYKVAPYGTVDGSGFNIPPHITHPEKFHVMHLYLDGKWYECARPIDPNAG
FT                   PLDILDVAVLQKLVLEGMLGITDPRGDARLQYLGGARPVADLEKLVDAGTYRLALAMQP
FT                   VRVATVLSIADASGVMPPKSTWFEPKLLSGLVIHSFA"
FT   gene            129770..130288
FT                   /locus_tag="Mboo_0136"
FT   CDS_pept        129770..130288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0136"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: mhu:Mhun_2553 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54660"
FT                   /db_xref="GOA:A7I4J9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4J9"
FT                   /protein_id="ABS54660.1"
FT                   /translation="MISHEQDPVPMIRSLPGAFSPTTPLIRPATPADVPTIVAIEKDAF
FT                   ADPWDAEIFTEALSYYPTTYLVAEVEGTVAGFIVGALEDTGENIYGHICNFAVAAPFRS
FT                   RGIGRQLVLRLENQFALERATGAQLEVRESNAPAQRFYRRLGYQHVFYVGGYYANGEDA
FT                   FVMMKWFRF"
FT   gene            complement(130301..131581)
FT                   /locus_tag="Mboo_0137"
FT   CDS_pept        complement(130301..131581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0137"
FT                   /product="3-hydroxy-3-methylglutaryl Coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /note="KEGG: mhu:Mhun_3004 3-hydroxy-3-methylglutaryl
FT                   coenzyme A reductase; TIGRFAM: 3-hydroxy-3-methylglutaryl
FT                   Coenzyme A reductase; PFAM: hydroxymethylglutaryl-coenzyme
FT                   A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54661"
FT                   /db_xref="GOA:A7I4K0"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K0"
FT                   /protein_id="ABS54661.1"
FT                   /translation="MAGDEGHRDPARAGDGPDHGKEAEIKNKLRDGSVRLYELEKQLPP
FT                   VDAVRVRREFIEEETGTTLENIGIFSIDVDRASTRNCENMIGTVQVPVGVAGPLAINGE
FT                   YAKGLFWLPLATTEGALIASVNRGAGAITKAGGAEVRILHDGMTRAPVFAAKSVGHAKE
FT                   IADWAEAHFDDLAAIAATTTNHGKMTGLVTFVTGTSVFIRLEFDTKDAMGMNMVTIAGA
FT                   KIADEIAQATGARLIALSGNMCSDKKPAAINGIMGRGRSVVAGVALSHEQIAKILKTDA
FT                   ATMVEVNYRKNLVGSARAGAMGFNAHAANVVAAMFIACGQDAAHAIDGSTCMTTIDATE
FT                   SGVYVAVTLPSLPVGTVGGGTSVDTQQECLKILGVAGGGSPAGANARKLAEIIAAGVLA
FT                   GELSLIGALAAQHLARAHQELGRGVKR"
FT   gene            131630..132541
FT                   /locus_tag="Mboo_0138"
FT   CDS_pept        131630..132541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0138"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: putative methyltransferase; protein of unknown
FT                   function Met10; Methyltransferase type 11; KEGG:
FT                   mhu:Mhun_3003 protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54662"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR040601"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K1"
FT                   /protein_id="ABS54662.1"
FT                   /translation="MTAEQWGVRVPVKSGEGTRQALLREGALDCTLKVLRDGGDLIFPV
FT                   NAEREDTGRFTFEEQPGREELPRHELVGGIAILQENDPAGAARILSARPSLHTVLFPTS
FT                   EVTGEFRTRTYAVLAGNDTTRTEVVEHGHCFAVDLAGAYFSARLSTERQRIAEKMGRNE
FT                   LVLDMFAGVGPFAITLAPHAALVVAADLNPRAVALLMENIRNSRATNVLPLLFDARRLD
FT                   AILPWKFDRIIMNLPLAGTEFLPEAFRLIRPGGTIHFYSLVSCEKEHLDRIRELGGAEV
FT                   TERVVRSYSAEKWHAVYDIAAR"
FT   gene            complement(132948..133241)
FT                   /locus_tag="Mboo_0139"
FT   CDS_pept        complement(132948..133241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54663"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K2"
FT                   /protein_id="ABS54663.1"
FT                   /translation="MSVLVKFRHVGVFHTGDSLSIDLSKISEFKITRQRNSCELLAITP
FT                   ENHQPDKPYSIATRDREYQLQEIMTDLRQLKKEKRDITYEITDTGVQRTIRA"
FT   gene            133874..134215
FT                   /locus_tag="Mboo_0140"
FT   CDS_pept        133874..134215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0140"
FT                   /product="translation initiation factor eIF-1A"
FT                   /note="KEGG: mhu:Mhun_2969 translation initiation factor
FT                   eIF-1A; TIGRFAM: translation initiation factor eIF-1A;
FT                   PFAM: S1, IF1 family protein; SMART: Eukaryotic initiation
FT                   factor 1A (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54664"
FT                   /db_xref="GOA:A7I4K3"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K3"
FT                   /protein_id="ABS54664.1"
FT                   /translation="MVGFHRKDDTGAADPNALNPDGTPVCRVRLPKKWNNEQFARAETM
FT                   QGANHIRVQCMDGVSRMGRIKGKMKKRQWIREGDTILIVPWSFQDDKCDIIYRYLKPQT
FT                   DWLRKNRYI"
FT   gene            complement(134501..135064)
FT                   /locus_tag="Mboo_0141"
FT   CDS_pept        complement(134501..135064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54665"
FT                   /db_xref="GOA:A7I4K4"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K4"
FT                   /protein_id="ABS54665.1"
FT                   /translation="MPNYKGTDRVNGRVDNIANTPGIFPGDYLSTARTHFAMDATTILK
FT                   KFETIVYYILITLFAIIVACSLGELIYIVYEALFVNSPLLLENSELLGIFGYFLLVLIG
FT                   VELLATVVAYINEKVIHVEVVIMIAIIAIARSVILLDTVNTDPMDMFGIAAIIIALCAG
FT                   YFLLRKGGLRQQREYNPPNARVPE"
FT   gene            135089..135508
FT                   /locus_tag="Mboo_0142"
FT   CDS_pept        135089..135508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0142"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mma:MM3117
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54666"
FT                   /db_xref="GOA:A7I4K5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K5"
FT                   /protein_id="ABS54666.1"
FT                   /translation="MVDLQEQLFEELAKLSRMRDECSCSIFSECGLSEITVRQIAYLRT
FT                   IDEQGDVTFTRLAEITNTSKPTVTEMVNRFVRMECACRAPCPDDGRISYIHLTEKGKQI
FT                   ARAEKAALRRLIERMVETLDQDELDLLVEILRKVR"
FT   gene            135563..137947
FT                   /locus_tag="Mboo_0143"
FT   CDS_pept        135563..137947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0143"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: mma:MM3118 ATP-dependent protease La; TIGRFAM:
FT                   ATP-dependent protease La; PFAM: AAA ATPase, central domain
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: peptidase S16, lon domain
FT                   protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54667"
FT                   /db_xref="GOA:A7I4K6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K6"
FT                   /protein_id="ABS54667.1"
FT                   /translation="MQQESNEDTAEKLVIPLFEIVTYPGSRTKFPVDPVTGGYLVASLA
FT                   QGNEVFAIGLTVKSGIRLADLTPDSFYGIGNLLQITHVEPADHGYLVSAEAEHRVKAVA
FT                   LAGKDGHFTARCETVPDAEDLTADLQERILSDIKSTIFEISHRFSGSGQFTRPIERMES
FT                   VDRIMGFVMPFLPANLAEKQALLEISSKKERYIGFLDLLIRTRETIRIRMEMAEKVSER
FT                   VGKSNREAMLREQLKVIQEELGEGGEGAGDAGYRGRVEASKMPEDIRKKALAEVHKLEA
FT                   GGPQNHESTVIRNYLDLLLDLPWVTEEKKNIDIAEARRVLDSHHNGLEKVKERIVQHLA
FT                   VMKLRQEKQGSILLFAGPPGTGKTSLGKSIAEALGRKYVRVSLGGVRDEAEIRGHRRTY
FT                   VGALPGRIIQGIKRAGTKNPVFILDEIDKLATSYAGDPASALLEVLDPEQNSSFSDHYL
FT                   EVPYDLSDVLFIATANSLATIPAPLLDRMELIEISGYTKNEKFAIAKDHLIPEILKEHG
FT                   LDTDKLRIEDAALREVIEKYTREAGVRWLKKQLAMIARHVSEKIVSGTAELPFVVTPDK
FT                   VFSILGKEQIRQEVAKKEPVPGVVTGLAWTPVGGEILFIEGTFMPGTGKLTLTGQLGDV
FT                   MKESATISSSLIRSRLAGSGKGFNFIASDIHIHVPSGATPKDGPSAGITIFTALASLIT
FT                   GKTVDPELAMTGEITLSGAVLPVGGIKEKVLAAHRAGIKKILLPKENERDLPDVPEDVR
FT                   AELAFVPVGNVEEVLKEALGIELPRIVAVPAGTGLVPVQNA"
FT   gene            138405..140714
FT                   /locus_tag="Mboo_0144"
FT   CDS_pept        138405..140714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0144"
FT                   /product="Lysine decarboxylase"
FT                   /EC_number="4.1.1.18"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bam:Bamb_4345 lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54668"
FT                   /db_xref="GOA:A7I4K7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K7"
FT                   /protein_id="ABS54668.1"
FT                   /translation="MSSPERLVVAVIDDEIHKDTPHGRAIKRIIRDLEKYEIFVADIAS
FT                   PEDARTAYSNLPSVNCILIDWNLGNREKEAQQDTLKLIRQIRCINEDLPIFLMAEPTSE
FT                   PPIGITVDVLKEINEYLYVMEDTSEFIAGRISAAAKRYQDRLLPPFFGELVKFSKDFEY
FT                   SWHTPGHAGGTAFRKTPAGRRFFEFFGEQLFRSDLSISVGELGSLLDHSGPVGEAERYA
FT                   AKVFGADMSYFVTNGTSTANKIVFFGRVTENDVVLVDRNCHKSAEHALTMTHSVAVYMV
FT                   PTRNRYGIIGPIPPSDMTPAAIRKKIAACPLAKNLPDKTPVHAIVTNSTYDGLCYHAVE
FT                   VEKELGKSVDSIHFDEAWYGYARFNPLYRDRFAMRDGAKDKKGPTVFATQSTHKLLAAL
FT                   SQASMVHVRNGRVPIEHARFNEGFMMHSSTSPLYTIIASLDVSTKMMDGASGRLLTTES
FT                   IEEAIRFRRTMARIEKEIGTGKTRTDWWFPMWQPDTVTDPKTKKKIAFATAPLETLRDN
FT                   PSCWVLHPKDAWHGFEDLPDNYCMLDPIKVTVLTPGVKEDGSLAAWGIPAAIVVKFLDT
FT                   RGIINEKSGDYSILFLFSMGITKGKWGTLITELFEFKRRYDENAPLDEVFPDLVAQWPD
FT                   RYGGMTLPELAAQMHAFKRDHNMCGLLQKAFSALPEPVITYAESYKRLVRDEVEQIPVA
FT                   QAANRIVATGIVPYPPGIPLLAPGEKTGPKTGPVLQYLLSLQDFDRRFPGFEHDTHGIE
FT                   SIKGEYRMICVKEKKR"
FT   gene            140711..142135
FT                   /locus_tag="Mboo_0145"
FT   CDS_pept        140711..142135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0145"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   lpp:lpp0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54669"
FT                   /db_xref="GOA:A7I4K8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K8"
FT                   /protein_id="ABS54669.1"
FT                   /translation="MSDDAPVVNKKVLGVFALAMINVAAVLSIRNFPSMAIYGWSCIGW
FT                   YILGTILFLIPISLAGAELATGWPEGGGVYAWVKQAFGEKGGFTALFCEWSNNLVWFPT
FT                   VLSFTASTLAFALTPNLASNPWFMFSVMMIVFWGTTAIAYFGEEASAKFSNVGVILGSI
FT                   VPSLLIIILGLWWLGSGQAIVLPHFSFGQVVPTINLSTLPFFATVVLLFAGMEMAGFHA
FT                   LETRNPQRDYPKAMALSAVIIVICTVLATLAIAIVIPASQLNLASGVMQAIQYFFDASG
FT                   IAWLVGPMALLITLGGVVNLASWLIGPAKGLGIVAEEGNMPPIFDRTNKYGAPVAVLVI
FT                   QALIGSVVSLLYVFLPSVNQAYWILSAMTVELLCIVYILVFAALIKLRYSQPDTPRPFK
FT                   IPGGKTGIWIVGGLGLFGTTFAFIVGLMPPSFFTSWVTYVSAVLLGTFLLAVPPLVFLK
FT                   FKHPGWSKKTQGGSNP"
FT   gene            142176..142637
FT                   /locus_tag="Mboo_0146"
FT   CDS_pept        142176..142637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54670"
FT                   /db_xref="GOA:A7I4K9"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4K9"
FT                   /protein_id="ABS54670.1"
FT                   /translation="MTLSKNGEIALAVFLVVVFILPFAFLGLLYSEAPYFTVTGEPVKE
FT                   AADAAGISIVSVQGTLWNMTGALGGKSYTLTDPEGDTAIIATQAFDSADSRDAAVRLYY
FT                   AHAPGKGRTVGSLIVVGQYVVYATPANSPIFAKLAPALQQAAKAAGVQL"
FT   sig_peptide     142176..142271
FT                   /locus_tag="Mboo_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.574 at
FT                   residue 32"
FT   gene            complement(142681..143331)
FT                   /locus_tag="Mboo_0147"
FT   CDS_pept        complement(142681..143331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0147"
FT                   /product="uncharacterized membrane protein"
FT                   /note="KEGG: mba:Mbar_A3450 uncharacterized membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54671"
FT                   /db_xref="GOA:A7I4L0"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L0"
FT                   /protein_id="ABS54671.1"
FT                   /translation="MSSAGLAKRCIILLCGLFLMGLGISLVVRSTLGTSPISSVPYVLS
FT                   LAFPLTFGEFTFLITLIFFIAEIAIIGKDFPRPQYFQILIALLLGTFVDVGMFLSAGVQ
FT                   PGIYPEQIAIVFLGSAVLALGIFLQITANVILNPGEGLVRAIAEKTHKRFGIIKVMFDT
FT                   SLVAGAAVISFAAFGTIEGLREGTVISAVLVGYIILGFALCYTRYDLGRFLSD"
FT   sig_peptide     complement(143239..143331)
FT                   /locus_tag="Mboo_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.618 at
FT                   residue 31"
FT   gene            143430..144230
FT                   /locus_tag="Mboo_0148"
FT   CDS_pept        143430..144230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0148"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: plt:Plut_0889
FT                   lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54672"
FT                   /db_xref="GOA:A7I4L1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L1"
FT                   /protein_id="ABS54672.1"
FT                   /translation="MALPPPETCTIGDVTLAYRTYGTGFPLVLINGLASAMDTWNPPVL
FT                   DALARHFRVIVFDHRGTGYSGASAESFSIPLFSRDTAGLMEHLGITRAHVLGFSMGTCI
FT                   AQELELAFPEKVDRLVLVSGDCGGTEAVRTDPDVFARLIDRSGTIDDVVNRMLPLLFPS
FT                   FWLATHDPFRYCPAVEEITSDENAARQLAAFLSWPGTFSRLENIRSRTLVITGDADAVV
FT                   PCENSRLLAGKIPGAKLVEFPGAGHGLMYQCPDRFGETVLDFLY"
FT   gene            complement(144287..144847)
FT                   /locus_tag="Mboo_0149"
FT   CDS_pept        complement(144287..144847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54673"
FT                   /db_xref="GOA:A7I4L2"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L2"
FT                   /protein_id="ABS54673.1"
FT                   /translation="MTLRVISSAEIDAQNKLIAALNADTELRSLATPVTQTTDSDKKDD
FT                   LMNALLKYIPVTIVVGYTFLDSVFRAVTPVPETVWMASFVALLILAFILTYQITAGSEI
FT                   PIAAMLEGKESVKKAIADWQAIIRNQRIKQSVIAVIAFAGYVMCLGGPFTSLSWWQAYY
FT                   GSVALVFATVLIAIIAAKDLLAS"
FT   gene            complement(145146..147641)
FT                   /locus_tag="Mboo_0150"
FT   CDS_pept        complement(145146..147641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_1858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54674"
FT                   /db_xref="GOA:A7I4L3"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L3"
FT                   /protein_id="ABS54674.1"
FT                   /translation="MVILGHRHIFSSISLAVAVLFLLSVSVHPAMAADSVNKMTTDCAG
FT                   CSAGDLSSVPGFEGKKVPVTEIREVTQNRGTNVHPATNRMSSAAAAPATQLHQIGTVSL
FT                   SVADPRTENSATAQGKQSATLQAATDGAGSSGDLPDAITANLSSEGFVFTSESEVHLYE
FT                   TTLTSDDFLSLNSSQKDTLAAAGFISASTDTIRSYRDVTYYTFANQTTGSEIYVMAIQQ
FT                   LDADGNAIGDRHYSVSPEFPLQSGASHAGTARTAAASTIDRNGSCFWNWVSVSLLIVVL
FT                   IIDLAVLISSGTLADGDTFYFGEYRVIMDMEYDLGINIYRHGKTGSGLIRVKDYEIDRD
FT                   VFYAAGILTGLVILILLAYEIYKLGVCMKWWDEISWDSVAWTYQERAGYAENGKTLPVA
FT                   LHDRIAIALPANTSADKNAAWVPDLTGAGGLVIKDTKNETLGNSTIQTWLFEADKEGPQ
FT                   QLTVRYTTTAPIPPDIPTTTFTLLLPVLPGNWKIAFVDNSSSRYGTGLYTSLAFDPAGT
FT                   PHISSYDAGNGRIRYSSWNGTGWESGTVANSAGTYSTSLAFDKTGNPAISFGDGYHFGN
FT                   LMFATKNGMNWETDTVAWGLAGDAGQDSSLAFDKNGVPHITYNDGQSYATLKYATRSGT
FT                   NWETFEIDIGGFLGDTGYGSSLKFDDGGFPHVAYTNGKSYASLRYAENTGTGWDVTTVN
FT                   NGGGLLESTGFTPSLAFDSKGFPHVSYYDASKKDHMYSSWWNGIGWVTETVDHVNDVGE
FT                   FSSLAIDANNNPHISYYDASNHELRYATKIGDTWIKRTIDNDGKVGQFSSLALDPAGHP
FT                   CIAYFDDTHHALKYAGWAA"
FT   sig_peptide     complement(147543..147641)
FT                   /locus_tag="Mboo_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(148215..148396)
FT                   /pseudo
FT                   /locus_tag="Mboo_0151"
FT   gene            complement(148403..148648)
FT                   /locus_tag="Mboo_0152"
FT   CDS_pept        complement(148403..148648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tko:TK1510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54675"
FT                   /db_xref="GOA:A7I4L4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L4"
FT                   /protein_id="ABS54675.1"
FT                   /translation="MRCRRLPHHKPVSGDEVIRVLCNKFGFTISGRSGSHVRLSKITAD
FT                   GKTGTVVPLHDEVKPGTLRGVLKLAKIDIEDFYRCI"
FT   gene            complement(148620..148832)
FT                   /locus_tag="Mboo_0153"
FT   CDS_pept        complement(148620..148832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0153"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   syf:Synpcc7942_0871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54676"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L5"
FT                   /protein_id="ABS54676.1"
FT                   /translation="MSTYTAVLHKEDDMYVAECPEVGTVSQGKTFDEAVSNLKEATELY
FT                   LEEFPQTKKKRAILTTFEVSSVATS"
FT   gene            149538..150455
FT                   /locus_tag="Mboo_0154"
FT   CDS_pept        149538..150455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0154"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: chy:CHY_1700
FT                   putative prophage LambdaCh01, restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54677"
FT                   /db_xref="GOA:A7I4L6"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L6"
FT                   /protein_id="ABS54677.1"
FT                   /translation="MGNYFETKKIKNEILHLIPNKENIHKDIKKLQIQLNETDEEIRIL
FT                   SKEIADIVVAISLIQTQKNKGFELFDNNWVPIEDLQKLREIKIGLAKNFENISPFDFEY
FT                   FVAMLLREMGYTTEVTKKTGDYGIDIIAKKGKQIVAVQCKRHNEKNLIGNVLIQQLLGS
FT                   MHFINASHCIFITTSHFTKNAITQSQNSPIELWDKDTFHNLVRKYLLNCNIDQIFDAIQ
FT                   KDKQRQKEQIEHEKNAIIEKKAEKKLLLEKRKQEKTAKREIKKLNDDAKKICPRCGGKK
FT                   WKSRKYCSKCKQEIKSERRYDNCW"
FT   gene            complement(150496..150888)
FT                   /locus_tag="Mboo_0155"
FT   CDS_pept        complement(150496..150888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0155"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mac:MA4043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54678"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L7"
FT                   /protein_id="ABS54678.1"
FT                   /translation="MTVARFWRHLPQRYNMVGTKCEKCGRHFFPPRSFCPDCRRAGKIV
FT                   EHKFKGEGTVVTFTVIHTAAEQYSMLTPYVLAIVKLDEGPQITTQIVMDPAKAKIGMKV
FT                   KSVFRRIATDGESGIIHYGTKFVPVE"
FT   gene            complement(150891..152057)
FT                   /locus_tag="Mboo_0156"
FT   CDS_pept        complement(150891..152057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0156"
FT                   /product="Thiolase"
FT                   /note="PFAM: Thiolase; KEGG: mhu:Mhun_0150 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54679"
FT                   /db_xref="GOA:A7I4L8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L8"
FT                   /protein_id="ABS54679.1"
FT                   /translation="MRDVAVIGIGCTKFGEKWESSFRDIFVEAGTLALEDAQLSGEKID
FT                   AMYVGNMSAGRFIGQEHIGALIADYAGMATRHIPSTRVEAACASGGLAFRQAVIAVASG
FT                   MEDIVVAAGVEKMTDVGSDESTDTLTGAADREWEGFMGATFPGLYAMIANDYIHKYGMT
FT                   REQLAQVAVKNHYNGARNPIAQFPNEITLDTVMKSTMVAEPLRLFDCSPVTDGAAAVIV
FT                   APLDRAKEFTDTPIKVLATAQASDSIALHDRRDISTLDATVAAGQRAFKMAHLTNKDIN
FT                   MVEVHDCFSIAEICAIEDLGFCKKGTAGKFTADGETALGGKIPVNTSGGLKACGHPVGA
FT                   TGIKQVYEIVQQLRGDAGKRQVENAKIGMTHNVGGTGATVAVHILGRV"
FT   gene            complement(152054..153106)
FT                   /locus_tag="Mboo_0157"
FT   CDS_pept        complement(152054..153106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0157"
FT                   /product="putative hydroxymethylglutaryl-CoA synthase"
FT                   /note="TIGRFAM: putative hydroxymethylglutaryl-CoA
FT                   synthase; PFAM: Hydroxymethylglutaryl-coenzyme A synthase,
FT                   N-terminal domain; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal domain protein; KEGG: mhu:Mhun_0151
FT                   hydroxymethylglutaryl-CoA synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54680"
FT                   /db_xref="GOA:A7I4L9"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4L9"
FT                   /protein_id="ABS54680.1"
FT                   /translation="MVGIITYGAYIPRYRIKVEEITKVWGANAADITGGLGVFEKSVPD
FT                   LDEDAATIAVEAARNALKRRHVDPAKIGAVYVGSESHPYAVKPTACTVGEAIGATPVMT
FT                   AADFEFACKAGTAGIQTCMGLVKSGMIPYGLAIGADVSQGAPSDALEYTAAAGGAAYII
FT                   GNDNPIATLNHTCSFTTDTPDFWRREGQDYPRHGGRFTGDPGYFKHVKGASTLLFEQCS
FT                   TSPKDYTYAVFHQPNAKFPQKVAKDLGFTSEQIKPGLVVPWLGNTYSGASPIGLAATLD
FT                   IAKPGDRIFVCSFGSGAGSDAFDITVTEAIASKDFHRDAAPGVMQLLKDPIYLDYARYA
FT                   KHKGKIVMQS"
FT   gene            complement(153100..153810)
FT                   /locus_tag="Mboo_0158"
FT   CDS_pept        complement(153100..153810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0158"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mhu:Mhun_0152 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54681"
FT                   /db_xref="GOA:A7I4M0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M0"
FT                   /protein_id="ABS54681.1"
FT                   /translation="MKSGLRNQLAEKMAGEITLSDSPGLALKKWRQNFEIPPGVLSDRL
FT                   GVSPSVISDYESGRRKSPGTAVVGKIVDTILTIDEESDGRHIHKFSSMLFSGVADDVIL
FT                   DIHEYTNPVALKELTDAIGCSLLCGSMDQTIFGYTVVNSLNAILQLSAEEFNRIYGWST
FT                   ERALIFTHVSTGKSPMVAIRVTAFKPRSVILQGISAENVHPFVAKMADRDHITVLCTEM
FT                   EIDQIVSTLREKEW"
FT   gene            153946..154614
FT                   /locus_tag="Mboo_0159"
FT   CDS_pept        153946..154614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0159"
FT                   /product="protein of unknown function DUF120"
FT                   /note="PFAM: protein of unknown function DUF120; KEGG:
FT                   mhu:Mhun_1259 protein of unknown function DUF120"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54682"
FT                   /db_xref="GOA:A7I4M1"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023470"
FT                   /db_xref="InterPro:IPR023602"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4M1"
FT                   /protein_id="ABS54682.1"
FT                   /translation="MVLAEDLECLKALALMGGMREPVFISSQTLGEVLETSPQTASRRL
FT                   KALEGQRLISRTLNPDGQHITVTKEGEDGLRREYAEYCRLFAHEGGHYTLPGIVISGLG
FT                   EGRYYMSLEPYKKQFLRHLGFEPYPGTLNLRLSGSDIPTRKKIDSLTWIPIHGFSAEGR
FT                   TFGEVRCMPCRINDIPCGIVVPGRSHYPEDIVEVIAPVGLRDALGVKENDRVNVEVAYD
FT                   "
FT   gene            154607..155284
FT                   /locus_tag="Mboo_0160"
FT   CDS_pept        154607..155284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0160"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   KEGG: mhu:Mhun_1258 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54683"
FT                   /db_xref="GOA:A7I4M2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M2"
FT                   /protein_id="ABS54683.1"
FT                   /translation="MIDDAITALREGKMILLYDFDDREGETDFAIRSDAVTPKDILRMR
FT                   KDGGGLICTAIDPVAAERLGLPFASDALKNTQIAEQEGEIPYDRKNHSSFSLWVNHKNT
FT                   FTGITDRDRALTITAVAEQVKKSLNGGGAHFSEHFRTPGHCALLRAADDLLDQRHGQTE
FT                   LSVALARMAGVTPSITICEMLDDESGYALPKTRAKAYAKKHDLVFVEGREVLDRWESAK
FT                   KQK"
FT   gene            155446..158565
FT                   /locus_tag="Mboo_0161"
FT   CDS_pept        155446..158565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0161"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1739 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54684"
FT                   /db_xref="GOA:A7I4M3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M3"
FT                   /protein_id="ABS54684.1"
FT                   /translation="MISVVCVDDEPDLLEIARLFLERSGEIDAMSFVSAQEALDSPAIL
FT                   SCDIVVSDYQMPGMDGIAFLKEVRMRFGDLPFILFTGRGREEIVIEAINNGADFYLQKG
FT                   GDPTAQFAELLHKIRQAVRRKEAERSQHESEQRLANIIDFLPDAILAVDRTGRVIAWNR
FT                   TNENITGVPASGILGKGDYEYALSTYGERRPFLLDMIYEPDEKILKYYTNIVHDGGAIS
FT                   AETSLAAPKGRRIDIMAKASPLYNQKGEVTGAIEVIRDITALKKIEQDLRAAYERVTLT
FT                   EEELRTQYEELRQTNEQLSATEEELTCQVNKLAHSEQVLRVNEERLAMAQAVGRTGSWE
FT                   YRLDTGTIWGSAEGLRIFGYPATARDLPIEDIESCIPERERVHQALVDLIASGKDYDLE
FT                   YTIRPADGSGPKVIHSVARLERDARGIPVRVIGVIQDTTERRKAYEDIAFKNTLLATQQ
FT                   ETAPDGILIVDETGKILSYNRKFAELWKIPQELIEQGRDVLLLQQVNGQLVDPEKFLAR
FT                   VRYLYEHNDEKSFEELSLRDGRILERFSSPVFGENKKYYGRIWYFRDITGRRNADKAVL
FT                   ESEKKFATVFKSSPIALTLVSATDGTFFDVNDAFLKDTGYTREEVIGKTAEDLRLFSDA
FT                   RERENLISVLQTGKSVYGMDLQCRGKSGEIRTCRFTSQLLTIDNKAFRLFTSEDITERK
FT                   HSEEARRESEKRFRDLVETLPDIVWEIDLQGKIRYISPTVERVMGYTPEELEGGLTSDL
FT                   VAEQRRDFARRELGKYISNDSPLVPFEIPARHCDGHEMMVEIRASRVKDSEGKVTGFRG
FT                   VTTDVTRRWKSEEALRRANRQLTLLGSVTRHDVLNRITVLLGYLAIVKRKCTDPGQEAY
FT                   LQKMESAIDLLRAQMEFTRIYQDVGSHEPRWIELEAVIPRDQVPEMVSLVPDVQGFRVY
FT                   ADAMFEKVFANLLDNSIRHGGHVTEIRVTCHPEGTALVIAWEDNGVGVRAGKKEQIFRQ
FT                   GVGSNTGLGLFLIREILALTGIEIRETGEPGSGARFEIVVPEGLYLPART"
FT   gene            158645..159844
FT                   /locus_tag="Mboo_0162"
FT   CDS_pept        158645..159844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0162"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG:
FT                   mba:Mbar_A0649 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54685"
FT                   /db_xref="GOA:A7I4M4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M4"
FT                   /protein_id="ABS54685.1"
FT                   /translation="MQVPARELTSRLARFRAEMDLRSPGWSLAAITERINLYYFTGTIQ
FT                   DGLLLIPRGGDAVFWVRKSFERAQCESLFPDIRPMKSYRDAAAATRPVQGPAYLELDSV
FT                   TLAQYGRMQKHFAFSAPPLALDAQVAAVRAVKSQYELSLMEKAGKIHRHVFEDCIPDLL
FT                   VEGMDEIEFGTRLYSLMMQEGHQGIVRFRMFNEMLLGQVGFGVSTITPTCVDTPGGISG
FT                   LHPAIPLMGNREKKLNKGDLVVVDTGCGVEGYHTDKTMNYMFGKAIPDAAIKVHEKCVA
FT                   VQDEVASMLKPGAVPSEIYATVVAGLSPEFKDGFMGFGQNTVKFLGHGIGLEIDESPVI
FT                   APGFDEPLQEGMVFAIEPKKGIAGLGLVGIENTFVVTPQGGRSLTGNNRGLIPVGFLTG
FT                   "
FT   gene            complement(159870..160802)
FT                   /locus_tag="Mboo_0163"
FT   CDS_pept        complement(159870..160802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0163"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A2163 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54686"
FT                   /db_xref="GOA:A7I4M5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M5"
FT                   /protein_id="ABS54686.1"
FT                   /translation="MSLPLRLTPTGTAAVVLLVATLALATLVPDAPQQAISSNIVFVGV
FT                   IVFLLAAFVAGLFVYPEKAVTVGDLFLVVSTGLLIWEIAFGKLVLLDPLLFPGPAKVFA
FT                   VFGADYSLMLTGLVNSLALLGAGYALALATAIPIGLYLGWKKRLFDVAYPIAKAVSPIP
FT                   PTAYLPYTIVLLPTFATSSIFLIFIGAFWPILVGSVYGVFSIDRRLINSAKTLGLSERD
FT                   ILRKVLFPGALPSIFSGAFIALIMSFITLTVAEMIAATSGLGWYIQYNHDFANYDKVIA
FT                   GIILIAVVVIVLMFFFDRIQKYCLRWQST"
FT   sig_peptide     complement(160725..160802)
FT                   /locus_tag="Mboo_0163"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            complement(160799..161626)
FT                   /locus_tag="Mboo_0164"
FT   CDS_pept        complement(160799..161626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0164"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO7545 putative ABC-transport protein,
FT                   ATP-binding component."
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54687"
FT                   /db_xref="GOA:A7I4M6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M6"
FT                   /protein_id="ABS54687.1"
FT                   /translation="MATIELQDISMVFGLNGSNHEALNKVCLHIREGEFISLIGPSGCG
FT                   KSTIIDVVSGLRAPTTGRVLIDDQPVTGPGTDRGTVFQDYSLFPWMTAFENLRFAIEHA
FT                   NGKRDPDSFDAEAERFLKLVGLEKFRNAYPNTLSGGMRQRISIARMFSLDPKVFLMDEP
FT                   FGALDSLNRIYMQDLLLRLWTRGEKRKTVLFVTHDVDEALLLSDRIAIMSPSPGRIKEV
FT                   IEIPFERPRCRKTLGAQPEYLALKSHLLSVLYCEMLDDLDRQLEEPVAGGTPA"
FT   gene            complement(162068..162733)
FT                   /locus_tag="Mboo_0165"
FT   CDS_pept        complement(162068..162733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0165"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: gsu:GSU1341 ABC transporter, ATP-binding
FT                   protein; TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54688"
FT                   /db_xref="GOA:A7I4M7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M7"
FT                   /protein_id="ABS54688.1"
FT                   /translation="MIEVSGLVKTYPAGRKEFRLFDGLSFSSEKGEFVLITGRSGSGKT
FT                   TLLNILGGLTRPTAGSVKINGREISQMDDDESSAFRSKTIGFVFQFPGLLSALSALENV
FT                   TLPQSLAGHPANADAARALLDRVGLSGKEDASPAYLSGGELKRVAIARALVNQPALILA
FT                   DEPTADLDVETEREIMELFAGIHAAGTTIVMVTHNPDLAAYASRVLRMERGGLTEKTP"
FT   gene            complement(162730..163917)
FT                   /locus_tag="Mboo_0166"
FT   CDS_pept        complement(162730..163917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0166"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   tde:TDE1518 permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54689"
FT                   /db_xref="GOA:A7I4M8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M8"
FT                   /protein_id="ABS54689.1"
FT                   /translation="MIRLIGKNIAYRPVRNGALFVCFAFIAASIFLGHVLMAGATGSIH
FT                   QELSRLGADLVVVPAQYTSESEDVLLRGEPSTFFFDRSVLDEVSNVSGVAQAAPQSYFG
FT                   TNPDNHDSPLVQIIAFDPDRDFTITPWLSEHQQKPLGHGEVILGSGLAGDIGSTNYYYG
FT                   QPYVVAGRLEPTGTGVDFSVFIREDDARMMAHLSEFYAEEMFALPDNDISVVLVKVQDP
FT                   SQAALVAERITEQVPGVKVLTPQSLVSTVATQLDATVKLLDLAALVAILVSLPLIAIIS
FT                   LMAANERMREIGILRALGATKKRIFSLILGESLVLALAGGITGVLASLGGLLLSEQYIA
FT                   SSLGIPLALPATGEFATLALTTIIVTAAIGVAAAVIPALHAARTEPYLAMRSGEL"
FT   sig_peptide     complement(163801..163917)
FT                   /locus_tag="Mboo_0166"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.930 at
FT                   residue 39"
FT   gene            complement(164070..165227)
FT                   /locus_tag="Mboo_0167"
FT   CDS_pept        complement(164070..165227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0167"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: mka:MK0601 homolog of
FT                   ABC-type nitrate/sulfonate/taurine/bicarbonate transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54690"
FT                   /db_xref="GOA:A7I4M9"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4M9"
FT                   /protein_id="ABS54690.1"
FT                   /translation="MPFSHRHPPGRGPERVTNMVKKEYTYIIAAVVIIAVAVVAFYAFS
FT                   GSNTANTPVVSSSPAQQQLQPLNVGYLPNNGHAIIFIAQEKGYFEKEGLNVNLVQFQNS
FT                   AEGTNAIISKKIDVGGFGLVPLIYISKGYNETIIGGLDGDAAGLVVTSDKADQYQNLTK
FT                   FSDLTVFKGKTIATVRASTGDIHFRDALTKAGLNLTTDVTIVELANPQLVLDAVKSGKA
FT                   DAGMVWTPYMEQSETEGFTVVLYTGDFYPNHPCCRIAVLTDNLNANRDTYVKFERALIE
FT                   SYEWLKQNPNASVDIVGKYVPVNRSVLQDAMTDNETYNSPDPNLHAIDNVYAMMKNMNY
FT                   INTTVNIDDHVDTSVYKQALDELAKENPSDPFYAQQEAIYQTQDG"
FT   gene            165505..166707
FT                   /locus_tag="Mboo_0168"
FT   CDS_pept        165505..166707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0168"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase, class I and II;
FT                   KEGG: sus:Acid_3616 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54691"
FT                   /db_xref="GOA:A7I4N0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N0"
FT                   /protein_id="ABS54691.1"
FT                   /translation="MARIISSATPPRPGTSRTPVRPLSVSRADRFTESVIREMTRLSLQ
FT                   YGAVNLAQGFPDFPCPDELKAAACQAINADINQYAITWGAPELREELSRRVKAYNGMEF
FT                   DPATGVTVTCGSTEAMLASLMAVIRPGEEVVVPEPFYENYGPDTILSGAVPRYVSLGDD
FT                   FSIDEEAWKEAFSKKTRAVVINTPNNPTGKVFSKKELSFIADLCVENNAIAITDEIYEH
FT                   ILYDRKKHVSIGSLPEMQDRTITLGSFSKTYSVTGWRVGYALAHPELTGRIRKIHDFLT
FT                   VGAPAPLQQACAAALRLPESYYRELAESYDRKRRILFAGLKKAGFSCTLPEGAYYIFTD
FT                   ISEFGKTDVEFARHLVQTAGVAAVPGSSFYHTGGETKLRFTFSKKDETLQEACRRLETI
FT                   A"
FT   gene            166726..168027
FT                   /locus_tag="Mboo_0169"
FT   CDS_pept        166726..168027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0169"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: rru:Rru_A0790 phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54692"
FT                   /db_xref="GOA:A7I4N1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N1"
FT                   /protein_id="ABS54692.1"
FT                   /translation="MTEKKYWDKEIETMPRDKLEKYQLRLLKNEIAFARKGSAFYKKYL
FT                   PDITLKSIDDIQKLPFVTKQIIRERQQAKEPFGDMVAVPEEEIVYISASSGSTGVPTAS
FT                   PFTAQDFDDFIDCQARLFWRSGMRPKDRYIHALNFSLFIGGPCVLGAQRLGALAIHAGS
FT                   IPSERLLNFVRQFKPNWTWTTPSYAWYLGETAKNADLNPAKDLSLRNFICSGEPGGGIK
FT                   ETRENIEALWGANLYEYYGLSDIFGACAGSCTEKSGIHIEEDHMIVEVLDLKTGEPVGE
FT                   GERGEMVLTTLKKRARPLIRFRTGDIVTYTDEKCNCGRTHKRLSGVHGRTDDMLIIKGV
FT                   NVFPSDVEAVVRSLDFLTGEYRLIVDREKHLDTLAIEVENTKKTIPEVQDILATAIKAR
FT                   LGVKADIIVHKPGTLPRETHKAKRIIDKRTKVWG"
FT   gene            168167..169054
FT                   /locus_tag="Mboo_0170"
FT   CDS_pept        168167..169054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0170"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: sat:SYN_00691 pyruvate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54693"
FT                   /db_xref="GOA:A7I4N2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N2"
FT                   /protein_id="ABS54693.1"
FT                   /translation="MVVIAEIPSTEYVLNCTSACAGCGDSLALRYVLKAAGPDTILVMP
FT                   AGCTAAFQGVYPKTAYALPVVNIAFAAAAASASGLSTFLRAKGKKTKVVVYAGDGATLD
FT                   IGLSAVSGAFERRTDFLYVCYDNEAYGNTGMQRSGATPIGAKTTTTPAGKPEIKKDIDT
FT                   IIAAHEPPYQATACAAYPQDLFRKVQKALTFEGPTFVHILTPCPPGWRYSAEKTVELGK
FT                   LAVKSGIWALYERENGKLVISAPTKAAMKKPVPLEEYLAPQGRFKGIDSATVALLKGRI
FT                   AENFRRLAAEEAGS"
FT   gene            169051..170163
FT                   /locus_tag="Mboo_0171"
FT   CDS_pept        169051..170163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0171"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   sat:SYN_00692 pyruvate synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54694"
FT                   /db_xref="GOA:A7I4N3"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N3"
FT                   /protein_id="ABS54694.1"
FT                   /translation="MRKISTGNKAVAEAVALARPDVVAAYPITPQSDIVETIAEFVAAG
FT                   KLDTKYIPVESEHSSMAACIGAGIAGARTFTATSSHGLTYMHEMTNWAAGARLPVVMAN
FT                   VNRSLAPGWNIWVEHSDAIQERDTGWLQIWVSTVQEAYDTTLMAFRIAEHNDVLLPVMI
FT                   NLDGFTLSHIMQPLDTVEPGDFIPPIHLPDPVDPAHPAGYGTIAGPADQFRFRYKMEQA
FT                   MQDAKAVIAETEQDFARRFGRTYSAAEEYRAGDADVVVVALGTLGKEAEVAVDILRDEG
FT                   IKAGSVRPRWFRPFPDLDLAGKELVVIDRDYSFGFGGVLAHEIRSKYLTKVFSVIAGLG
FT                   GQEVTYDDIAEFVRKRRIGEEFWFGVSDHV"
FT   gene            170156..170683
FT                   /locus_tag="Mboo_0172"
FT   CDS_pept        170156..170683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0172"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; KEGG: sat:SYN_00693 pyruvate synthase gamma
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54695"
FT                   /db_xref="GOA:A7I4N4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N4"
FT                   /protein_id="ABS54695.1"
FT                   /translation="MFEVRIHSRGGQGGVTAAKLLAGAALHDGKYATACPFYGAERRGA
FT                   PVVSFVRIDDRPIKIYSQIREPDLVVVLDASVMETVDVLHGLKTGGRVFVNSAHPREFA
FT                   GYRAAHADLTGIALKESLVVAGSPILNTPVIGALAKAGIVSPGSATAAIREMFSDERNV
FT                   RAAEAAYREMSA"
FT   gene            170680..170937
FT                   /locus_tag="Mboo_0173"
FT   CDS_pept        170680..170937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0173"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; KEGG: mhu:Mhun_2393
FT                   2-oxoacid:acceptor oxidoreductase, delta subunit,
FT                   pyruvate/2-ketoisovalerate"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54696"
FT                   /db_xref="GOA:A7I4N5"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N5"
FT                   /protein_id="ABS54696.1"
FT                   /translation="MSPYRNEHVAISRPVAGSAGHTGAWRVFKPVVNRENCNGCGICAL
FT                   YCPDAVIGEDLVIDLAFCKGCGICANECPKKAIAMVREEK"
FT   gene            171004..171714
FT                   /locus_tag="Mboo_0174"
FT   CDS_pept        171004..171714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0174"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mhu:Mhun_0442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54697"
FT                   /db_xref="GOA:A7I4N6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N6"
FT                   /protein_id="ABS54697.1"
FT                   /translation="MIGISTYCLIEEPLSVALDRLTALTDLIEVMDEGPHFVDSTEPFE
FT                   SYTADFILHAPYHGMNIACLFESVRRASVDVMTACFAQAAEIDAAVVLHPGYFAWAQER
FT                   EQAAAQFAKSLAELCAAACEYSVSFSFENMGNMDFFNLRTPADLALIGDCGFTLDVGHA
FT                   NLNGCLPGFLDTHFSHLHLHDNDGRRDTHSPVGEGTIAFPAVIAAMRQKKATAIVEVKS
FT                   YPGAIASLKLLETM"
FT   gene            171893..172405
FT                   /locus_tag="Mboo_0175"
FT   CDS_pept        171893..172405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54698"
FT                   /db_xref="GOA:A7I4N7"
FT                   /db_xref="InterPro:IPR019216"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N7"
FT                   /protein_id="ABS54698.1"
FT                   /translation="MAQKTCPYCGAPVDPNRSACPNCRKVLAAKSPMTPYIVVGVLIVV
FT                   IVVIVAVLLINPVQGPGPGTSIVPSVTVQPTSADASSIPPQPTCFVDITPSRASSSAIQ
FT                   LQVISTTCGSGDITALQVSINGVNKGTLGTSPGASATFAAPSSSSIVVTAKFANGAESV
FT                   VYQNPAL"
FT   gene            complement(172464..173303)
FT                   /locus_tag="Mboo_0176"
FT   CDS_pept        complement(172464..173303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0176"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mhu:Mhun_1110 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54699"
FT                   /db_xref="GOA:A7I4N8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N8"
FT                   /protein_id="ABS54699.1"
FT                   /translation="MTAPPPPPQQYLATGFRDVDGSTDTPACTRCLDLIAGIPFFRRVK
FT                   DESFRILAGTRPGLVLDAGCGAGNDLLALAGLLSPDSRLIGLDASARLLATAAERIADH
FT                   RARCCLVRGDLLSVPFRKSTFAACRIDRVLQHLHNPGRVVQELVRVLEPGGTLVAFDND
FT                   WDTLTLSLDNRHAAAALTRFWSDSFASGRVGKDLATLFSDAGLTDVVAEPRALALTDPE
FT                   IAEKVFDIPALLDRMNAAGLLNAGEVHEIKEDLARNARRGTFASGYTGYLVRGRKPV"
FT   gene            complement(173860..174762)
FT                   /locus_tag="Mboo_0177"
FT   CDS_pept        complement(173860..174762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54700"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4N9"
FT                   /protein_id="ABS54700.1"
FT                   /translation="MDSSKKHSLDEIQDPIVTVINEALKKYPHLEKIIPQCTPRSKLHF
FT                   DQFKGEIPKSRKHEISESKIYEVLLGSGESKQFSCQLSFLESLLTKYPEYCTKSFGQQL
FT                   VGAFFSHYLEIEIYDNLRECGYDPLIDPDIIPNLKNSTKADFKINQSGHDIFIEVVSPR
FT                   LPLDEELMFEEKPKMRFFEDSERNDTFNKIYKEYSHHFKPFEPRYNSPTLIILDKTYSM
FT                   GLSEVLGSLDLSRIYSEYEFPDYFIGILDRTRYNRDLIYKVLKRPRPTRFYLNPEYVDY
FT                   HTLIPELFRRFIHFTAISG"
FT   gene            complement(174772..175374)
FT                   /locus_tag="Mboo_0178"
FT   CDS_pept        complement(174772..175374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54701"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P0"
FT                   /protein_id="ABS54701.1"
FT                   /translation="MSSTAPEMGGRRDASFEREPARRVFASELRECRYQFKDGEDEKSP
FT                   TFVLLPTGERSNRIFISGTLTEKSRQGEQNVFYRGRVIDPTGTFFVMAGSYQPEAMQQL
FT                   AKIETPAFVSVTGKPNLYQKPDGSYLVSVRVESITVVEKETRDLWVLDTAARTLDRLDA
FT                   LATGTSPDITKAKEQYPMLDPAVYRKNVFDALAQIKM"
FT   gene            complement(175371..176621)
FT                   /locus_tag="Mboo_0179"
FT   CDS_pept        complement(175371..176621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0179"
FT                   /product="nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; KEGG: mhu:Mhun_2542 nucleic acid
FT                   binding, OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54702"
FT                   /db_xref="GOA:A7I4P1"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P1"
FT                   /protein_id="ABS54702.1"
FT                   /translation="MDYSEATERISRKYAKTGHEIDRQKIEGKLRRLVEEFGVQPAEAE
FT                   RSVTNELNKEFNITPAGVPGTPGPAGGATSEKKIADARPGDWVTIEGKVVSLSAPASPA
FT                   IAQSGILADESGAIRFVVWAKSNAPKMDEGAWYRLDSAVVDEYKNIPNLKVHSGTTITA
FT                   IDRTDPLIPAPCAIKDLHPGIGSVRAKVVQEWDTTHDRMLQSGLIGDETGTVKFIIWKE
FT                   QGKEKLAVGAVYSIFYAQADEFNERLSLNITGAAIMQEEGDIATVTGGDTEVRGALVHI
FT                   APGSGIIKRCPVPGCNRALSRQNYCPIHEIQPRFEYDLRIKGWLDDGEKTHNILLKRDV
FT                   VEPLTGMTLDQAKEIAENNPLGMDEVFLQMRDRVLGRYVVCKGREIENRLLVNTCEKMH
FT                   FESGEHAKLLNRAGGAS"
FT   gene            176771..176965
FT                   /locus_tag="Mboo_0180"
FT   CDS_pept        176771..176965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54703"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P2"
FT                   /protein_id="ABS54703.1"
FT                   /translation="MADLTADSTIYDLLQAKPEATEALFKFGMGCVGCAIARGETIREA
FT                   AEAHGIPLAELLNALGIKE"
FT   gene            complement(176955..177845)
FT                   /locus_tag="Mboo_0181"
FT   CDS_pept        complement(176955..177845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0181"
FT                   /product="protein of unknown function DUF105"
FT                   /note="PFAM: protein of unknown function DUF105;
FT                   cysteine-rich small domain; KEGG: mhu:Mhun_2543 protein of
FT                   unknown function DUF105"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54704"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P3"
FT                   /protein_id="ABS54704.1"
FT                   /translation="MRYYTKNSTLFVRGAFRAASTGIDGGIRDVTTLFNHTVPADWSHD
FT                   SPKKEIELVAAAAGIGPCVFGLLTAVPLRHLCVLQYDFVTVFVTAGIREHPPQEAGTIN
FT                   IIVYSSEGMEDSALLEMILVATEAKAEALIAAGRDSGTPTDAVIAACEGEKLHRYAGRI
FT                   TEPGQRLREAVLKGVPEALRRYERGAENEEPAFFIYSRLEGGHWVEWSPVNCPYYPCHF
FT                   PGQRCDFCYCPFYPCKNEALGDWSVSSSGGKVWSCSRCTLIHEPAVADYLKRYPDAPLD
FT                   ELVQYQKQQKKKIIP"
FT   gene            complement(177842..178204)
FT                   /locus_tag="Mboo_0182"
FT   CDS_pept        complement(177842..178204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0182"
FT                   /product="oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase-like protein"
FT                   /note="KEGG: mhu:Mhun_2544 oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54705"
FT                   /db_xref="GOA:A7I4P4"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P4"
FT                   /protein_id="ABS54705.1"
FT                   /translation="MDWSTEQRTTAEKYKKLEDIPESERKYKCHTCHLIVDQNPCPNCG
FT                   ETKLEIMCPLDNCHCSHEMISGIEYCPLCGKPVCPECGSHDVVQISRVTGYLQDVSGWN
FT                   SGKQQELKDRMRYSVA"
FT   gene            complement(178320..178967)
FT                   /locus_tag="Mboo_0183"
FT   CDS_pept        complement(178320..178967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0183"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: mhu:Mhun_2545 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54706"
FT                   /db_xref="GOA:A7I4P5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P5"
FT                   /protein_id="ABS54706.1"
FT                   /translation="MPDLILALDVTEKKKALAIAEACAPHIDAIKVGYPLALAAGLSIA
FT                   GDLKKTGLPLIADFKVADIPNTNQLICDQVFLAGFSAIICQGFCGMDSVKACVASARTH
FT                   HGECYVVAEMSHPGGKEFFSGGIAEQIAANAVIAGADGIIAPATRPDRVAVLRGFVGDK
FT                   KILSPGVGTQGGSVDSIAELVDGIIVGRSIYDAPDPAAAAQSYAAARRRQKR"
FT   gene            complement(178960..179898)
FT                   /locus_tag="Mboo_0184"
FT   CDS_pept        complement(178960..179898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0184"
FT                   /product="putative deoxyhypusine synthase"
FT                   /note="TIGRFAM: putative deoxyhypusine synthase; PFAM:
FT                   deoxyhypusine synthase; KEGG: mhu:Mhun_2546 deoxyhypusine
FT                   synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54707"
FT                   /db_xref="GOA:A7I4P6"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P6"
FT                   /protein_id="ABS54707.1"
FT                   /translation="MKHQCDEPVSQMHIRPGMTVGELVNAMGKAGAYNGGSLCHAAGIY
FT                   EQMLKDKETTKFFGLAGAMVPAGMGGIVSDLIRDGHIDILVSTGANLTHDIIEAIGCHH
FT                   FHGTAFCSDIELRHDEINRIYDVYLPNEAFEHFEEFMQGVYGKLEPRSTVSISGLLHHI
FT                   GLHLKTGILATAAKKGIPVYCPAVQDSMVGLQYWLFSQTNKVTVDAFADMPALLDTCFT
FT                   AKKAGAFIVGGGVPKNFILQSMLMTPNGFSYAVQLTGDRPDLGGLSGATLDEAKSWGKI
FT                   TEEAQAVTVYGDATITLPVLVAAVMERLSHA"
FT   gene            180023..180532
FT                   /locus_tag="Mboo_0185"
FT   CDS_pept        180023..180532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1825 TrkA-C"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54708"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P7"
FT                   /protein_id="ABS54708.1"
FT                   /translation="MQDVRLTIKKRAFPSHGRVRLNAAILPDLGVAEGEHVDLINEAAK
FT                   KSVSVTVIADSMVPAGQIRVSEEDLKKIGLSEGSEVLVRKSVALKEKLSKAAAEANASL
FT                   EKEAKKIDAAAKKTAGDVSAGAASAAKTIKKETDKATKSIGKAVSKTTKDVKKAVKKAT
FT                   GKENDL"
FT   gene            180591..180998
FT                   /locus_tag="Mboo_0186"
FT   CDS_pept        180591..180998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54709"
FT                   /db_xref="GOA:A7I4P8"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P8"
FT                   /protein_id="ABS54709.1"
FT                   /translation="MADVTDAAAAAVSGVPDMVYVGIFIILGLLVVYLIIREIRIMRTT
FT                   NRSIELELERDKLKLLQQHEAQKSFPFTRFSPEQTAAIRQVEDETQALGNDNYAKENLL
FT                   EKRLSRLENIAKSKKLDNLLHNVGEQEKKVK"
FT   gene            181001..181315
FT                   /locus_tag="Mboo_0187"
FT   CDS_pept        181001..181315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54710"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4P9"
FT                   /protein_id="ABS54710.1"
FT                   /translation="MSFISQDAEINPTGSSFLDRFAEIPGAIESRIPTFDRSLDAYFDQ
FT                   HFAAIIEEWGLVTEGDLQGLEARLARVTDEISSLYAGRAALESRVQRLDNLITSLERSK
FT                   "
FT   gene            181312..181533
FT                   /locus_tag="Mboo_0188"
FT   CDS_pept        181312..181533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54711"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q0"
FT                   /protein_id="ABS54711.1"
FT                   /translation="MIGMDSYLNAYVDRRMKLIVDEWDLSTREDLGEFTGRLAALEQEI
FT                   PRLKAFEKTSSDKLAELEKRAAKLKGGA"
FT   gene            181535..181891
FT                   /locus_tag="Mboo_0189"
FT   CDS_pept        181535..181891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54712"
FT                   /db_xref="GOA:A7I4Q1"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q1"
FT                   /protein_id="ABS54712.1"
FT                   /translation="MDLFTFILLVLVLCAVLFLVFYYFRGAKGNISLTRPVESRVDEYL
FT                   DRRFQSMVEEWQLVTRSRLGQFQDRRVPEIEQNEARIAELKSYETGMQTTLTSLEARLD
FT                   VLEKELAGKGNAKK"
FT   gene            181935..182147
FT                   /locus_tag="Mboo_0190"
FT   CDS_pept        181935..182147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54713"
FT                   /db_xref="InterPro:IPR025872"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q2"
FT                   /protein_id="ABS54713.1"
FT                   /translation="MMRKQGEPPVKDPHSFAQFTCDLCNTAHPIAELRQCVLCGRWACN
FT                   ACWKDEYYTCRSCAGLIKIHQLKGE"
FT   gene            182233..182895
FT                   /locus_tag="Mboo_0191"
FT   CDS_pept        182233..182895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0191"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: tte:TTE1844 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54714"
FT                   /db_xref="GOA:A7I4Q3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q3"
FT                   /protein_id="ABS54714.1"
FT                   /translation="MLLPFNIIDVVLHFDKYLPVILQQYGLWTYVVLFLILFLETGIVI
FT                   APFLPGDSMLFVAGALAGTGLLDIRILLATLVIACVLGDTVNYWIGYTFEMKVLEWRYS
FT                   LVKKEHLEETHRYFEKYGGFTIVIARFMPFIRTFAPFLAGVGKMRYSWFVGYNILGGVL
FT                   WASLFLLTGYFVGNLPIVQANFGLITYAIIAISLVALVSVFAKIYLTMKKEKGSGKA"
FT   gene            complement(182908..183459)
FT                   /locus_tag="Mboo_0192"
FT   CDS_pept        complement(182908..183459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM3151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54715"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q4"
FT                   /protein_id="ABS54715.1"
FT                   /translation="MAHDTTTLRTGTVTFKSVAQIYDSDDPSPGAHRDLSEKAEDRIFR
FT                   TVLSASRGWRTRLCGQIEIRVPDPAPGQGEAIVSAIREHFLRRADEMAESTALTVRVGL
FT                   RECRLTAAVCAPSFIGIAICSQFKGNPFVEVAENVLVIMCWVVIWQPFQSLVFDRWTQK
FT                   ETAAIYKKIARMPIRVVTGE"
FT   gene            183594..185648
FT                   /locus_tag="Mboo_0193"
FT   CDS_pept        183594..185648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eli:ELI_00730 type II restriction enzyme,
FT                   methylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54716"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q5"
FT                   /protein_id="ABS54716.1"
FT                   /translation="MRPPGTGEFGETAVPVLAGPEAALYNDLCTWREQLARSIARTHIG
FT                   MRSSRIGQAANQVLFSLLALAIAEDRHLVDPGTVWTIAETGDGESCLPEILSTFGDLWA
FT                   GTDGTAGTGRNPEGIPVIDDALIREIAGRLTGADRPYDLSQIPLASVAAILDRYLTRTV
FT                   RRSAAHQAIVIDRPETGAWQVEITPALADYAAGRTLAAVCAGRSPDDPLPLRVIDPACG
FT                   AGRMLLAAYRYLRSLPGNDEPSDLLRHTLHGIDPDPHAVAAARMMLALAACSDRDGSAN
FT                   SPEFIPAFREYLAILSATIQCGNALVGPTIADDESWAFCPVRERHELRPFAWQEYFPEV
FT                   LLPGGFDAVLCCPPEYPVPAREWLRQYFQRHYTVYDPGAGLSAYVVEKSLAILRPYGVA
FT                   GIVGSDRWLRARSGAPLRTFLLGRQPEEILTAGKDSCFLLMANARTFRPFIVRNAGPAP
FT                   AGADAIREIPGFPVDPRDLAAGGWVFRDTRGKRLVEKISRDTTPLGEYVLGEIRYGAGT
FT                   RPVPSSHGGRDRIIFSASAVPPRFELAGNRAAPGPGTGIIMSGSRYLLGLLNSRLAEFL
FT                   FHSIWEETGDPGDVVALFPVATPDFDDPVQAARHGRLESLVTERLALARHRTLARSPRE
FT                   LQAINAEMVSTEKQIESLVYGIYGLSMDEISFVESSLPSEKPLSSGKRS"
FT   gene            complement(185914..187137)
FT                   /locus_tag="Mboo_0194"
FT   CDS_pept        complement(185914..187137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0194"
FT                   /product="domain of unknown function DUF1743"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; domain of unknown function DUF1743;
FT                   KEGG: mhu:Mhun_2547 nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54717"
FT                   /db_xref="GOA:A7I4Q6"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q6"
FT                   /protein_id="ABS54717.1"
FT                   /translation="MLIGIDDTDSPTGMCTTYLGAVLARRLIREHMKVREARLVRLNPN
FT                   VTFKTRGNAAIALDVDGDPARGFELACGIVEELADFSCDKTNPGVVVAGERLDPAFYRK
FT                   AVTDFCEIEEATELLERSGARYRGWKNRRGLVGATAAVASVLPDKTYEILAYREPAHWG
FT                   TPREVDRESLFVAEEATFPHTWDTVDLANRVVVCVPHTPDPVLFGIRGESPAWVMTGRS
FT                   LIESEKPALEQIWVTNQGTDSHLVPGTCGSLREGLSYRVRGVVTGRPVTGEGGHVSFAI
FT                   RDNEAEIRCMAYEPTKNFREIIRALVPGDEIIAAGSYKKGSINLEKICVLSLARDLRHK
FT                   APFCTVCKKRMTSDGKGKGYKCRRCGAHELEPEEQEIPRTIRTGWYEVPPTARRHLAKP
FT                   LCRGMPDR"
FT   gene            187181..188134
FT                   /locus_tag="Mboo_0195"
FT   CDS_pept        187181..188134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0195"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mhu:Mhun_2548 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54718"
FT                   /db_xref="GOA:A7I4Q7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4Q7"
FT                   /protein_id="ABS54718.1"
FT                   /translation="MSQDRQLQLVTSVMISAGFEVSEKFTLRPRSFDLIARNNGTLVVI
FT                   KVVTHIDSVSEEAAFDLDVIAAHLGGVPLIVGERAREAELERGAVYVRYGIYAISVSTM
FT                   YDYFVEKIPPLVYASPGGLYVNINGDALRELRERRSMSLGDLGQVLGVSRRTISKYESG
FT                   MGTTLEVAIRIEEYFNTGVVESIDIAKREPAKSDSPTSKKPQGPGVPFGFLEELGMQLH
FT                   TLRGAPFQALLTFDRHTILTGYGPAQKVVKRAALISNLSRIAKKHAMCVITDYHHEKKI
FT                   GRTLVIGEERLHSIEDGFELLDLLGDIGADPSPRDS"
FT   gene            complement(188190..189941)
FT                   /locus_tag="Mboo_0196"
FT   CDS_pept        complement(188190..189941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54719"
FT                   /db_xref="GOA:A7I4Q8"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q8"
FT                   /protein_id="ABS54719.1"
FT                   /translation="MAGENDLKLEALSKYIVTTPSWAKSTALILLLCGCVEIMAMLGSH
FT                   HSLTHPSLFPVFAYLLPALAALALTPALAGLFGGKLTYGWSGLTAAIGLVISLFVSLSP
FT                   VLFFTSSFPVFFAASLAFVFAFRMLLLAAVVDFHLRRVVVPALIHSGIAVIGAAPFLGL
FT                   PFVQLSVLLHISFAAGVLVFIIVVERPMKANFRVGPLELANAFLAHLSEGSHKLDEFFR
FT                   SIGESVVVPQVSLALQREGKEEILVTVPNVHPGPLGEIGGSNLPKILHGILGSGSMVFH
FT                   GAASHDFNPVDEEEVKKLGAEVLATLPRTCTNNGCTVPVRHRFGSVDVLVQAFGDTVIA
FT                   AATRSPEVTEDLEFAVGFAIIKSGEKYFHNVGFIDAHNCMDALSDGVYPGTELAMEYMN
FT                   AAETAFAAASREPQAAFSAGYAARTFPFTRQDGFGDLGVQVLVIETRGRSTAYVLVDGN
FT                   NMQTGGRDEIRKRLHSLVDECEVMTTDTHVVNTVSGRNQVGLKVPVDSFYPVIEEAVRA
FT                   ARDDVAPARSAGVTHYCHGIVVFGSQRISQLASTVNGMMGFLLPIAIIVILGAFLTTAM
FT                   AYYLLVY"
FT   gene            complement(189975..190523)
FT                   /locus_tag="Mboo_0197"
FT   CDS_pept        complement(189975..190523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0197"
FT                   /product="Uncharacterized protein UPF0114"
FT                   /note="PFAM: Uncharacterized protein UPF0114; KEGG:
FT                   gsu:GSU2648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54720"
FT                   /db_xref="GOA:A7I4Q9"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Q9"
FT                   /protein_id="ABS54720.1"
FT                   /translation="MNEPAPTITGTDQGSKKRWIANMFTITRLLVILAITGLFIAAVIV
FT                   ITYGFVELFRIVVHVSGIGFMNEGAGKYLSVNMTEMIDLNLIGIVLVIMAIGLFQLFIK
FT                   PDIRLPKWLDTPSLDALKERLLVVIVVLLPIIFLGFAATWSGGIDIAAIGFAIALVMIA
FT                   TGYILSIVGRFKNETKGPD"
FT   gene            190564..190977
FT                   /locus_tag="Mboo_0198"
FT   CDS_pept        190564..190977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54721"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R0"
FT                   /protein_id="ABS54721.1"
FT                   /translation="MRDEGSGRQHCRQEPSDCCINNNLIGGHAVFGEMTGPDNMVLPPV
FT                   MGCKQFGRPYRQVCRSPDWPYTSLIGSVHRNGNVLEVLCIISPLVRDLNGPVSGSRHCC
FT                   SNGKCRSGSRPFRHVTWLSQGNCRRSRPGCAPG"
FT   gene            191233..192891
FT                   /locus_tag="Mboo_0199"
FT   CDS_pept        191233..192891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0199"
FT                   /product="thermosome"
FT                   /note="TIGRFAM: thermosome; PFAM: chaperonin Cpn60/TCP-1;
FT                   KEGG: mhu:Mhun_2549 thermosome"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54722"
FT                   /db_xref="GOA:A7I4R1"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R1"
FT                   /protein_id="ABS54722.1"
FT                   /translation="MSQQLGGQPIFILKEGTNRTRGRDAQGMNITAAKAVAAAVRTTLG
FT                   PKGMDKMLVDTIGDVVITNDGVTILKEMDIEHPAAKMMVEVAKTQDDEVGDGTTTAVVI
FT                   GGELLKKAEDLLEQDVHPTVITHGYRMAAEKAQEFLKDIAFDVKANDKALLKNIAGTAM
FT                   TGKSAEASKEKLCDLVVKAVIMVAEEDGTVDIENIKVEKKTGGSIEDSEIVEGVLVDKE
FT                   RVHPAMPKKVTNAKILLLNAAVEFKKTEVDAEINITHPDQLQAFLDEEERMVKGIVDKI
FT                   QKSGANVLFCQKGIDDIAQHYLAKAGIFAVRRVKKSDMEKLARATGGSLVSSIDAISKE
FT                   ELGKAGIVEERKVSGEEMTFVEQCKNPKAVSIIVKGGTEHVVDELERAIHDALRVVGVV
FT                   VEDKKVVAGGGAPETELSLRLHEYAATVGGKEQLAIEAFAQALEIIPRTLAENAGLDPI
FT                   DMLVEIRATHEKGKKTYGLNVFEGKAVDMKAAGVVEPLRVKTQAISSAAEAAIMILRID
FT                   DVIASSRSPEPAGGAGGMPPGGMGGMGGMPGMGDF"
FT   gene            complement(193198..193803)
FT                   /locus_tag="Mboo_0200"
FT   CDS_pept        complement(193198..193803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54723"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R2"
FT                   /protein_id="ABS54723.1"
FT                   /translation="MENSCVQRMKLLMGFIILLVALVTVTGCTQTASTSTPATTATTAP
FT                   ATMQATTVATTVPTMVATTIPVVNTTTIMANVTAPAANATTVPVTTMANVTVAATPTPA
FT                   SMVTTVVLTSSGFAPQTDVILPGTGISFVNNDNVTHTIKSTGNSTGVFNSGALIPGAAF
FT                   QYTFNSNAGTVTYALADNSSVTGTVIIQSLSAGHTSVA"
FT   sig_peptide     complement(193681..193803)
FT                   /locus_tag="Mboo_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.385 at
FT                   residue 41"
FT   gene            193976..194377
FT                   /locus_tag="Mboo_0201"
FT   CDS_pept        193976..194377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54724"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R3"
FT                   /protein_id="ABS54724.1"
FT                   /translation="MSDRFISTKYRTDCYHCRALADQQIQATPNRADVTCENCKATRVF
FT                   VPLIEDVDETGMFTRPGPWPAWSLAVPAVCRNCGVDGLHDLVVSCRHITVRCRNCRFTH
FT                   LFRFSLEYMAPDKPDEQTSGIVDGHATCP"
FT   gene            complement(194472..194732)
FT                   /locus_tag="Mboo_0202"
FT   CDS_pept        complement(194472..194732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0202"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; KEGG: mhu:Mhun_2393
FT                   2-oxoacid:acceptor oxidoreductase, delta subunit,
FT                   pyruvate/2-ketoisovalerate"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54725"
FT                   /db_xref="GOA:A7I4R4"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R4"
FT                   /protein_id="ABS54725.1"
FT                   /translation="MSDKAQRERLAVSRPTEGAAGQTGAWRVFKPVVNKEKCNGCGLCS
FT                   MYCPDNAIDEELIVDLRFCKGCGICAEECPKKAITMVREEK"
FT   gene            complement(194729..195256)
FT                   /locus_tag="Mboo_0203"
FT   CDS_pept        complement(194729..195256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0203"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; KEGG: mhu:Mhun_2394 2-oxoacid:acceptor
FT                   oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54726"
FT                   /db_xref="GOA:A7I4R5"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R5"
FT                   /protein_id="ABS54726.1"
FT                   /translation="MFEVRIHSRGGQGGVTAARLLATAALHDGKYATACPFYGAERRGA
FT                   PVVSFVRIDDHPIKVYSQIRQPDLVVVLDASVMETVDVLHGLKKGGRVLINSSHKPEFA
FT                   GHTTFNVDLTGIALKENLVVAGSPILNTPVLGALAKMGIVSRESAKEAIRGMFSDERNV
FT                   KAAEAAYKEMSA"
FT   gene            complement(195249..196361)
FT                   /locus_tag="Mboo_0204"
FT   CDS_pept        complement(195249..196361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0204"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   sat:SYN_00692 pyruvate synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54727"
FT                   /db_xref="GOA:A7I4R6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R6"
FT                   /protein_id="ABS54727.1"
FT                   /translation="MKKIATGNKAIAEAVKQALPGVVAAYPITPQTEIVETIADFVTSG
FT                   QMKSRYIPVESEHSAMAACIGASITGTRTFTATSAHGLLYMHEMTNWAAGARLPIVMAN
FT                   VNRSLGPGWNIWAEHTDAMQERDTGWLQVYVSTVQEAYDTTLMAFRIAEHNDVLLPVMV
FT                   NLDGFSLSHIMQPLDTVEPGDFIPPLHLPHAIDTKNPTGYGGLTGPDQHFRFRWDIERS
FT                   IRDSVNVIEETELDFAARFGRRYGPVEEYRCEDADVVLLAMGTLGKEAEVAIDILRKEG
FT                   IKAGSLRLRWFRPFPKLDLAGKEVVVIDRDYSFGYGGIVANEILAKNKCDVYNVIAGLG
FT                   GQEVTYDDMAGFVRERRIGEESWFGVNSHV"
FT   gene            complement(196358..197242)
FT                   /locus_tag="Mboo_0205"
FT   CDS_pept        complement(196358..197242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0205"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: sat:SYN_00691 pyruvate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54728"
FT                   /db_xref="GOA:A7I4R7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R7"
FT                   /protein_id="ABS54728.1"
FT                   /translation="MIIAEIPKEEYMKKCTSACAGCSSSLTLRYVLKASGPDTVLVIPA
FT                   CCTSVIQGIYPNTAMNVPVYNVAFAAAAACASGMSEAFREAGKKTNVIVYAGDGGTLDI
FT                   GIQSMSGAFERGTDFLYICYDNEAYGNTGMQRSGATPLGAKTTTTPTGKTVEKKDIDAI
FT                   AAAHHLEYMATACSAYPLDIYKKVAKALTFRGPTFIHILAPCPPGWRYPTEKTIDMGKL
FT                   AVKSGMWMLYEREHGKLTISAPSKTAMKKPIPLEDYLAPQGRFKGIDAKSLEILKQRLA
FT                   ENLKKLAAEEAKS"
FT   gene            197705..198199
FT                   /locus_tag="Mboo_0206"
FT   CDS_pept        197705..198199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0206"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; KEGG: afu:AF1244
FT                   putative TrkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54729"
FT                   /db_xref="GOA:A7I4R8"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R8"
FT                   /protein_id="ABS54729.1"
FT                   /translation="MSPMALRSLNLPGVGTKYEFETDKGDTVAIFFTKAGTIQMYTLQK
FT                   GCHTPSAAEMTPVEARRLGNILTGAIIEADQESVEIAFSALADLRVTIHSYIIPRAIAG
FT                   KTIEDLGIRAKTGTTVIAVSRNDKNIINPPPSFVFETGDAVLVIGESDQLRLFEREIMV
FT                   D"
FT   gene            198199..199359
FT                   /locus_tag="Mboo_0207"
FT   CDS_pept        198199..199359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0207"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: afu:AF1245
FT                   Na+/H+ antiporter (NapA-2)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54730"
FT                   /db_xref="GOA:A7I4R9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4R9"
FT                   /protein_id="ABS54730.1"
FT                   /translation="MDGILAAQGLIIALFVCLVLALVTKYLSIPAIPFYIIAGVVLGKA
FT                   GLGLVASDPISSFFSELGLIFLLFFVGLGLKVDKISENQREVLASGIIDLNVNMLIGFV
FT                   AAYLLGFSLIEALIVAAAFYSSSTALAVTSLIENRKLMMREAGTIIWLMVFEDLVLIVI
FT                   LALLSAGNENLLLFAVEILAGLGIMYVLAHYGKEFLVSLLERDDELPILFTFVSVLATA
FT                   GAALFLGIPDTLMVIALGAAIATTDPDAFEQHARPFKDVFLVIFFVFFGVTINLSGNVS
FT                   MGVMAIICLLAVASKLISGVLTGIALYGSAASGIEIWTNTIARGEFSIALAALYGSPPV
FT                   AVTIAVMVIVTSLVGSFAAKYSGVFTHGFGGGNRHRGPPRRVRAGH"
FT   gene            199427..199677
FT                   /pseudo
FT                   /locus_tag="Mboo_0208"
FT   gene            complement(199677..200123)
FT                   /locus_tag="Mboo_0209"
FT   CDS_pept        complement(199677..200123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0209"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: mhu:Mhun_2404
FT                   cytidyltransferase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54731"
FT                   /db_xref="GOA:A7I4S0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024902"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4S0"
FT                   /protein_id="ABS54731.1"
FT                   /translation="MTARRVVATGTFDILHPGHVYYLTESRKLGDELWVIVARDENVKH
FT                   KPRPILPEAQRLAMVSALRPVDHAILGDHTDMFCPIDDIRPAVITIGFNQYFDEEKLKG
FT                   QLAERNLPAEVVRIGKYEDGDLASSRMIVQRIVEARGSGDQRIG"
FT   gene            complement(200120..200491)
FT                   /locus_tag="Mboo_0210"
FT   CDS_pept        complement(200120..200491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54732"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S1"
FT                   /protein_id="ABS54732.1"
FT                   /translation="MTIRGIKRDLLNLLLELGKDSHPNEFAALLTEECGVISELNLLPG
FT                   TVTGSSSASVFFDMMPLGTHHAGSAHSHPNGVLRPSGADLNFFPRAGRYNLIIGAPYRE
FT                   GDWRCFTADGEPCELAVIP"
FT   gene            complement(200639..201403)
FT                   /locus_tag="Mboo_0211"
FT   CDS_pept        complement(200639..201403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54733"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S2"
FT                   /protein_id="ABS54733.1"
FT                   /translation="MTTVRKIVLASAVLICAALVMVPLVSAAGPGQGFSPGGQQNQGQG
FT                   NQIAPGNGGNGNNPGSGNDQNSGNGAMASGGPGNGQNRQTPGAGIQPFAGNMTAPQGQP
FT                   DQNFGNASWNATPPGPGGALNLTAVGNALFGQLPPDANATGSNNWTNNWTMQLNATGLK
FT                   PDGQNVPLPAGNLTGHNPADGNVTPPSQPALSGNGNTNNAGNQNNAGTATQGYSSGPQA
FT                   GSTSQSASQDQKDSNLIEAFLTWLRGGGSSTT"
FT   sig_peptide     complement(201320..201403)
FT                   /locus_tag="Mboo_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.812 at
FT                   residue 28"
FT   gene            complement(201926..202741)
FT                   /locus_tag="Mboo_0212"
FT   CDS_pept        complement(201926..202741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0212"
FT                   /product="Acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /note="PFAM: alpha-acetolactate decarboxylase; KEGG:
FT                   mmp:MMP0613 alpha-acetolactate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54734"
FT                   /db_xref="GOA:A7I4S3"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S3"
FT                   /protein_id="ABS54734.1"
FT                   /translation="MNKNFFLGIGLAVAIVFAGAAVYLGLAKQAPVNSADRDTLYQVST
FT                   ISALMQGVYNGTTPVGDLKKHGDFGIGTFDRLDGEMIVLDGKVWQAKADGTVSPATDDQ
FT                   TTPFATVTYFSPDFRQATPDQAVNFSRFSAEMAARLPTQNMIYAVEIHGTFPSMTVRAI
FT                   PAQEMPYPNLTVASAGEHEYTFNNITGTVVGFYTPVFLKDLNTQGYHLHFLSDDHTRGG
FT                   HILDMTVPAASSVEYDITPYYTVVLPTTGAFAGTNLTADMSGAVAAVER"
FT   sig_peptide     complement(202679..202741)
FT                   /locus_tag="Mboo_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.850 at
FT                   residue 21"
FT   gene            complement(202767..203048)
FT                   /locus_tag="Mboo_0213"
FT   CDS_pept        complement(202767..203048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0213"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: cac:CAC0279 peptidil-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54735"
FT                   /db_xref="GOA:A7I4S4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S4"
FT                   /protein_id="ABS54735.1"
FT                   /translation="MTTQVRASHILVTSEDDANKILKRIKDGEDFAAVAKRFSSCPSKK
FT                   SGGDLGWFGKNQMVPEFEAAAFAADQGTVVGPVKSQFGYHVIKVTGKK"
FT   gene            complement(203628..203936)
FT                   /locus_tag="Mboo_0214"
FT   CDS_pept        complement(203628..203936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54736"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S5"
FT                   /protein_id="ABS54736.1"
FT                   /translation="MESRKIFRSNVEKSKNSWREKWKMGVSSATNSLPRRKSCSRAWAL
FT                   GSKNLPFFGREIFQAGKFLGLNTGMPKISGTLKKFPHEPIRENHAIPFTPSLNREGP"
FT   gene            complement(204222..205634)
FT                   /locus_tag="Mboo_0215"
FT   CDS_pept        complement(204222..205634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0215"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /note="TIGRFAM: dihydropteroate synthase-related protein;
FT                   PFAM: dihydropteroate synthase, DHPS; KEGG: mhu:Mhun_2402
FT                   dihydropteroate synthase-related protein synthase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54737"
FT                   /db_xref="GOA:A7I4S6"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S6"
FT                   /protein_id="ABS54737.1"
FT                   /translation="MRIILPTGAVTADTVRKAAAGFDAEVVVTGKIASFLTPRALRALI
FT                   QKGTYDAVVVPGMCTASFEAVERETGVPIYRGPRHAADLAWVLPLVGKVPLSGTVPAED
FT                   FLLEKNAADAMSRVAEAEERAEPEFVIRGTKIGGNSRMKVLAEIMDAHRAEDIRDRVER
FT                   YFSLGADIVDLGFGFDATPADVERVFLSLADIEGPLAVDTQDPDLIRAALSRADLVLSL
FT                   QEKNLPHVGKEVARAGAAAVVVPGEKTLPANIAKARRAGISCIIADPLLQPAGSGLVAS
FT                   LARFRDYSCPLFFGAGNVAELLDADSIGINALLAGMAMEAGAAIIFTSEHSDKTRGSIA
FT                   EMRRATEMMVLARDRPYAKDLGIDLLVLKEKRRRREPPLEYENVVAAKRMPDEITYDPK
FT                   GNFRIGIEGDQIVAEVREKAVKGTRWQDVLYTLIEEGHVSLLDHAGYLGRELYKAELAI
FT                   RYGRSFEQDGEF"
FT   gene            205677..206354
FT                   /locus_tag="Mboo_0216"
FT   CDS_pept        205677..206354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0216"
FT                   /product="PHP C-terminal domain protein"
FT                   /note="PFAM: PHP C-terminal domain protein; SMART:
FT                   phosphoesterase PHP domain protein; KEGG: mhu:Mhun_2401
FT                   PHP-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54738"
FT                   /db_xref="GOA:A7I4S7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S7"
FT                   /protein_id="ABS54738.1"
FT                   /translation="MLTCDLHVHTNFSKDGESSVEEILRQAEAVGLDVIAITDHDCVDG
FT                   AKKALAFKTSVLVIPGIEVSTKQGHLLVLGTTELIPAGLDVRETVQIARRMGAIVILPH
FT                   PYHVWRHGVARRVRAAMNIVDAVEAFNSRYIVGSANRKAGRIADRLEKPCVGGSDAHNA
FT                   RFVGYGRTFVEAEPEIPAIFEAIRRGQVSCGGRKTPLRTYTRQSLNNTWRKLKRLTRRL
FT                   RFR"
FT   gene            206309..207139
FT                   /locus_tag="Mboo_0217"
FT   CDS_pept        206309..207139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0217"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /note="KEGG: mhu:Mhun_2400 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54739"
FT                   /db_xref="GOA:A7I4S8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S8"
FT                   /protein_id="ABS54739.1"
FT                   /translation="MEKVKETDPAAPLPVRLACRVSYLGTRFYGSQQQESSRTVEGEFI
FT                   EACRRLALFSDWRTAGFASAGRTDRGVHACGQVIAFSTQTPDRARQALNSQLPPDIWCT
FT                   ATAVVPDHFHPRYDARSRTYRYYFGEPPRDPVAMETAAREFSGDHNFTNFARVGDKNPW
FT                   RKILEIRIGTEGSFTYLEVKAQSFLWHQVRCMAAAALSAGMGEQDADGIRLLLNEAASR
FT                   PIQPAPAEGLVLWDTDCGLTWDPVGKSPRSCTYCTELRRHHALMEQVCRVLGPE"
FT   gene            complement(207152..207583)
FT                   /locus_tag="Mboo_0218"
FT   CDS_pept        complement(207152..207583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0218"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: sru:SRU_2458 low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54740"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4S9"
FT                   /protein_id="ABS54740.1"
FT                   /translation="MAQQSRVLFICTANAARSQMAEGYLRAKYGDRFDVFSAGVHPAGQ
FT                   VSPRAVQAMKEIGIDISGHRPKSVDTFTGVPLDLAVTLCDNAGAVCPVIPSAKRTIHHA
FT                   FPDPHLTAGTDEDILDGYRRVRDAICTWIDATFVHGLPM"
FT   sig_peptide     complement(207518..207583)
FT                   /locus_tag="Mboo_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.598 at
FT                   residue 22"
FT   gene            complement(207668..207976)
FT                   /locus_tag="Mboo_0219"
FT   CDS_pept        complement(207668..207976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54741"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4T0"
FT                   /protein_id="ABS54741.1"
FT                   /translation="MLRQHGHGGRYGMDKYSRLSSCAASALFGTRQITIAGNQVGITGL
FT                   EAAFAAVDARGLTSDTEITAELMRQVQQDNYVPPALAAEYGAAVLAEYRKSIGKSRT"
FT   gene            complement(207948..209291)
FT                   /locus_tag="Mboo_0220"
FT   CDS_pept        complement(207948..209291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0220"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: mtp:Mthe_1001
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54742"
FT                   /db_xref="GOA:A7I4T1"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4T1"
FT                   /protein_id="ABS54742.1"
FT                   /translation="MKAEIPRVIVAGTHSGCGKTTIATGLMAALFDRGLEVQPFKTGPD
FT                   FIDPSHHTLICGRASRNLDICMMGEAGVTRAFANATAGADISVIEGAMGLFDGREGSDK
FT                   ASAAHVARILGAPVILVVDAHAVSRSIHATIKGFRDFDPKVKIAGIIYNRIGSDRHRQM
FT                   IAEEEYVPALGWVPRQKDCEIQSRHLGLVMAHESPALKQFGRIIAESCDLDGILAVAAN
FT                   ARPLAVPAGTAKKSHTSHRRAVIGVARDPAFCFYYQDNLDRLTRAGAEIREFSPVAGEV
FT                   PEADAIYIGGGYPELHAAALEKSRSTKTIRTLAQDGMPVYGECGGLMYLCGSLETEGKE
FT                   HRMAGVLPGRAVMTKRLAALGYVKGAFSGPAGLWPGTVGIRGHEFHYSRVEFDRDARWA
FT                   IRLSAGKGIDSGNDGLVEHATIGAYTHAYFTDAFARCFVDAAAAWARR"
FT   gene            complement(209393..209767)
FT                   /locus_tag="Mboo_0221"
FT   CDS_pept        complement(209393..209767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0221"
FT                   /product="protein of unknown function DUF333"
FT                   /note="PFAM: protein of unknown function DUF333; KEGG:
FT                   bte:BTH_I1026 domain of unknown function (DUF333) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54743"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4T2"
FT                   /protein_id="ABS54743.1"
FT                   /translation="MANPASVNCVNVGGQSVIMTNPDGSQYGMCNFTNGTSCEEWALFR
FT                   GEGCQAAVTANQTANATAPSGQSGMANPASVNCVNVGGTVQIKDSAAGQYGMCAFPNGT
FT                   TCEEWALFRGEGCQAANVTA"
FT   gene            complement(210032..210829)
FT                   /locus_tag="Mboo_0222"
FT   CDS_pept        complement(210032..210829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0222"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: mth:MTH1660 tryptophan synthase alpha chain;
FT                   TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54744"
FT                   /db_xref="GOA:A7I4T3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4T3"
FT                   /protein_id="ABS54744.1"
FT                   /translation="MMGRIESVFAKKGKSAFIGFTVAGDPDKETSIRIAKALIDGGTDI
FT                   LEFGVPFSDPVADGPTIQRADDRALASCTTPDTIFAIVREVRAYSEVPIVFLTYYNTIY
FT                   RRGIDRFYLEAHEAGVDGILVADMPVEESDEVAATAEKYGIDPIFLVTQTTSNERMDTI
FT                   VRHARGYLYLVSVLGVTGARKTVAPEALALLNRVRSHTDLPLAIGFGISTPEHVTTCNL
FT                   AGADGVIVGSAIVDIVEKNLGNPDAMEQDLRRYVSVMKKAAEQ"
FT   gene            complement(210826..211992)
FT                   /locus_tag="Mboo_0223"
FT   CDS_pept        complement(210826..211992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0223"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: mhu:Mhun_1790 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54745"
FT                   /db_xref="GOA:A7I4T4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4T4"
FT                   /protein_id="ABS54745.1"
FT                   /translation="MGRKGRFGKYGGQYVPETLMNALIELECAYRDATHDPAFAQELAA
FT                   YQSEYAGRPTPLTFCGNISRDLGFKVYLKREDLVHGGSHKLNNTLGQALLAKRMRKKRL
FT                   IAETGAGQHGVATAIAGAALGFKVEVFMGEVDTKRQALNVFRMELMGATVHPVTCGTKT
FT                   LKDATNEALRDWVANVNDTHYLIGSVVGPHPFPTIVRDFQSVIGREARQQVMRKEGKMP
FT                   DAIVACVGGGSNAIGIFHPFLADDVELIGIEAAGKGLDTPEHSATLCAGDPGVLHGTLS
FT                   YLLQDNNGQVLPTHSVAAGLDYPGVGPEHAMLKDSHRVAYYAVKDHEVLDAFRYLSRTE
FT                   GIIPALESSHAVAYVLQNCDRFDKGDVVIINLSGRGDKDVAGIVPEAA"
FT   gene            complement(211982..212569)
FT                   /locus_tag="Mboo_0224"
FT   CDS_pept        complement(211982..212569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0224"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: mhu:Mhun_1789
FT                   N-(5'phosphoribosyl)anthranilate isomerase (PRAI)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54746"
FT                   /db_xref="GOA:A7I4T5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4T5"
FT                   /protein_id="ABS54746.1"
FT                   /translation="MRIKICGITRVEDVLFAEKAGADAIGVVMYSPTSRRSVPDAKARE
FT                   IFSALGPFVTRVVVTHTESESDLEKILAIRPDAIQISHPFVFEKYPGVRVLRVIGRGDA
FT                   VPTDCDAVIVDESMGAGKAFDQEFAKVVAKTSRVPVILAGGLTPENVGLAIREIRPHAV
FT                   DVASGVETEPGIKDHTKIAAFIRAAREADHGT"
FT   gene            complement(212560..213315)
FT                   /locus_tag="Mboo_0225"
FT   CDS_pept        complement(212560..213315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0225"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   mhu:Mhun_1788 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54747"
FT                   /db_xref="GOA:A7I4T6"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4T6"
FT                   /protein_id="ABS54747.1"
FT                   /translation="MILDEIVSRTKKRVEKLPATFPEPEGFRHTSLENAILSAHTKNPV
FT                   IAEIKCASPSKGIIRRNVDMGMMAGVLADSGCVGISVLTEPYFFAGSVADIARVKKAVR
FT                   VPVLRKDFIVDLRQVAETRALGADAVLLIAAVLKKQLPAFVDAVYDIGLEPLVEVHNAD
FT                   EIALALETKAKLIGINNRDLATMTIDRSTTRKLSGLVRAKDRLVVSESGMRSVDDIREL
FT                   RPYCDAFLIGSSIMADKRPDKKLEEFVCA"
FT   gene            complement(213312..214331)
FT                   /locus_tag="Mboo_0226"
FT   CDS_pept        complement(213312..214331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0226"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase, family 3; KEGG: gme:Gmet_2495
FT                   anthranilate phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54748"
FT                   /db_xref="GOA:A7I4T7"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4T7"
FT                   /protein_id="ABS54748.1"
FT                   /translation="MTMKEAIATVVEGRDLAPAQAAAVMNMMMDGQATPAQIGGFLTAL
FT                   RAKGETPEEIAAFARVMREHTVHVKPRVSGTLVDTCGTGGDGAQTFNISTAAAFVAAGA
FT                   GITVVKHGNRSVSSRCGSADVLTALGVDISVDPGRQAGIVQETGIIFLFAPSHHPAMKH
FT                   VMATRQDLGCRTVFNLLGPLANPAGAAAQVLGVYDQKLTGPMAEVLSLLGVSRAMVVFG
FT                   SGLDEITVTGETSVTELANSRITNYIVTPEQFGFTRAAPGDLLGGDPEKNARIIRAILD
FT                   GAPGPARDIVLMNAGAAIYVGGRAATLAEGIRHAAESIDSGKAAGKLAALVTATRGAS"
FT   gene            complement(214328..214921)
FT                   /locus_tag="Mboo_0227"
FT   CDS_pept        complement(214328..214921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0227"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mhu:Mhun_1786 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54749"
FT                   /db_xref="GOA:A7I4T8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4T8"
FT                   /protein_id="ABS54749.1"
FT                   /translation="MSAPTVLIVDCYDSFTFNLYQQVGKLGGRPMVFTCDTPLEKLKEI
FT                   RCDRIILSPGPGTPKESGVCLEVIDTMSKTIPTLGVCLGHQAICTAFGGKVVRSGHLMH
FT                   GKTSEITSDGRGVYTGLPTPFTATRYHSLVAQRDSLPQELLVTAESLDDHFVMGLRHRK
FT                   FPIEGVQFHPESILSHDGDALMRNFLFGPRVKNA"
FT   gene            complement(214918..216465)
FT                   /locus_tag="Mboo_0228"
FT   CDS_pept        complement(214918..216465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0228"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Anthranilate synthase component I and
FT                   chorismate binding protein; Anthranilate synthase component
FT                   I domain protein; KEGG: mhu:Mhun_1785 anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54750"
FT                   /db_xref="GOA:A7I4T9"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010116"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4T9"
FT                   /protein_id="ABS54750.1"
FT                   /translation="MATDTLHIPLTLNLGSEEYLTAVADQPKPLVIPLCAELTLPQCSP
FT                   LEVFLATRAGPGFLLESMEGSEKIARYSYMGINPACVITLGREVSVEGSDAFVAIAHEP
FT                   EGKNPVDRIRSILSRFHYINLRAPRFFGGMVGYFSYDIVHDLFEQVPDHRTKRGRECPD
FT                   ARFMLTKDCIVFDHRDRRLFVFSSPFLTYDTDPAAEYRRCAAHIAELTDRIASVAGTPK
FT                   KPDDVMQTVTGKVGKKPEITDNTGREAFMHAVSGIKEHIVAGDIFQAVLSRRMECPVVP
FT                   DPFPIYAALRSINPSPYMYYLDFGDEQVIGASPEMLVRVEKRRVTTVPIAGTRPRGADK
FT                   SEDKKLAQELLLDKKERAEHTMLVDLARNDLGRVCKFGSVEVSEFMGIEKFSHVQHMVS
FT                   TVQGTLMDHLDGCDALKSCFPAGTVSGAPKIRAMQIIGESEPDARGIYAGAVGYIGFDR
FT                   NLEFAIAIRTVTVKDGRASVQAGAGIVADSVPENEWTETENKAAAMMKAIEQAGVVP"
FT   gene            complement(216659..217030)
FT                   /locus_tag="Mboo_0229"
FT   CDS_pept        complement(216659..217030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54751"
FT                   /db_xref="GOA:A7I4U0"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U0"
FT                   /protein_id="ABS54751.1"
FT                   /translation="MQINFKRYALYLLRWQASTPILAGVGILLAGMGYIVAAIIANLIG
FT                   GLIFFWVDQFIFTSQSLATQWEVRENITCVDCGKIARGYRLVRAGDYDKSNDPVPEFRC
FT                   EECSKKKSETLRNKGIKIE"
FT   sig_peptide     complement(216917..217030)
FT                   /locus_tag="Mboo_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.916 at
FT                   residue 38"
FT   gene            217144..217737
FT                   /locus_tag="Mboo_0230"
FT   CDS_pept        217144..217737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54752"
FT                   /db_xref="GOA:A7I4U1"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U1"
FT                   /protein_id="ABS54752.1"
FT                   /translation="MWPNKQHTLGWVFVSRMIGIICFLIVVVLANILTFYIANPLYHAG
FT                   VDFLNLNFWLLILIGIIIFIADIFGALPFPLNLPAPIIKAIGSVFIIAFVLRVFQWVDS
FT                   TTGNDIYHYFWLLSFVIVPVVFIIVLLAGYYEILCDLWAKAKIRDESDLVVHASASDLP
FT                   PSSPSAKSWEDVGAELRMMLYDLFHRFREEIRRR"
FT   gene            complement(217798..218097)
FT                   /locus_tag="Mboo_0231"
FT   CDS_pept        complement(217798..218097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54753"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U2"
FT                   /protein_id="ABS54753.1"
FT                   /translation="MFSCTACAHVRRYINFPVPCAPMAASWQEALETARKQNIPQVYHD
FT                   CDTDTYGACRTGEHQGRFKGGVFIEHRCICMPAHLSAEELAEKERKFRADNPDW"
FT   gene            complement(218122..218301)
FT                   /locus_tag="Mboo_0232"
FT   CDS_pept        complement(218122..218301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2365 DNA-directed RNA polymerase I,
FT                   II, and III, 7.3 kDa polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54754"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U3"
FT                   /protein_id="ABS54754.1"
FT                   /translation="MSNTMERKGFGGPRNFGPREMTKTVCSDCGKECEVPFKPTEGRPV
FT                   YCRDCLPKHRKPRF"
FT   gene            complement(218393..219535)
FT                   /locus_tag="Mboo_0233"
FT   CDS_pept        complement(218393..219535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0233"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_2880 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54755"
FT                   /db_xref="GOA:A7I4U4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U4"
FT                   /protein_id="ABS54755.1"
FT                   /translation="MINGILPMYFHLILTDDCNLCCRYCRAKAFEEEEEPEGGRIEIDE
FT                   DLPPDLDFDLTLLYRFLARDPAATLTFYGGEPLLRSDLIERIVREAPVQRFMIQTNGLL
FT                   LDRLAPEIVNRFSTILVSLDGREALTDGNRGDRVFLRVMGNVQKILQNGYRGELIARMT
FT                   VTERTNIFDQVRYLADNPYHSFSSIHWQMDANFTGDFGHRAFAQWADTNYNPGIRALVT
FT                   AWADEMEKSGRVMRWYPLIDPMEDLLYGKESLLRCGAGHANYTILTDGHISPCPIMIGM
FT                   KQYYVGHIRDADPKNLPKVPVGGECQTCRIRTFCGGRCLYSAIVQPWKPAGRELVCGTV
FT                   QNLYDALAGALPRVQDLIRSGRISPGEFSHEKFNGCEIIP"
FT   gene            219660..220283
FT                   /locus_tag="Mboo_0234"
FT   CDS_pept        219660..220283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54756"
FT                   /db_xref="GOA:A7I4U5"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U5"
FT                   /protein_id="ABS54756.1"
FT                   /translation="MNKRCTKEEALTGFGIIVLILGVIVVLYIALMSRPPGTETGGGVL
FT                   HAFMGDTGNILRTVGPVTVFSAVNGTPHDVNARYPEPDPGRMGSVELNVALFIGSMGGV
FT                   DFNKVHVVWISNGIAETLPQNAERPLTCPGWTIVAKYNTIPLKNANSNNILDPGEQFEI
FT                   FACPKNTTTAYQQFSLVIAPEGNVIPPLVSTSAPPMVQPVMQLM"
FT   gene            220587..220802
FT                   /locus_tag="Mboo_0235"
FT   CDS_pept        220587..220802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54757"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U6"
FT                   /protein_id="ABS54757.1"
FT                   /translation="MGQKIGKEKIQREKGFLYFIGKDGYVWAAPMKHNKTGKKKKVGTE
FT                   KIAKEKGFMYYIGKDGFVAKAKMKNA"
FT   gene            complement(221252..221325)
FT                   /locus_tag="Mboo_R0003"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(221252..221325)
FT                   /locus_tag="Mboo_R0003"
FT                   /product="tRNA-Val"
FT   gene            complement(221329..221399)
FT                   /locus_tag="Mboo_R0004"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(221329..221399)
FT                   /locus_tag="Mboo_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(221526..222416)
FT                   /locus_tag="Mboo_0236"
FT   CDS_pept        complement(221526..222416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0236"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: mhu:Mhun_1307
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54758"
FT                   /db_xref="GOA:A7I4U7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U7"
FT                   /protein_id="ABS54758.1"
FT                   /translation="MEWKRDWGLTARVLLTGFLLFILYLVFMTVLVIFFPGVSIWLIVG
FT                   LAVVMGGIQYFFSDKLVLWSTHARIISEDEYPDLHQTVAKLVHEADLPMPKIAIMQSPV
FT                   PNAFATGRSPKHAVVCCTDSIMRLLSRDELEAVLAHELSHVKNRDILTMALASFVAMIA
FT                   SMIMQSVFFSALFGGNSRDNGAGWIIVWVVSILVYALSTLLMLALSRYREFAADRGSAL
FT                   ITRNPRALISALNKISGRMEVVPPDAKAKVEGANAFFIIPALSGNTLMELFSTHPPIEK
FT                   RIAALEKIAAELRIN"
FT   gene            222612..223262
FT                   /locus_tag="Mboo_0237"
FT   CDS_pept        222612..223262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54759"
FT                   /db_xref="InterPro:IPR015034"
FT                   /db_xref="InterPro:IPR023398"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4U8"
FT                   /protein_id="ABS54759.1"
FT                   /translation="MDEVDSEALADVAYGIFDHLLSRRLQAQGKYLFALVEGGIDFSED
FT                   VTETVVRFSDEYPQLAEALLARFGSADTIYRMLSLGEGVVPSKTTQMYWIVQDAPGSLP
FT                   EAIEDEHAGKWLIFQEPDAADAAWKKVRDATVALDLGISAKVSTAKPNPDSRDSRRVIY
FT                   IYTKDWADEPDVMRVRENLRGLGFTDRIGYKRNLETFAGEYAKKGKRVTYYSA"
FT   gene            complement(223326..223472)
FT                   /locus_tag="Mboo_0238"
FT   CDS_pept        complement(223326..223472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0238"
FT                   /product="Ribosomal protein L40e"
FT                   /note="PFAM: Ribosomal protein L40e; KEGG: mhu:Mhun_2870
FT                   ribosomal protein L40e"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54760"
FT                   /db_xref="GOA:A7I4U9"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4U9"
FT                   /protein_id="ABS54760.1"
FT                   /translation="MAKFPEAEARLLNVKICMHCNARNAIRATTCRKCGYKNLRPKNKE
FT                   RKA"
FT   gene            complement(223521..224099)
FT                   /locus_tag="Mboo_0239"
FT   CDS_pept        complement(223521..224099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0239"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   mhu:Mhun_2869 Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54761"
FT                   /db_xref="GOA:A7I4V0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V0"
FT                   /protein_id="ABS54761.1"
FT                   /translation="MSQTLTMVTSNANKAREVAAFFGGAIEVSHVALEIPELRSEDVRV
FT                   IAREKARYAYDHIHRPLIVDDTAFSINALKGFPGPYAAYVLSTIGNTGVLRLMDGVQDR
FT                   TARFTTAIAFSDESGIEVFSGTIEGRIIHGTRGTGGFGYDPIFEVGEKTLAEIPLEEKS
FT                   AISHRAKALSAFSTWFMNRQDPGLRDTNR"
FT   gene            complement(224096..225679)
FT                   /locus_tag="Mboo_0240"
FT   CDS_pept        complement(224096..225679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0240"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mhu:Mhun_2868 metalloendopeptidase, putative,
FT                   glycoprotease family; TIGRFAM: putative
FT                   metalloendopeptidase, glycoprotease family; PFAM: protein
FT                   of unknown function RIO1; peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54762"
FT                   /db_xref="GOA:A7I4V1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR009220"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V1"
FT                   /protein_id="ABS54762.1"
FT                   /translation="MPEFGQILGIEGTAWNLSAALFDRDLLALCSRPYSPEHGGIHPRE
FT                   AAQHHASAMREVIATVTKEPEKITGIAFSQGPGLGPCLRTVATAARSLALALEVPLIGV
FT                   NHCVAHVEIGSWATGCRDPIVLYASGANTQVIGYLNGRYRIFGETLDIGIGNALDKFAR
FT                   AKDLPHPGGPLIEAQAKSGTYFELPYTVKGMDLAFSGLVSAAKDSRKLLSDVCCSLQET
FT                   AFAMCVEVTERALSLTGKDEVLLVGGVGANARLQEMLRIMCEERGAHFFVPERKYLGDN
FT                   GAMIAYTGKLMLESGQTLAIENSQVNPSFRSDDVEVTWKHEATPVPGQENRGRTDQKRG
FT                   AEAVVLFRNGSAIKQRLSKTYRVPALDRKLITERTRAEARIIHMARKGGVPTPIMSDIT
FT                   GDSIVMEEITGTLLTHALSEANCEKAGEMTGQLHTAGIMHGDLTTSNMILRDTDGKCVL
FT                   IDFGLSQVTSEIEQRGVDIHVMFQTLTSTHPKDAGRLQAAFAKGYLATFASAREVLERE
FT                   KEIEQRGRYL"
FT   gene            complement(225686..225871)
FT                   /locus_tag="Mboo_0241"
FT   CDS_pept        complement(225686..225871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0241"
FT                   /product="Ribosomal protein S27a"
FT                   /note="PFAM: Ribosomal protein S27a; KEGG: mhu:Mhun_2867
FT                   ribosomal protein S27a"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54763"
FT                   /db_xref="GOA:A7I4V2"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V2"
FT                   /protein_id="ABS54763.1"
FT                   /translation="MAAAAKKAVAKGPSRSAFFKVEGDKVTTTKKYCPRCGPGVIMADH
FT                   KDRVACGKCGYTEFKK"
FT   gene            complement(225874..226173)
FT                   /locus_tag="Mboo_0242"
FT   CDS_pept        complement(225874..226173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0242"
FT                   /product="SSU ribosomal protein S24E"
FT                   /note="KEGG: mma:MM0599 SSU ribosomal protein S24E"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54764"
FT                   /db_xref="GOA:A7I4V3"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V3"
FT                   /protein_id="ABS54764.1"
FT                   /translation="MDFKIESDKRNELLSRREIAFTLTYDGATPSRLQIIGKLCALLNT
FT                   KDPLVVLDSLKSNFGKMVIVGKARIYDSEDAKKKTEHPYLSARGVPKPKEEGAA"
FT   gene            complement(226263..226769)
FT                   /locus_tag="Mboo_0243"
FT   CDS_pept        complement(226263..226769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0243"
FT                   /product="Protein of unknown function DUF359"
FT                   /note="PFAM: Protein of unknown function DUF359; KEGG:
FT                   mhu:Mhun_2865 protein of unknown function DUF359"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54765"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4V4"
FT                   /protein_id="ABS54765.1"
FT                   /translation="MFVLPDESRQLFKDPFGTLHRDIGTVLPELAGRTIYSVGDVVTHS
FT                   LQQNGITPAIAVVDGQTMRSPCIKMPEIAGPCIHVKNPPGTITDELVSALTHAVDHTPV
FT                   TILVDGEEDLAVIPLVIAAPLSSIVIYGQPNEGVVLRIVDDQAKTAARRLLTQFTKTES
FT                   PIPHN"
FT   gene            complement(226771..226977)
FT                   /locus_tag="Mboo_0244"
FT   CDS_pept        complement(226771..226977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0244"
FT                   /product="DNA-directed RNA polymerase subunit E, RpoE2"
FT                   /note="PFAM: DNA-directed RNA polymerase subunit E, RpoE2;
FT                   KEGG: mhu:Mhun_2864 DNA-directed RNA polymerase subunit E,
FT                   RpoE2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54766"
FT                   /db_xref="GOA:A7I4V5"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V5"
FT                   /protein_id="ABS54766.1"
FT                   /translation="MPPMNKKKQGKVCRDCHRVVEGENCVICGTTNLSDDWSGYLVIID
FT                   PENSDVAKRMNIKLPGRYALKVR"
FT   gene            complement(226961..227602)
FT                   /locus_tag="Mboo_0245"
FT   CDS_pept        complement(226961..227602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0245"
FT                   /product="DNA-directed RNA polymerase"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase; PFAM: RNA
FT                   binding S1 domain protein; RNA polymerase Rpb7-like; KEGG:
FT                   mhu:Mhun_2863 DNA-directed RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54767"
FT                   /db_xref="GOA:A7I4V6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V6"
FT                   /protein_id="ABS54767.1"
FT                   /translation="MYYKMTLEDKVRVPPNRLGEKLDKVILEVLQEQLEGSIDKELGVF
FT                   IAVTKVEHVGEGEIVPGDGGVYYDVKFEGLVLRLALQEVIEGIVVETTSFGAFISLGPI
FT                   DAMLHVSQISDEYINFDEKNARLICQDSKRYIGVGDTVRVRVVTLSLNEREPRDSKIGL
FT                   TMRQAGLGTTLWLEEEIEKEKERAAGGAAAAPKERAEKAKGKRKEHAADE"
FT   gene            complement(227617..227967)
FT                   /locus_tag="Mboo_0246"
FT   CDS_pept        complement(227617..227967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0246"
FT                   /product="nucleotide binding protein, PINc"
FT                   /note="KEGG: mhu:Mhun_2862 nucleotide binding protein,
FT                   PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54768"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V7"
FT                   /protein_id="ABS54768.1"
FT                   /translation="MMPAQFRIDLFNEIRELLGNFEPVVLQGVLQELGGLSRAKGNEGA
FT                   AARFGLTLARQCTVAEGSSSPQPVDDQVIAWARENRGMVVTNDRRVRDALLADGLGVIS
FT                   MRKQKKLEIVRK"
FT   gene            complement(227994..229205)
FT                   /locus_tag="Mboo_0247"
FT   CDS_pept        complement(227994..229205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0247"
FT                   /product="protein synthesis factor, GTP-binding"
FT                   /note="PFAM: protein synthesis factor, GTP-binding;
FT                   elongation factor Tu, domain 2 protein; KEGG: mhu:Mhun_2861
FT                   protein synthesis factor, GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54769"
FT                   /db_xref="GOA:A7I4V8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V8"
FT                   /protein_id="ABS54769.1"
FT                   /translation="MNIGVVGHVDHGKTTLVNALTGTWTDRHSEEVRRGISIRLGYADA
FT                   TFYKCDHCEGTEAYSTKPVCPACGSEGKPFRSISFVDAPGHETLMATMLSGSALMDGAM
FT                   LVISTTEKCPQPQTKEHLMALGLVGIKKIVIVQNKIDVVSQKEAIENYQQIKDFVKGTV
FT                   AENAPIIPVSAQKGINIGALVQALDQTIPEPVRDPDAEPVMLVARSFDINKPGCNWKEV
FT                   KGGVVGGSLIRGILHDGDPIEIRPGRQTQVENRIKWIPIITEITSINAGTKTVEEATPG
FT                   GLLGIGTKLDPALTKSDALAGQVVGHVGKLPPVWDKIRCQVTLMERVVGATSELVIEPL
FT                   KFNEPLMLSVGTAVTVGVVTSTKKEAVEVQLKRPVCAEPGARIAISRQVGARWRLIGMG
FT                   VLSE"
FT   gene            complement(229349..229609)
FT                   /locus_tag="Mboo_0248"
FT   CDS_pept        complement(229349..229609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54770"
FT                   /db_xref="InterPro:IPR019209"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4V9"
FT                   /protein_id="ABS54770.1"
FT                   /translation="MRYPRTGTTGAVVRIEQVGADLFAELDSTHLLYRTDLLIPAEQAK
FT                   AAAKSQKEDIKEIIQREREFAAGSEFQDALKNIDQSCEGGG"
FT   gene            complement(229720..232311)
FT                   /locus_tag="Mboo_0249"
FT   CDS_pept        complement(229720..232311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0249"
FT                   /product="Oligosaccharyl transferase, STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase, STT3 subunit;
FT                   KEGG: mhu:Mhun_2859 oligosaccharyl transferase, STT3
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54771"
FT                   /db_xref="GOA:A7I4W0"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="InterPro:IPR026410"
FT                   /db_xref="InterPro:IPR041154"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W0"
FT                   /protein_id="ABS54771.1"
FT                   /translation="MVQFDLYNRRNWLIGGLLAFFVIFAVWLRLLPMLSMGHTDVLSMV
FT                   GSDDPLYNLRQVEQLLANHFTYTWFDPMTQYPVGSNVYWGPLFIYISGLACWIAGATTR
FT                   PEIIGICLLVPVAMAAVTVVLMYFVGKICGDWKTGLLAAGFTAIVSGQFFYRSLYGYFD
FT                   HHIGEVLFSTLFCLVYLYILVSEKDAKIDLKNFTTWKKTALLSVLAGIAYLLGLFLMPT
FT                   MIVFALMVVIFTVIQFIICIYRERPTEYLLVANTTIFAVAIIGLVLFGFKSPGLDLANY
FT                   SVGHVFAYLAIILGTAVLYILHRYLKNQPKYYYPVSLVGIAVIGAAVLYVAGPQFFNQL
FT                   VSAAVQFFGQAPVTDTVQEARGWSVAAAWTTFNYGLILMAGGILAALYSIWREDRPHEV
FT                   FTLVWSAIIFYSTCQHIRYEYYLAVNVALLSAICVSFAFAWGRDDITRFISAINGSTGK
FT                   DAAADKSDPAEKRKKSKKSQKQESTQAAPRFAIIALVVVAAGLGLLFAYTSAAYSYVNA
FT                   SGNPLMMNQDWKDSLVWMANNTPATGVDYYTIYDKNTFTYPNTSYGVMSWWDYGHMITY
FT                   IAYRIPNANPFQAGVSGPDGSAAYFMATNESTANTILDHDGTRYVITDIEMDTGKFWAM
FT                   ATWFNATEAAAPYQMTVLIPGQTPSSGYQTAMLNEAPYYETMVSRLHNFDGSMATPSDA
FT                   YYVEYADANVTHISYPVVTNAEAMNVSAATARAAQYNQNPQAGYHATVLSASLVQPLTD
FT                   IPALQNYRLVHESPTSELATNTSDVKYVKIFEYVKGAHIKGSGIIDIPLVTNQGRNFTY
FT                   RQQSVNGEFIVPYSTTGNPYDVKATGKYQIEGTSQTFDVPESAVMQGLTIN"
FT   gene            complement(232369..233505)
FT                   /locus_tag="Mboo_0250"
FT   CDS_pept        complement(232369..233505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0250"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mtp:Mthe_1678 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54772"
FT                   /db_xref="GOA:A7I4W1"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W1"
FT                   /protein_id="ABS54772.1"
FT                   /translation="MKILLVSTQDYIHHPVPSRHHYIFEELAKRHEVHVAHFHVSRGAP
FT                   RPTRLIVEEATQFPVKSPLLHYTINAPYHYYIFNRIIREKKIDVVVAAHVLAGAAVISA
FT                   AKKNHVPAVFDLKDWFPDSAAAYFKNRFLADTVRRGVWEITRRNLTRSNRITTVSPSLV
FT                   DKLKHLGFSAELITNGVDTDIFVPQDGSRTRQELGIGPGEFVIGFSGSIERWYAIDEMI
FT                   RALPELIRYRKATRLLIIGGSLFTDYEKELRALAQSLGVANRVIFTGTKPYAELPRFNA
FT                   CMDVCTIPLSPPQWVDIALPNKFFEYSACGKPIVMRPIPDVTRIGGPNLFVYRTREEFV
FT                   DRIKYQMDHPATFRINLENYSWREKARQFENILSELCT"
FT   gene            complement(233554..234162)
FT                   /locus_tag="Mboo_0251"
FT   CDS_pept        complement(233554..234162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0251"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: mhu:Mhun_2143 transferase hexapeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54773"
FT                   /db_xref="GOA:A7I4W2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W2"
FT                   /protein_id="ABS54773.1"
FT                   /translation="MIEYGKNRIGAGSQVFEPVTLGFPSREFMGKSGFDGTTIGKDAVL
FT                   RSGTIIYCEVVIGDRFQTGHNVMIREKTRIGNHVSIGTGAIIEGNTRIGDDVNLQSMVY
FT                   IPTSTEIGDRVFIGPNAVLTNDRYPPSGIGGLVGPVVECDAAIGANATILPGVHIGEGA
FT                   LVAAAAVVTRDVPAHMLAVGAPAKIRDLPTQIAPIQRKR"
FT   gene            complement(234159..235901)
FT                   /locus_tag="Mboo_0252"
FT   CDS_pept        complement(234159..235901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0252"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   mhu:Mhun_2855 glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54774"
FT                   /db_xref="GOA:A7I4W3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W3"
FT                   /protein_id="ABS54774.1"
FT                   /translation="MCGIVGYIGRRKAAPLILEGLKKLEYRGYDSFGVATLGDQLELEK
FT                   HKGRISEHAAAIRLHGTIGIGHTRWATHGIPNDVNAHPHTDCTGRIALVHNGIIENYAE
FT                   LRKGLEKRGHAFRSETDTEVIVHLVEEQYAKTADLLSAVRDTLPLLEGSYAILVIAAGS
FT                   DCIVAARNASPLVLGMGDNEYFAASDMTPVLEYTERAVFLEDGDIARLTRTGIELWQGT
FT                   HPVKRPVELIDWSPEEVRKGGFDHYMQKEIYEQPQAFFSTLRATDRRTLPSFVCKAPSI
FT                   SLVACGSSYHAGLIFKYLLEESCEIPARVDFASEFKYFPPPVEGLVIGITQSGETADTL
FT                   AAMKQARAHNCRTLAITNILGSSASRIADTTLFMRAGPEISVAATKSFVAQLAVLMQII
FT                   NARAEGRYSEILLHAHQAIENVLLMDPEAAVDLCRDAKSIFYIGRGPFYPVALEGALKM
FT                   KEISYIHAEGYAAGELKHGPFALLSPETPVIAICIPGETYGVMVSNIKECKARGAPVIA
FT                   LGSEGDPDLPDIADVFIPLPKAHLFVHVLTSLVVLQILAYRTAVALGRDIDKPRNLAKS
FT                   VTVE"
FT   gene            complement(235903..237057)
FT                   /locus_tag="Mboo_0253"
FT   CDS_pept        complement(235903..237057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0253"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: mhu:Mhun_2854
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54775"
FT                   /db_xref="GOA:A7I4W4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W4"
FT                   /protein_id="ABS54775.1"
FT                   /translation="MQAVILAAGEGKRVRPLTWSRPKAMIPVANRPIIAYTIDALEANG
FT                   IRDIIVVVGYRREQVTRFLNQLDLPIEVVVQDRQLGTAHALRQAEKQISGDFLLLPGDN
FT                   YIDAQSIAKIKDARNAVLIKEHPSPSNFGVVTVREGQVDSIEEKPEHALSFLVSTGIYA
FT                   LTTDFFRYIRGNDITEAVAAMIAEGGSLQAITADDWQDAIYPWDLIRLNQRLLKHLPAA
FT                   REGSASRHATIHGPVRIGKCTTIGPNTVITGPVIIGDNCTIGPNCCILPNTSIGSRVTI
FT                   EPLCVLGNSIIMDDTAIASHSRVVDAVIGERCGLADHTSVGTANGILEIEGAPVRSRFG
FT                   AILGDNVACGPFSQLRNCIIGNNATLEGDRNVSSCVIPDGTLVI"
FT   gene            complement(237066..238265)
FT                   /locus_tag="Mboo_0254"
FT   CDS_pept        complement(237066..238265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0254"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: mhu:Mhun_2853
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54776"
FT                   /db_xref="GOA:A7I4W5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W5"
FT                   /protein_id="ABS54776.1"
FT                   /translation="MQCVVLAAGEGKRMRPLTARRPKVMLPVANRPMMEHLVLAARDAG
FT                   ITEFVFVVGYGEREVRNHFGNGERFGIQVAYAPQRQQSGTADALRSAQDLVTGPFLAMN
FT                   GDMILSSADIARMIDAPAPAMGTSTTDHPGDFGVVLVEDGRVLSLEEKSKHPKSNIINA
FT                   GAYSFTPEIFELLAGIRLSERGELELTDALGILIARHDLGAVPLSTWRDIGYPWDLLDA
FT                   NAALLLGLNSQNEGIVEEGVHLLGPVAVGEGTVIKSGTYIEGPCIIGKNCRIGPHAYIR
FT                   GATSIGDESHIGHCTEIKNTVVMARTKIPHFNYIGDSVIGSGCNFGAGTKIANLRHDHG
FT                   PVKAGGKDTRHTKFGAVVGDNVHFGINCSVNVGSVIGSNAQFAPNSVIEGSFGEDAAIR
FT                   "
FT   gene            complement(238290..239540)
FT                   /locus_tag="Mboo_0255"
FT   CDS_pept        complement(238290..239540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0255"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III; KEGG: mhu:Mhun_2852
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54777"
FT                   /db_xref="GOA:A7I4W6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W6"
FT                   /protein_id="ABS54777.1"
FT                   /translation="MLFGSSGIRQLFSGPLVETALAVGAILGERFPDCIVGTDSRTTSP
FT                   LLARAVISGITAAGGRARFTGIAPTPSVAYSARTAKAGCMITASHNPEEYNGIKLFNPD
FT                   GSSFVQAQQRETEELLKEPRWADWQHQGTEVSFDALTPHKVEVLDKVSLDPGLSVVIDC
FT                   GNGAGSVMTPDILAKAGVKTTCISCNPSGFFSRPSEPLAEHLGYVGEMVKKTGADCAVV
FT                   HDGDADRMMAFDNRGRYIDGDHLLLLFAEHLDAHRVVTTSDASMIIEEVAEVHRTPVGD
FT                   AFVSEELLSWGSFGGEPSGAWIFPQISYCPDGPFAAALFCEIASGCDVAERLDEMPAYP
FT                   ILRESIPHERAREVVTALGAENPTDGIRVSGESGWYLVRASGTEPKIRITAEGTTLSAA
FT                   KAMLALAKERIRQGKTA"
FT   gene            complement(239574..240221)
FT                   /locus_tag="Mboo_0256"
FT   CDS_pept        complement(239574..240221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54778"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W7"
FT                   /protein_id="ABS54778.1"
FT                   /translation="MDIITESVKRLEEFMVNSGCEETGIRLDVDPDACNCQFERGACMT
FT                   ATFGGRTAEFVTDSPIRAMTKISFMFGAPLDNPPTRGAACAIINVATAFFCLSRVRRAC
FT                   PMVSHGTCMKELAEELAGRRVFCIGPAPALARAPGVYQAEDIGSADIILVNNEGIIAPD
FT                   LGDLLARTGAEKRVIFLGPSTAGTSRLMHEGHWCPYGLPMLDAAPDPSQPTG"
FT   gene            complement(240221..240832)
FT                   /locus_tag="Mboo_0257"
FT   CDS_pept        complement(240221..240832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0257"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: gme:Gmet_0042
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54779"
FT                   /db_xref="GOA:A7I4W8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4W8"
FT                   /protein_id="ABS54779.1"
FT                   /translation="MKIIDVTRPLSGTTVSFPGDPALQFSQRDAGLYLISELHMNSHSG
FT                   THIDAPVHYLKKGDTIDRIPLDHLIGPCRVLDLSGAGPEITAADLGGRLCGAKRILLKT
FT                   VFSGETQFREDFPHISTDAAELLTREGVLCVGIDSFSIEALVCDGSVHREILGHGCIIV
FT                   ELLDLSSVSEGNYEMAALPLRLVGLDGAPARVVLMKQEDE"
FT   gene            complement(240836..241489)
FT                   /locus_tag="Mboo_0258"
FT   CDS_pept        complement(240836..241489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0258"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: mhu:Mhun_2850 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54780"
FT                   /db_xref="GOA:A7I4W9"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4W9"
FT                   /protein_id="ABS54780.1"
FT                   /translation="MTTPYPRSDERRRMVDLQIAGRGIRDPRVLAAMAEVPRHLFIPPP
FT                   YDRDAYADTPLPIGNDQTISQPYIVALMTELLHPCPEDRVLEIGAGSGYQAAILARLAA
FT                   KVVTIERLGAVAAQARANLAAVGAENVEVIEGDGTFGYPLSAPYDGILVTAASPEIPQP
FT                   LTEQLADKGRLVVPVGGRAMQDIVVLERDGSRYREERIEGVRFVPLIGKYGWEN"
FT   gene            complement(241504..242619)
FT                   /locus_tag="Mboo_0259"
FT   CDS_pept        complement(241504..242619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0259"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: mhu:Mhun_2849 SufBD"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54781"
FT                   /db_xref="GOA:A7I4X0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4X0"
FT                   /protein_id="ABS54781.1"
FT                   /translation="MSAQLNAPGIAKDDQERIVQSGIDFDLENRCGSYLQVDQNIVESE
FT                   CRQEGIEVLSFKKAMEKHAWLKDFLWKAVSKDKDEITQYVAEQPDPKGYVIIAHKGSKN
FT                   ILPIQACLYLGRETIQHVHNIIIAEEGAELHMISGCASSGNIGEGAKHYGVSEFYIKKD
FT                   AKISFTMIHTWNENVEVFPRSASIVEENGVFLSNYVCMQPVKKVQMYPTATLKGENSVA
FT                   RFSTITVASPLSYIDVGSRAILEGKGASAELITRAITKGGTIISRGQIIGKTAGTRGHL
FT                   ECKGLILKNGTIYAIPEIDGRVVGTELSHEAAVGKLAQDEIEYLMSRGLSEDEATATII
FT                   RGFLDVKIAGLPETLQKQIDATIDVAEKAGF"
FT   gene            complement(242604..243368)
FT                   /locus_tag="Mboo_0260"
FT   CDS_pept        complement(242604..243368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0260"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mhu:Mhun_0461 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54782"
FT                   /db_xref="GOA:A7I4X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4X1"
FT                   /protein_id="ABS54782.1"
FT                   /translation="MQPSTYTMRFGMLDIRDLHVNVGEKEVLHGINLHIDAGETHVLMG
FT                   PNGSGKTTLLMTLMGFSGYKITKGEITLNGEDVTAMHADERAKRGIGMLFQRPPTISGL
FT                   KLGKLLTAISHDKTVDLPALADSVHMGGFLERDINKGFSGGEIKRSEVLQLMIQNPGFV
FT                   MLDEPESGVDLENISLIGKAIGDLLEKDKRMAKREKSGLVITHTGFILDYVDADKGHVM
FT                   CDGMITCHGNPREILKDIKQRGYTECRECRRS"
FT   gene            complement(243774..245177)
FT                   /locus_tag="Mboo_0261"
FT   CDS_pept        complement(243774..245177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0261"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: mbo:Mb2551c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54783"
FT                   /db_xref="GOA:A7I4X2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4X2"
FT                   /protein_id="ABS54783.1"
FT                   /translation="MEQAEYPQLPGVNSIFDQFSSNDIPAKTRALMPGIVTDLEKLIRY
FT                   PSVAFPGYPEEPVRAMADATAAILREYRLDNAQLIDVPGGYPAVYGEIPAPHGMPTVLM
FT                   YAHYDVQPAKKEDGWTTDPWNPQEINGRLFGRGSADDKSGIMLIAASLRVFDGKPPVGV
FT                   KVLIEGEEETSSHIEALIASRPDLFSCDAFIIEDNGNLTAGEPALTTSLRGEVSCIIEV
FT                   STLDHPVHSGMFGGAAPDALVALIRILATLHDARGDVAVPGLRPDPPGNGDYPEADYRD
FT                   SAGVLNGVDLIGTGTIGDRLWTRPSLTVIGIDAPSIKASANILIPRASAKISLRIAPGA
FT                   DAGHELSALMEHLRSVAPWNARVTVQEVSRSPGFACPTDGPGYAAARAALAEAFNRPVL
FT                   EKGTGGSIPLLRTLQVAVPRAEFILWGPEDAAGSRIHGTNESVDLHDLELTIVAQALFL
FT                   TLLGKSRAG"
FT   gene            complement(245229..246020)
FT                   /locus_tag="Mboo_0262"
FT   CDS_pept        complement(245229..246020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0262"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport protein; Ion transport 2 domain
FT                   protein,; KEGG: vvy:VV0578 Kef-type K+ transport system,
FT                   predicted NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54784"
FT                   /db_xref="GOA:A7I4X3"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4X3"
FT                   /protein_id="ABS54784.1"
FT                   /translation="MGEVPVSELIDLKDPGYEIFIIFVSVLSVINLFVTLIPGLNPQAV
FT                   GVVQITNFFLTIIFLADFVFRLLSAGSKKHYFFFDWGWADLLASVPFLRILRLFRIVKA
FT                   YHLLKKYGVKNISAQIARHRAESVLYIVIFCVILVIECGGILILIAESPAPNANIKTAS
FT                   DAMWWVYVTITTVGYGDRYPVTSAGRLVGVLVMTTGVGLFGTLAGFIAHKLVAPAVNAA
FT                   PEETKAPDPTNQDAQKEQARQNAEILDRLDRIEQELKKQSR"
FT   gene            complement(246223..248418)
FT                   /locus_tag="Mboo_0263"
FT   CDS_pept        complement(246223..248418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0263"
FT                   /product="translation elongation factor aEF-2"
FT                   /note="TIGRFAM: translation elongation factor aEF-2; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: mhu:Mhun_2828 translation elongation factor
FT                   aEF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54785"
FT                   /db_xref="GOA:A7I4X4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4X4"
FT                   /protein_id="ABS54785.1"
FT                   /translation="MSRGKKTVERVVELMKDPKHIRNIGIVAHIDHGKTTLSDNLLAGA
FT                   GIISEELAGKQLFMDSDAEEQARGITIDASNVSMVHEVEGQDYLINMIDTPGHVDFGGD
FT                   VTRAMRAVDGAVVLVDAVEGTMPQTETVLRQALKEQVRPVLFINKVDRLVNELKVDETE
FT                   MQIRLGKVIDKVNKLIKGMNEDLYNNGWKLDASKGTVAFGSALYNWAVSVPYMKKGGVS
FT                   FKDVFEKCRAGDMKYLAKNSPLYEVVLDMVVHHLPNPLEAQPRRVNVIWHGDHSTKEGK
FT                   AMLACDPNGPATMMVTDISFDPHAGEVATGRLFSGTLRRGDGLYVMGSAKKENRLQQVG
FT                   IFMGPKRVEVEEIVAGNIAAVTGLKDAIVGSTVTSLMEMSPFESLKHYSEPVMTVAVEA
FT                   KNMKDLPKLVEVLRQVAKEDPTLGIAINEETGEHLISGMGELHLEIVTGRIKRDKGVEI
FT                   VTSEPIVVYRETVTGKVEDVEGKSPNRHNRFYFTLEPLPEEIVNLIKAGEITMNQQAIE
FT                   RRDVLLKAGMDKDEAKNVKHIKGTNMLIDMTKGIQYLNETMELIIEGINEALAGGPLAD
FT                   EPVQNLKMTLTDVKLHEDAIHRGPAQVIPAVRGAIKGGMLIAGDSLLEPVQKIQISVPM
FT                   DQMGAATSQIQGRRGQVFDMQSEGDTITVVGKAPVAELFGFAGDIRSATEGRAMWNTEF
FT                   AGFELVPNNLVKDVVVAIRKRKGLKEQMPTPSDYLSV"
FT   gene            complement(248443..249057)
FT                   /locus_tag="Mboo_0264"
FT   CDS_pept        complement(248443..249057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0264"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: mhu:Mhun_2829
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54786"
FT                   /db_xref="GOA:A7I4X5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4X5"
FT                   /protein_id="ABS54786.1"
FT                   /translation="MAEAEVKAQPEGDAAPQSKALLFNKWDVSEVKVTDPSLVRYVNLT
FT                   PQIIPHSCGKFSRQEFNKANMMIVERLINRLMQTENNTGKKQLAIGIVRDAFELINKKT
FT                   KRNPIEVLVEAIGNTGPREETVRLKYGGINVPKSVDTAPLRRVDSAIGFIAEAVWKSSR
FT                   KSKKPASAILADELIAASKGDAKCYSVGKKEEKERIAKSAR"
FT   gene            complement(249063..249491)
FT                   /locus_tag="Mboo_0265"
FT   CDS_pept        complement(249063..249491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0265"
FT                   /product="ribosomal protein S23 (S12)"
FT                   /note="TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   ribosomal protein S12/S23; KEGG: mhu:Mhun_2830 ribosomal
FT                   protein S23 (S12)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54787"
FT                   /db_xref="GOA:A7I4X6"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4X6"
FT                   /protein_id="ABS54787.1"
FT                   /translation="MGQGKFAARKLVRDSKKFRWSDKNYARRELNLDVKSDPLEGAPQA
FT                   RGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRQVTAFAVGDGAINFIDEHDEVEIEGIG
FT                   GRLGRSMGDIPGVRYVVTSVNNVCLHEMVIGRKEKPRR"
FT   gene            249646..250059
FT                   /locus_tag="Mboo_0266"
FT   CDS_pept        249646..250059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0266"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2831 6-pyruvoyl tetrahydropterin
FT                   synthase and hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54788"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4X7"
FT                   /protein_id="ABS54788.1"
FT                   /translation="MITPMKVGIYKEVQIDTSHRLLHYNGKCANLHGHRWKIEVWMEGE
FT                   PDPATQIVIDYSVIKKIVEKYDHQIILNKDDPMVPRIAEFHPVITTPGDPTSELIASII
FT                   RDDLDSACRDMGLRAKVTKIRVWESPTSCAEIS"
FT   gene            250061..250669
FT                   /locus_tag="Mboo_0267"
FT   CDS_pept        250061..250669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0267"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_2832 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54789"
FT                   /db_xref="GOA:A7I4X8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4X8"
FT                   /protein_id="ABS54789.1"
FT                   /translation="MKIAEIFKSLQGEGVRQGTPCIFIRLAGCNLACRWCDTQYARSGG
FT                   TETSCDKILEEIWKENPRSVCITGGEPLLQTDVLLPLLASLHKRGITIDIETNGTIDFS
FT                   PVQPFAAVCMDVKCPSSGERSDLSLLARIRPTDSVKFVVGDLADCRYAQEVLARHAIAG
FT                   ECFLSPVYGTDCDTIVRFILDNNLPVRFQLQLHKILGVK"
FT   gene            250767..251264
FT                   /locus_tag="Mboo_0268"
FT   CDS_pept        250767..251264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0268"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mhu:Mhun_2834 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54790"
FT                   /db_xref="GOA:A7I4X9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4X9"
FT                   /protein_id="ABS54790.1"
FT                   /translation="MEIFRGGKLWIEKKKIQLPNGVEKDAVIVHPKGAVAILPVTETGY
FT                   LLLRQYRYAVGQYIWEAPAGTMEDGEDPIETARRELIEEAGVAAGNLIPRGFIYTTPGF
FT                   TDEKIWLFEARDLTPSDEFQKDADEVIEVMDVTRDNTDAMVTDGTICDAKTICLLHQCG
FT                   EG"
FT   gene            251268..252164
FT                   /locus_tag="Mboo_0269"
FT   CDS_pept        251268..252164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54791"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y0"
FT                   /protein_id="ABS54791.1"
FT                   /translation="MRTLLIAAGLACLVVLAACAGCMSSTTPQPTYTVDNNGVLSVTCA
FT                   PVTTNETVLFSNETYTESKIILHTQTGDVTTYLSYPEDPKAVLLYLPGAGEKISGHAGR
FT                   MVQYAADGYAFMFLDYRGRGGETTGYPFNPNTDYALFENKEWPEYYQTICDISSAQALL
FT                   SSRFNVPVYAMGGSNGGRYAAVAAGVDKNFAGYIGISTADWGLKDQVLSQGGSGDILRF
FT                   AESLEPSTYLPTISPRPVWMYHNATDPIIPFADGQALYATANKPKNFTEFNGDHGINPD
FT                   VDNRLMALLAQIYGTQA"
FT   sig_peptide     251268..251342
FT                   /locus_tag="Mboo_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.835 at
FT                   residue 25"
FT   gene            252204..253475
FT                   /locus_tag="Mboo_0270"
FT   CDS_pept        252204..253475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0270"
FT                   /product="peptide chain release factor eRF/aRF, subunit 1"
FT                   /note="TIGRFAM: peptide chain release factor eRF/aRF,
FT                   subunit 1; PFAM: eRF1 domain 1; eRF1 domain 2 protein; eRF1
FT                   domain 3 protein; KEGG: mhu:Mhun_2836 peptide chain release
FT                   factor eRF/aRF, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54792"
FT                   /db_xref="GOA:A7I4Y1"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y1"
FT                   /protein_id="ABS54792.1"
FT                   /translation="MTEPVEMDEARRRYEFKKTLEKLEAQEGDGTELITLYIPPDKQIY
FT                   DVTGQLKDEFGQCANIKSKQTRTNVQSAISSILSRLKYYKRPPEKGMAVFCGTVKLYGD
FT                   RTDLQCTVIEPPEPLNLYMYRCSSNFELEPLKQMLEEKFVYGLLVLDRREAYWGFLRGN
FT                   RIEPIGGSTSTVPGKMRKGGQSAARFGRLREIAINEFYTKVGERSSAIFLAEKDYFTRF
FT                   KGLLIGGPSPTKEEFEAGNFLHHEVQKRILGLFDVAYTNEDGLPELVDAAKDVLSGMAV
FT                   VKEKAFMDRFLKELVKDNGLAAYGEESIRKNLEVGAVDRLLLSSNLRKSRLKIKCQNCD
FT                   HTEERTVNMPLGKTIRDIELGSCPKCTAPLVLEEEIDIIDELAKLADLSSAKVELISDD
FT                   FEEGSILYSAFGGIAALLRYRTGY"
FT   gene            253475..255151
FT                   /locus_tag="Mboo_0271"
FT   CDS_pept        253475..255151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0271"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: mhu:Mhun_2837 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54793"
FT                   /db_xref="GOA:A7I4Y2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4Y2"
FT                   /protein_id="ABS54793.1"
FT                   /translation="MVVDTTAAIKRALSECTGLAEIPLVDGGEHADLATTVAFALAKTK
FT                   KQAPVKIAQDVVAALKNNRELSDLGVTVEAKGPYINFVFGSAYVTAALKAAVQPGYGSF
FT                   PAKESPRIVLEHTSANPNGPLHVGHIRNSIIGDSLARAFRKAGYPLEVEYYVNDMGRQI
FT                   AIVTWGFDHLEHGQHESEKEDAHIARVYIAANREIEKDPGITKQVDKLMELVESGDPET
FT                   VKKFRREVSRCLDGFAVTLKNLNVKHDRFVWESDFVKNGDTKAVIAKIENLPQATHEGT
FT                   LLALDLAEFGFTNKYVMRRSDGTSVYAARDLAFHTWKNQNFDRAIDVLGADHKLIGAQL
FT                   QCTMQLLGEKAPEIVHFEFVSLPEGSMSTRAGKFVSADELIDEVTKRAFDEVTTRRPEL
FT                   DEATRRNIADSVARAGIRYDIVKISPEKSTVFDWKQALDFERQSGPYIQYAHARACSIL
FT                   EKAGAFEECYDLATEQEIILAKKIAKFPSVIEKVVTELRPHLLATYAHELADTFNTFYH
FT                   YEPVLKSEGEVRDRRLTLVKAVQNTLQESLETLGIDAIHTM"
FT   gene            255132..256043
FT                   /locus_tag="Mboo_0272"
FT   CDS_pept        255132..256043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0272"
FT                   /product="Wyosine base formation"
FT                   /note="PFAM: Radical SAM domain protein; Wyosine base
FT                   formation; KEGG: mhu:Mhun_2838 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54794"
FT                   /db_xref="GOA:A7I4Y3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y3"
FT                   /protein_id="ABS54794.1"
FT                   /translation="MPSTPCDARIRQGYLFFSPKSSAALKPCLWCKRALTGGDMCYKHQ
FT                   FYGIDSHRCVQMTPTLRCNQRCLFCWRSFEHEVEEEEECPPETILAGVPKLQKKALAGY
FT                   NSVLGNTVTDERWQEALKPRHVAISLSGEPTLYSRLPELVDLFNANGYTTFVVSNGTNP
FT                   DMIARCRPFQQYISLDAPDCETYERACRPMGNAEAFWDRIRESLGKLRAKRSAVRITLV
FT                   AGVNDTDPEGYARIIQDSGATYVEVKGYMYLGYSRNRLQRNNMPEHAQVRDFAERVSAS
FT                   CDYTIRDENPLSRVVCMEREEQ"
FT   gene            256040..257692
FT                   /locus_tag="Mboo_0273"
FT   CDS_pept        256040..257692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0273"
FT                   /product="O-phosphoseryl-tRNA(Cys) synthetase"
FT                   /note="TIGRFAM: O-phosphoseryl-tRNA(Cys) synthetase; PFAM:
FT                   phenylalanyl-tRNA synthetase, class IIc; KEGG:
FT                   mhu:Mhun_2839 phenylalanyl-tRNA synthetase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54795"
FT                   /db_xref="GOA:A7I4Y4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR005246"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041590"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I4Y4"
FT                   /protein_id="ABS54795.1"
FT                   /translation="MRFNPQDWKEKSHTNFEGAWHDGPSVITPPGEDKKYPRLRYTRAQ
FT                   PHPIFATINRLREIYLSMGFDECENPVIVEESDIYRQFGPEAMAVLDRVFYIGGLPRPN
FT                   VGISRKQLDEINDILQSHRSPLVHGHEIPAGDSGNKEPFRPMSRETEEQLRETLHAYKK
FT                   SEIDGDELTHELAKVLGVDDGIVVHILDSVFPEFRSLVPESSRSTLRSHMTSGWFMTLG
FT                   SLWERTPLPIKLFSVDRCFRREQAEGPTRLMTYHSASCVVAREDVTIEDGKAVSEALLS
FT                   AFGYEDFRFQPDDKRSKYYMPDSQTEVYAKHPVHGWVEVATFGMYSPSALGEYGIGVPV
FT                   MNLGLGVERLAMIAYNANDVRQLSYPQFFPRLAGDREIACAVHLREEPVTVEGKALALA
FT                   IARVAAAHATEQGPCSFTVWEGTLYGRNVNVIIEETEANAKLCGPACANEIFVHEGNIL
FT                   GVPDNEKWKDVRIKGIPTGISYLSAVSALAAANIEHAARCGTGTQVQVKMAKHPGDINL
FT                   KIEEYAMRTITDTKKKVDVRGPVFLAVRSEIAE"
FT   gene            complement(257733..259151)
FT                   /locus_tag="Mboo_0274"
FT   CDS_pept        complement(257733..259151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0274"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1309 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; histidine kinase A domain
FT                   protein domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54796"
FT                   /db_xref="GOA:A7I4Y5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y5"
FT                   /protein_id="ABS54796.1"
FT                   /translation="MISVLYVEPDARMQEEVRGFLESDPGIRVVTLGSAYEALDLIRER
FT                   RFDVIVSESCLPVTDGQAFLEVLRLGRKESTPFIIFAKKSSHNDAIRALNTGATYYLLK
FT                   GTDPEKVFPVLRHYVTQAVNQHRIKEELEKSEKRYRSVVEDQSEFIVRFRPDGRLVFAN
FT                   GAYCRYVSLNEKELIFGKTVDLPPFGQKDLFLQDLRALSPDAPTSTLELPWILPDGRVA
FT                   WQNWENRAIFDAEGKIIEYQSVGRDITERKTAEFALREALRNLGIMNSITRHDILNQLT
FT                   GMFGYLESCLNASTDPRVRESLGKAISTAETMKTQILFTRDYQEIGNAAPRWQNAEEIF
FT                   SRAAGSLALSRMTLEIHLDNLWVYADPLIEKVFFNLLENSLRHGERVSVIRVFSREDDH
FT                   GLMVVYEDNGIGVPAGAKEKIFRREYFQNTGLGLYLSREILAITKMEIQETGIPGEGAR
FT                   FEIFVPKGSYGTRV"
FT   gene            complement(259268..260233)
FT                   /locus_tag="Mboo_0275"
FT   CDS_pept        complement(259268..260233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0275"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   mhu:Mhun_0794 phosphoribulokinase/uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54797"
FT                   /db_xref="GOA:A7I4Y6"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y6"
FT                   /protein_id="ABS54797.1"
FT                   /translation="MPRTPPFKEIIARSPLVFVIGVAGDSGSGKTTFTNAIREIFGPDL
FT                   VATITLDDYHTYDREERHHLDITPLHPDANNLSGLEADVAHLKQGYAIEKPVYNHATGT
FT                   FDPPIPFPSKKILILEGLHTLFTPALRDLVDFSVFVDPDREVKYAWKRQRDTGQRGYSP
FT                   DEVNGEIARREADYATYIEPQRCNADAIIRIGYSKYGKDLGPAKNVYSISLLQNPMDQA
FT                   VRNTSLSIDLTSLLAFHESEFSIEFSTQRIECSFLRSLTFDGEMNYDTVRNLELSIEHQ
FT                   TGIHPIEMFAGRKVVTPTNIVQLLLSWRIINRRIFLQDHR"
FT   gene            260388..260774
FT                   /locus_tag="Mboo_0276"
FT   CDS_pept        260388..260774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54798"
FT                   /db_xref="GOA:A7I4Y7"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y7"
FT                   /protein_id="ABS54798.1"
FT                   /translation="MKPRNIYRIVIGLLFILTGAVAGLSSSGNIVLPVILLAAGAAFLT
FT                   TGLIRHNRYGDDPESDERSKKIGAYGLSYAWMTGAVGITLLFWGEYAGIGHLGGTEALE
FT                   LSVLLLVIPAVVFQAYLFRKGDVE"
FT   sig_peptide     260388..260471
FT                   /locus_tag="Mboo_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.435 at
FT                   residue 28"
FT   gene            260798..261031
FT                   /locus_tag="Mboo_0277"
FT   CDS_pept        260798..261031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0277"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mbu:Mbur_1719 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54799"
FT                   /db_xref="GOA:A7I4Y8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y8"
FT                   /protein_id="ABS54799.1"
FT                   /translation="MQTKIKECRARYSLTQDELAKKVGVRRETIVFLEQGKYNPSLKLA
FT                   HDVAKTLHTTIDELFIFDDDEPGPESRVVLVD"
FT   gene            complement(261042..263363)
FT                   /locus_tag="Mboo_0278"
FT   CDS_pept        complement(261042..263363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0278"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: mhu:Mhun_2730 DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54800"
FT                   /db_xref="GOA:A7I4Y9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Y9"
FT                   /protein_id="ABS54800.1"
FT                   /translation="MAVADVVHFISTNPVYRSRVACHNVTDPEPAAYGKLDRPLPDALD
FT                   AYLAHAGIRLFTHQCEAVNLLREHRNVIITTPTASGKTLAFNLPVFERMSADPDARALY
FT                   LYPTKALANDQLATLLAMEKFTGIPVKSAIYDGDTPQSKRSAIREHARIVISNPYELHQ
FT                   VLSWHSKWSPFFSNLQYVVLDEAHRYRGIFGSQIALLVRRLRRLARYYGTDPQFVLSSA
FT                   TLANPEEFAKRLAGLPFVQVESDGSPRGRRHFVLYNPFFDGVGERSAHQESKDLLVSCV
FT                   KGDLQALCFAGSRKIAELVALWAKEDLRRNSPRLAESVLAYRAGYLPEERRWIESRLKG
FT                   REIRGVVSTNALELGIDIGSLDAVIIDGYPGTMMSTRQQAGRAGRKAGESLAVLVAQAN
FT                   PLDQYFMHHPEEFFSRPHEHAIIDTQNPYIVSGHLLCAAAELPLHEEKDREFFGDRFSP
FT                   VLSDLAGSGLLSRTSRGFVYAGRGRAAEAVTLDGMAAESFRILCEGRVLETMDRAQAYR
FT                   EAHKGAIMLHQGITYVVNEMDLENHTVRVSETDVDYYTQPLKDTSLKVLETLETREIHG
FT                   VTCAFGNVEVTERYTAYKIKKGDTVLGVEPLDLPPITFRTKAFWLVVPETLATPVCASG
FT                   LDLAGGLHGAEHALIALMPFFVLCDRWDIGGLSCPVFGESGEPMIFIYDGYEGGIGLAE
FT                   KAYTLLPELFTRTHEMVRDCTCKKGCPSCIYSPKCGNDNIPLDKEATVMILAGLAAAGA
FT                   GNITMPGQAGIIPGAGPVAQ"
FT   gene            complement(263350..264435)
FT                   /locus_tag="Mboo_0279"
FT   CDS_pept        complement(263350..264435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54801"
FT                   /db_xref="GOA:A7I4Z0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z0"
FT                   /protein_id="ABS54801.1"
FT                   /translation="MAGMQAESRIGEIWQQRMAALREYSVVRDGNVFGAGLAGSCLFSS
FT                   EYDRARALLGRLVSQYDNVSFESLFPGSEIETENGTCLALEHREAFAAPPLDGERLSAE
FT                   MLADLTLVRGIGERSAARLRARGWKTIADLANHPRFRYAAREVLERLSRADPREIMDLA
FT                   GNRHAKSHPFVLGAAGAFSPQDFVFLDIETLGLFSRPIILFGVGTVEERNFVVRQYLLR
FT                   DIGEEAAALTALAGHFARQKKALVTFNGKAFDLPYVQDRLAYYGIPPVSRVPHFDVLHF
FT                   ARRRWKGQYPSCRLGELESAILGVGRENDVPGQMVPEFYETYLRTNNCGPLVPIVHHNR
FT                   QDVISTAHLFFYLLGETCGRC"
FT   gene            264536..265192
FT                   /locus_tag="Mboo_0280"
FT   CDS_pept        264536..265192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0280"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   cya:CYA_0959 glutamine amidotransferase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54802"
FT                   /db_xref="GOA:A7I4Z1"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z1"
FT                   /protein_id="ABS54802.1"
FT                   /translation="MITILRHGEHEPAGTIEDTLNAKNEPFTVIRLYESDPVPADPPER
FT                   LIVLGGQMSVNDEREFPFLVDEKSLVKKAVARGSTVFGICLGAQMIAAACGKTVYAGEK
FT                   ELGWRTLTGCNSPGHRFFPGQFNVFHWHKETFDLPEGARLLATGTAVKNQAFMLNNALG
FT                   VQFHTEVTKEIITFWAKDLGADERDLILKDSEEKLIENRILCDAIVSVFLAGWKW"
FT   gene            265201..265977
FT                   /locus_tag="Mboo_0281"
FT   CDS_pept        265201..265977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0281"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   mtp:Mthe_0653 HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54803"
FT                   /db_xref="GOA:A7I4Z2"
FT                   /db_xref="InterPro:IPR006355"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z2"
FT                   /protein_id="ABS54803.1"
FT                   /translation="MPDRKIRGFLIDLDGVLYTGDTPVPGAVEAIEFLTENGYPFRCLS
FT                   NSTRKCRATIAARLEKMGFDIPEHSIFTPPLAAVRYMEAAGKDKAFLLVTGDVDRDFSG
FT                   ACTDDGSGHMDYVVVGDAGDNVTYANLNHAFRCLMEGAGLIALEKDRYWMDRDGLSLSA
FT                   GPVVAALEMASGTTATVVGKPSKEFFGLALRDMGLAAGEVAMIGDDIFTDIGGAQAAGI
FT                   RGVLVRTGKFRKDVCEKSTIIPVAIINSIRDIGTLL"
FT   gene            265985..267091
FT                   /locus_tag="Mboo_0282"
FT   CDS_pept        265985..267091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: neq:NEQ353 bipartite nuclear localization
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54804"
FT                   /db_xref="GOA:A7I4Z3"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z3"
FT                   /protein_id="ABS54804.1"
FT                   /translation="MTRTDRFLIVVVATLMVIAMAAGYFYATRPQVVVSHIVVGTDDSP
FT                   PITTTHTFPFENNQITITVPVDAAVYDAAKSTDKTVSVYGNVTENVWVTDSYQELINDP
FT                   TQDQMFTNLIAQFRKIRDEKGLTSDEYLELMATYTQSLTYENNPETPTKYPVETVVEGN
FT                   GNCGDKSVLLAGLLSREGYKVSLLLFTPEAHMAVGVGSTDSLYKDTGYAYLESTNLSYV
FT                   GVPPDELEGGIRLTSEPMVIPVGNGTTLYTRGAETAYIYNEETLSEQKVTAINAQLAPI
FT                   ASDLTAKQNQISQLESRMESLRSSGNIGGYNALVSSQNAQVSAYNAELSTYQREVAQGN
FT                   AYAEVYNYVITHVYDRKGTYSWVKANMP"
FT   sig_peptide     265985..266050
FT                   /locus_tag="Mboo_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(267119..267997)
FT                   /locus_tag="Mboo_0283"
FT   CDS_pept        complement(267119..267997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0283"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   hac:Hac_1016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54805"
FT                   /db_xref="GOA:A7I4Z4"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z4"
FT                   /protein_id="ABS54805.1"
FT                   /translation="MKQEKVKDKAGKAKVRKGSKDAKAPLPSRENPEIEPFVNRIFCGD
FT                   ALSVLSGMPSESVDLVITSPPYNFGHAYAQDPHDDTREWNDYFATLNAVWTECVRVLRP
FT                   GGRMAVNVQPLFSDYVPTHHIISNQLLGLGLLWKAEFLWEKNNYNAKYTAWGSWKSPSM
FT                   PYIKYTWEFVEIFDKGTHKKTGRREDIDITSDEFKEWVIGRWKIPPEHRMKEFDHPAMF
FT                   PEELPRRVMKLFSYKNDIVIDPFNGAGTTTLAAAKCGRRFIGIDVSHQYCDTAVRRLRE
FT                   ATDQRLPEPEP"
FT   gene            complement(268075..270723)
FT                   /locus_tag="Mboo_0284"
FT   CDS_pept        complement(268075..270723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0284"
FT                   /product="LVIVD repeat protein"
FT                   /note="PFAM: NHL repeat containing protein; LVIVD repeat
FT                   protein; KEGG: mma:MM0391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54806"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z5"
FT                   /protein_id="ABS54806.1"
FT                   /translation="MNKPTLLPARTVFTLLLLSLLIGIGAAASAPSVTDITPDTRENTT
FT                   RTFTANISGSGFAAGAQVLLVPVGARPIHAGSITDGGGTAPFLNGPLAVFLSGSHAYVA
FT                   SQGSNALEIIDVADPAHPVHKGSLLNGTGGALLKAPTGVAVSGNYAYVTSSGNNALEIV
FT                   DISNPAHPVHAGSITNGTGGALLYNPQSVAVSGRYAYVAGSGSNSLEIVEISDPAAPVH
FT                   AGTMKDDILFKNPTGVFVSGNYAYVTSSGNNTLEIIDVSNPANPVHKGTINDGKGKSPF
FT                   LKNPKNVFVIRNFAYVASFGDNTLEIVDVANPANPIHKGALVSGTGEAMLGAPTGVYVS
FT                   DHYAYVASYGSNALEIVDVSNPAVPIHLGTISNMPGGALLDVPSGVSVSGPYAYVTGKT
FT                   GNSLEIVDIGSVISIPAGSVTWRSATMIASTFNLTGAAAGKYNVVVANPGSPPGTLAGG
FT                   FTVTAPQPCPTVTGITPSSGTNATLIQITDLTGSNFNTTIAPTVKLNRTGFTDILATNV
FT                   TALRSTQLTCTFDLTGREAGSWNVVVTNPDERGGLLQNGFSVIYQVPTTPPTTVPTTLP
FT                   TEVPTTFPTDVPTLTRTTVPTNTQPVPPPEPTPLPAITGSGGSVSESGISGRGISSVAT
FT                   SPGAPAGGIMSFALDNAGSRGFAEYPYTVTAATLVPSQPLGPTDLIVAYGMTVRPPGND
FT                   HVTAGIVSLEPVATNPSAISSGTITFAVADTWLRANRLTPAHVTLMRLEEDIWSELPTT
FT                   YLNRSGDAHYFTATTPGFSYLAVSTRSSMGGVNSIGTMDTAALSPAVSMPVVSVAPAPP
FT                   VAPDTPASVDRTPEVPRTPPVPANNGVPQASGTGTAAAVIGTAGAAPACGLYLRRWWIR
FT                   RQNPKLFRKYD"
FT   sig_peptide     complement(270634..270723)
FT                   /locus_tag="Mboo_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.604 at
FT                   residue 30"
FT   gene            complement(271096..271599)
FT                   /locus_tag="Mboo_0285"
FT   CDS_pept        complement(271096..271599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54807"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z6"
FT                   /protein_id="ABS54807.1"
FT                   /translation="MADFAPKSAVKSAVRTLAAPFEDVDTLNAVVQSVILNNPFGCVSY
FT                   MSTGANHPPVEKSRENYTARFVYQDNEAKIVGRTAENYATVAGYKAGVAAVLANTANIA
FT                   AHGGVPAHEIESDTFSVTLKCHAANGEIFLLTFARQQVSLSSYEDDSIQTVVETWADGV
FT                   PSLA"
FT   gene            complement(271792..272301)
FT                   /locus_tag="Mboo_0286"
FT   CDS_pept        complement(271792..272301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54808"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z7"
FT                   /protein_id="ABS54808.1"
FT                   /translation="MIETTTAQDVIAPGAMASGASYSNRINPCEAVAGETTVILHTAPG
FT                   GNEAGTAQRYSRNSAHVHEALRILAANGHVPVRLAESPLPVNIIAFKKDDPLLVLVIGA
FT                   RKPVPSAARLHADYKEAVEYLCLMAGRLRCRIMIWVHSPSCGWRYYRVFPGGLAYDHKF
FT                   PSLLED"
FT   gene            complement(272885..274783)
FT                   /locus_tag="Mboo_0287"
FT   CDS_pept        complement(272885..274783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0287"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: tcx:Tcr_0336
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54809"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z8"
FT                   /protein_id="ABS54809.1"
FT                   /translation="MDIDDILAAFQIFDHVSDIDKFQSWIRTYHKIEDFEPLFLGYRYF
FT                   LEICGIRIVDEISEDFSLNLEMDDYFSFACNADLPLDEIPNSCEKVIVIKNIWRYFEPI
FT                   KNAKDWAELKTIIHQTEEISKIFREIFKNANVTENFPEKEISRFAALHYTHIFFNDTSR
FT                   LKPAGAVVGLIKLDIDSIGSDFFKGYAYTLEYLWYQLLEKNEFQHSLAKNIHNPATGLS
FT                   SEDLQRITEIYSHNDYEDPAFQENAVMWATLDQLFQPLFEKCLAPKFREYHTSSRSHFI
FT                   VRDNISKSLIFPLLDRTYINEPYYFSDNSNDEARFKKIDYHFKWLPVTYIDSGKVHDAF
FT                   GTYAFIPFLLGLTSSENVSSNNKIEILRIKHPEDGVSGYFYSYGILNKSQYFDEQGMGW
FT                   IIFLTCGTDFSGHGGSMHTSAEKCIREIQKRGILDAKEITIDENAFRRYLKERTETSVS
FT                   DSTTPVETLIEFGESQLVEFKSSLLWSYEKNQISNSTEYEVVRTIAAFLNSSGGTLLIG
FT                   VDKNKNIVGLDKDYAQLKQARRVQNRDGFEIRLNEVLNKFFGRGIRLDIDVIFERLSEK
FT                   EICRVIVKPTIEPIFLVNSNNSNHSEFIVRSGNQSQLLMGKEITSYITKHWNYKKR"
FT   gene            complement(275361..275675)
FT                   /locus_tag="Mboo_0288"
FT   CDS_pept        complement(275361..275675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54810"
FT                   /db_xref="UniProtKB/TrEMBL:A7I4Z9"
FT                   /protein_id="ABS54810.1"
FT                   /translation="MKKTITVSGILALCLVLFLIGAGCTSQSQGTGAGQAGGQQTVTTP
FT                   QTTAQSTPVVTATAAATAPAVSDQGLVSDDGSDAVAQAEALNSTQASAPDTADFGDIMP
FT                   "
FT   sig_peptide     complement(275589..275675)
FT                   /locus_tag="Mboo_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.380 at
FT                   residue 29"
FT   gene            complement(275695..276762)
FT                   /locus_tag="Mboo_0289"
FT   CDS_pept        complement(275695..276762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54811"
FT                   /db_xref="UniProtKB/TrEMBL:A7I500"
FT                   /protein_id="ABS54811.1"
FT                   /translation="MVKHAKIILCLLVLAVLMVPAVSAWSPGQPWTDNSEHIAAMQAYT
FT                   AYAGELFKAKMDGAIQYIGTLNQSTSTLQNDEQQFLATVSSVQSMSSNDTITQAWGTMT
FT                   QQVTQFRTDLKTAISAGNGSGSALQAAVNSSVTADQANIQNLDTTYWTDREKSRLDEFS
FT                   YNDGRRTDLLTNLTAKGIDVSSAQAIESQIQALQPQLKAALDAKDEAQIRQVNSQIDSL
FT                   CQQLSQAVVNLSWQARESARLAQFTNTTTRMQDRLTNLTARGLDVSDAQTILSQITALQ
FT                   SQLQTALQNHDQSTLSSVNSQLESLDQQYAQALQQITAQARSQLANQTAQNRENRTAGE
FT                   RRTNQSVGGFAPKFG"
FT   sig_peptide     complement(276688..276762)
FT                   /locus_tag="Mboo_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.533 at
FT                   residue 25"
FT   gene            277154..278137
FT                   /locus_tag="Mboo_0290"
FT   CDS_pept        277154..278137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54812"
FT                   /db_xref="UniProtKB/TrEMBL:A7I501"
FT                   /protein_id="ABS54812.1"
FT                   /translation="MKPRTVVLLVLLALGLCCAIGPAMADNNSTVWGMPSSGYNQSYAR
FT                   SIGPNSSLYGLQTAFENLDESFTFNQTEKLEKEIQYDNIRIAELEAALAANQSDAANRA
FT                   MDQYRLDLNRTQRTISWYNTTDSQYAFNGTDLGTGPQQGSYRNSTGTGLPDESHRASSP
FT                   QPPNAAAMIAAQQQIALHQDILQHLLDVHPDNSALARAYNTSVDAEKRFEDRTLVHFDL
FT                   ERTADHHVIFHPVVLNPVVRNHIATTNSWNQTRNTVTYTGNGQNTDHTTQNWVDQHRQD
FT                   TSQVNNSNGQYPANNQAYRYRNTSSTGSDNRNTYQNNGRDDQHRFP"
FT   sig_peptide     277154..277231
FT                   /locus_tag="Mboo_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            278222..279205
FT                   /locus_tag="Mboo_0291"
FT   CDS_pept        278222..279205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0291"
FT                   /product="Uncharacterized membrane-associated
FT                   protein/domain-like protein"
FT                   /note="KEGG: hma:rrnAC2685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54813"
FT                   /db_xref="GOA:A7I502"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I502"
FT                   /protein_id="ABS54813.1"
FT                   /translation="MDMLKRYVAITILLLFCILPIAAAATPSDYATTYTITLQPDGSAL
FT                   WTVEYRTPLSTESDIADFQEYSANITSVYLPQLEDLIQHSSSEAATATSRPMSIGNFSG
FT                   NAVVQTSPTGQFGVVTYTFAWTNFSVPEGGLVAGDSFAGGLYLDKDSALILRYPPGYSV
FT                   TSADPAPDQQSGNSLTWYGEREFGAGEPQVVLAAPSLPFLPLIALIVAVILVAVAGFAV
FT                   YRRKRSPREPEAEPDEPGDLSPVLSSADLASLEDRIIGLLKAHGGERFQSEIVRELGLP
FT                   KSTVSSTLNDLHHQGKIQKIKKGRENLIRLAEEDKDSRPEPDAGFR"
FT   sig_peptide     278222..278296
FT                   /locus_tag="Mboo_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.576 at
FT                   residue 25"
FT   gene            279493..281085
FT                   /locus_tag="Mboo_0292"
FT   CDS_pept        279493..281085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0292"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; KEGG: hma:pNG7155 HTR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54814"
FT                   /db_xref="GOA:A7I503"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I503"
FT                   /protein_id="ABS54814.1"
FT                   /translation="MISALYVDDDPDLLEVGRLFLERSGNIRIETALSAEEGLNKLRTT
FT                   PYDIVISDYQMPGMDGIAFLKVVRTRYPKLPFVIFTGRGREEVAIEALNSGADRYIQKG
FT                   GDPRSQFTELIHTVKDSVEKRRTQEEIIHLNRLYSVISRTNRATIHIRDRQALLDEACR
FT                   IAVEEGKFLMAWIGIVDPATREVRPVAACGYEAGYLSLLSITVDNVPQGMGLTGSCIRE
FT                   GCPMVCNEILSDPRMEDYREEAARRGYCSSASFPLRDGNEIIGAMRFYSGECNFFNDRE
FT                   LALLRELTDDISFALEMMERDSTLAELALSNRKLNLLNDLIRHDILNTLTGLLGLEDMA
FT                   ATRLSDPTATGQILDEIRESTKRIQQQITFTRDYQNIGVHAPQWQDLHAVVTRAADPAN
FT                   PGPVALKITIDKDLEVYADAMLEKVFFNLIDNALRYGGGDLTRIALSVRTECSCIIITC
FT                   QDDGPGIPDAEKERIFDSGFGKNTGLGLFLAREILGISGLSIRETGISGKGACFEITVP
FT                   EQAWRRKRVPSLK"
FT   gene            complement(281120..281518)
FT                   /locus_tag="Mboo_0293"
FT   CDS_pept        complement(281120..281518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0293"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: sat:SYN_02719 flavin-nucleotide-binding
FT                   protein structurally related to pyridoxine 5'-phosphate
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54815"
FT                   /db_xref="GOA:A7I504"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A7I504"
FT                   /protein_id="ABS54815.1"
FT                   /translation="MAKLTAEIKESLAATKTAYFATAAKDGTPNAVPIGAYKLLDDETI
FT                   LVSDQYFNKTLANIKENPRVALTFWGEKGGYQIKGTVTIHTSGTIFTEDVAWVKSLKAT
FT                   LEPKSAIVMKITGVYTIKPGPDAGKKIL"
FT   gene            281654..282781
FT                   /locus_tag="Mboo_0294"
FT   CDS_pept        281654..282781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0294"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745; KEGG:
FT                   swo:Swol_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54816"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A7I505"
FT                   /protein_id="ABS54816.1"
FT                   /translation="MHTFMFTADSPDELSHGIREQQSRFTPTLAIVFSSPSLDMGACVR
FT                   ALEGSGCDVFGASTAGEILTGAGASKVFEQSATCCLLDPDPSIFAVRLFPRNDVPPFEL
FT                   GEQAGRWAAGCFAQPAILLAVSGLTNNAEAIIRGMEKHLPTGTVIAGGVAADDTAFLET
FT                   TVFTATSLTSDGIVVLAFDTARVSLSSFTTSGWTGIGVEMTVMSSAGNIVRQIDGKNPL
FT                   DLVADYLNISKEVVVSTALNFPMLVQRPDGSEVLRTALSADYTTGALIYAGSVPEGSKI
FT                   RFSSSFGTETIEKTIREMIAYYEKNPEADLVILFDCCARHQAAGAYVNDEISAIADLWK
FT                   VPVIGFFTYGEIGHSPSGKCDLFNETLSLALLKFR"
FT   gene            282778..284745
FT                   /locus_tag="Mboo_0295"
FT   CDS_pept        282778..284745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0295"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1048 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54817"
FT                   /db_xref="GOA:A7I506"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I506"
FT                   /protein_id="ABS54817.1"
FT                   /translation="MTLMKPTDELRELIGPVLAHVETRDAERIEKILRRIEKHAELQER
FT                   KLQRAILDRQAVHSLMNRTAGDLAKRYQTLFEQDSNPKVIIEKDGTISLANNSFCLLIH
FT                   EMRGDVESKKNICDYLDGMICDPLSDDAAPRDDLSPPDLSSGQIHTAGGEFIDVLINKG
FT                   SFPGSTQSIVTLINVSERMRLERELLETSGFLSGILQASPVGFHMTDTKGNYVYVNETW
FT                   SAITGFAPDQVQGKYYSLILHPDDCDRIADEIEEIAKRRVSREIETRIIRPDGTVRWIF
FT                   NHSVPVIDDGGQLTGWVGAVSDITERKKIETALKESEEKYRALTENTGDVLYSVDMDGN
FT                   ITYVSPQVSRYGYTQEEVISMPLSAFIHPLDISRVRKSLASQAQDRVHTISTFRIFSRN
FT                   GNIHWLEGKSTLQTDASGKPLSFLGILRDVTDRKHAEDAIALANRKLNLMNNVTRHDIL
FT                   NTITGVYGFIDMANATSCEEERVQLLHDVKDLVGIIQRQINFTKQYQEVGIQEPQWQRV
FT                   AAVIERVIPNFSRSGLEFAVELDRLEIYADPLLEKVFYNLIDNAIRYGDTLTTISARFD
FT                   LSPAGLSLIIEDNGVGISSEEKEQIFERGIGKNTGLGLFMTREILGITGITITENGEPG
FT                   KGAMFVLSVPRGAYRLADKD"
FT   gene            284989..285843
FT                   /locus_tag="Mboo_0296"
FT   CDS_pept        284989..285843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0296"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Tellurite resistance protein TehB;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   mma:MM2459 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54818"
FT                   /db_xref="GOA:A7I507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A7I507"
FT                   /protein_id="ABS54818.1"
FT                   /translation="MPQKTNLNYWIDYWNRTNPASDLMDEESLVSFWDKRSEDFADKIA
FT                   TAGGRKRSRENIALLEASGFCAEGARVLDIGCGAGSLSLPLARAGAEVTSFDISPGMLA
FT                   QVQRVADREGLSVTTIAGSWWTANIDRLGFREKFDLVISSMTPAIKDAETLERMITCSR
FT                   ASCFYIGSFPGGRDAILSDLLSRIGKIPSPRRPPMGFLFPFMYLYLKGYRPEVTFSRRR
FT                   WNETLDTKKAAAHAIDIISHDQTVTPAMNRAIQRYYKETAVDGKCIFKNEMFLGMMVWK
FT                   VRP"
FT   gene            complement(285902..286231)
FT                   /locus_tag="Mboo_0297"
FT   CDS_pept        complement(285902..286231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0297"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mhu:Mhun_2505 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54819"
FT                   /db_xref="GOA:A7I508"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A7I508"
FT                   /protein_id="ABS54819.1"
FT                   /translation="MKLVIALIRPERFGAVKKALEDKGYIGMTTAEAKGRGAQKGIALV
FT                   YRGGRLTIDILVKVRIEIVSHDRDVEDLVSTIRESAWTGANGDGRIFVLPVEQAIRIRT
FT                   GEMEG"
FT   gene            286490..287641
FT                   /locus_tag="Mboo_0298"
FT   CDS_pept        286490..287641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0298"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG: mhu:Mhun_0255
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54820"
FT                   /db_xref="GOA:A7I509"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A7I509"
FT                   /protein_id="ABS54820.1"
FT                   /translation="MEPPLIYLNNAATSWPKPPGVIAAVNDALALPFGEAGRSAAGLSS
FT                   DCVADAREAVARYFHAPETDHVIFSANATDALNTLISGFAINEAGPFHAIISDLEHNSV
FT                   IRPLRTLEAGGRCSVTVVPSTGARVDPDAVAAALRPDTRLAVLSHGSNVLGSVQDISAI
FT                   GKLLQDESVFFIADGAQTAGLAQIDLGRLPLDAFVFTGHKYLFGFPGTGGFYIRDPEKS
FT                   ASTRQGGTGTDSRYPLQPQGMPEKFEAGTHNYPGLVSLAAGIAFLEETGADAIARSITR
FT                   QAGIFLREFSGTDTIQVYNTNPDLPVISFNLRDLENEDTGFVLRRMYGIVTRTGLHCAP
FT                   LIHDRIDGGHGCVRISPSILTPDETCRSAAAAIREVADSVHSA"
FT   gene            287625..287930
FT                   /locus_tag="Mboo_0299"
FT   CDS_pept        287625..287930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54821"
FT                   /db_xref="UniProtKB/TrEMBL:A7I510"
FT                   /protein_id="ABS54821.1"
FT                   /translation="MSIVREKNFKNCADGRVKKEYLLSDPFTKETACSFSSFGSANVME
FT                   FLKKPFFTLVRPPSMNMRAVLGENTLEVWYEPADLPFSEPVIYRLLEGDPVVQDPS"
FT   gene            288123..288272
FT                   /locus_tag="Mboo_0300"
FT   CDS_pept        288123..288272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54822"
FT                   /db_xref="UniProtKB/TrEMBL:A7I511"
FT                   /protein_id="ABS54822.1"
FT                   /translation="MAFPDGVRKYYAPVSWDTYASIAHALNPARLVRQSIECKVLLITV
FT                   TGYQ"
FT   gene            complement(288728..289141)
FT                   /locus_tag="Mboo_0301"
FT   CDS_pept        complement(288728..289141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54823"
FT                   /db_xref="UniProtKB/TrEMBL:A7I512"
FT                   /protein_id="ABS54823.1"
FT                   /translation="MTTNRQEDHNALTIIAGVIKGAGPLIHSFGDAMDKGDYTRAHEVA
FT                   TTLCTYIDKVLPEIQNATGISGTAKPALLELESGLAELRTGATDTIAWIDEYSVLKKKV
FT                   KPIAEKVCSATDHINKSVVLARDAVAGRIAKDS"
FT   gene            289530..290339
FT                   /locus_tag="Mboo_0302"
FT   CDS_pept        289530..290339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0302"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   tko:TK0979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54824"
FT                   /db_xref="GOA:A7I513"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A7I513"
FT                   /protein_id="ABS54824.1"
FT                   /translation="MIVSLAAFLISCGIGVIAAVIGLGGGFLYVPTLTLIFGFDPRIAV
FT                   GTSLAVMVFSSFAATVVYRRQGRVLYKAAAVIAIPSIAFSMLASVISSYIDTRLIIALF
FT                   ALALLAMSFEMLIPALHLIRKIGIGPLMALSCRDLDGTEKIIQIPYAHLVVWGAFGGFV
FT                   SGVTGTSGGAYFVPALVALGVPVHWAVATSLLAVIPTVVTGASVHAFLGHVSVPFLVLY
FT                   GAGAGMGACLGAYIAPRIHPDHIRKFFGVMLIFIAVLMIQQKVLTGI"
FT   sig_peptide     289530..289586
FT                   /locus_tag="Mboo_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.492 at
FT                   residue 19"
FT   gene            290395..290859
FT                   /locus_tag="Mboo_0303"
FT   CDS_pept        290395..290859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54825"
FT                   /db_xref="UniProtKB/TrEMBL:A7I514"
FT                   /protein_id="ABS54825.1"
FT                   /translation="MRLIVSFFVLGALAAAILAGGCISSVTTTTPTATPTPYEVLTPPG
FT                   NTLLGNWTGTMVSYDEGTGYADNGNRTMSMAVTGEKDRLFSGTMVIQANGTLYTVPIAG
FT                   IMAKDRQSFVLVEKNFGYVTGTFVNGNEIELDWHNDGPEIGVAIDTLQRV"
FT   sig_peptide     290395..290481
FT                   /locus_tag="Mboo_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.292 at
FT                   residue 29"
FT   gene            complement(290930..291394)
FT                   /locus_tag="Mboo_0304"
FT   CDS_pept        complement(290930..291394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0304"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; KEGG: mhu:Mhun_1116
FT                   ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54826"
FT                   /db_xref="GOA:A7I515"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A7I515"
FT                   /protein_id="ABS54826.1"
FT                   /translation="MPSPLSELETRLGFTIKDRTILDAALTRQAYINENPTAGNDCMDP
FT                   LATVGDAVLGAVVATRLYESGIRDKGTLTSEKIRGVNRDKTRAFAEKFQLHKFIRWGKG
FT                   EEKNKVWEQGSQAFDAAFEALIGAVFLDTRRQGKDGLAAVQVLLEGLKFF"
FT   gene            291754..292248
FT                   /locus_tag="Mboo_0305"
FT   CDS_pept        291754..292248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0305"
FT                   /product="phosphohistidine phosphatase, SixA"
FT                   /note="TIGRFAM: phosphohistidine phosphatase SixA; PFAM:
FT                   Phosphoglycerate mutase; KEGG: gme:Gmet_0878
FT                   phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54827"
FT                   /db_xref="GOA:A7I516"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A7I516"
FT                   /protein_id="ABS54827.1"
FT                   /translation="MDLYLLRHGKAGQSPGGFDDNTRPLTAEGKKEIRNAGRFLKKRKI
FT                   RFDGIATSPLLRARETAEIVAKVTGAKEDPAIWDELAPNGDPDTLCYQASQYGDDAVLL
FT                   LVGHEPSLAGLISRVIAREGSASVALGKGGLAKIRHFSFEHSPSGELQWLLTSGLLSEM
FT                   E"
FT   gene            292307..293335
FT                   /locus_tag="Mboo_0306"
FT   CDS_pept        292307..293335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0306"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase;
FT                   isochorismatase hydrolase; KEGG: gme:Gmet_2952
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54828"
FT                   /db_xref="GOA:A7I517"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A7I517"
FT                   /protein_id="ABS54828.1"
FT                   /translation="MIVLRLLADADIPVIKSWPHYPPEFAGLDYSLRDGGWLDTHRNEP
FT                   GTVVFAATENGKLVGFSLLVQGLEGVSEFMVALHPERIGGGLGRTIVRLTLARGFSCPG
FT                   TARIRLIVRKNNFRAKALYTSLHFVRTGELVKEIQGDPVAFFEMEITREDFTKGEGIMK
FT                   QVLLVIDVQNEYFSGALPVTYPEGSLGNILKAMDHAHSARMPVVVIRHTNPAPGAPAFG
FT                   QGSPGADLHPEIKKRQADLVIEKHYPGSFTGTELSAWLKENRITTVTIAGYMTQMCCDT
FT                   TARQAFHEGYAVNFLSDATGTLSITNTAGSVSAADLHRAILVTQQMVFSRVLSTAEWIA
FT                   ET"
FT   gene            293440..293598
FT                   /locus_tag="Mboo_0307"
FT   CDS_pept        293440..293598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0307"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   cte:CT1101 rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54829"
FT                   /db_xref="GOA:A7I518"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A7I518"
FT                   /protein_id="ABS54829.1"
FT                   /translation="MQSYVCQACGHKYVPKKGDAAGNIPAGTSFEALPTDWTCPACFAG
FT                   RDEFWPV"
FT   gene            293729..294637
FT                   /locus_tag="Mboo_0308"
FT   CDS_pept        293729..294637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF1487 A. fulgidus predicted coding region
FT                   AF1487"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54830"
FT                   /db_xref="GOA:A7I519"
FT                   /db_xref="UniProtKB/TrEMBL:A7I519"
FT                   /protein_id="ABS54830.1"
FT                   /translation="MKKTGILLVLAFILLFFVVAAGCMNLAMTEKYTVSQDAQITHAEY
FT                   DLNMDRSTYNLLKLGAEHEGYDSVQALLERNLTKTLGPGNVSYTETWDNQNNKVTLSFS
FT                   STDTYSPPSDSKISIRKDGDNLVYQDDTFYSPQALQSLGAGESAASLTTPVPTPAPTSA
FT                   LVYNATTHGYDLITITPTPVPTKWIWNSSLQKYEQVEITPTPAVPLFNASEEREMMGAM
FT                   LSGVSVDYYLEMPGKIVNTSATVVNNNKAEWHFGGADLMNTSIYAESQPPSLLPGFTSF
FT                   VAVAGCALVVLFLGRRKNKSR"
FT   sig_peptide     293729..293791
FT                   /locus_tag="Mboo_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.413 at
FT                   residue 21"
FT   gene            295628..297601
FT                   /locus_tag="Mboo_0309"
FT   CDS_pept        295628..297601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0309"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1943 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54831"
FT                   /db_xref="GOA:A7I520"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I520"
FT                   /protein_id="ABS54831.1"
FT                   /translation="MVLMIPILYVDDEPSLLELGKLYLERTNEFTVTTAPSASVALDRL
FT                   KSNSIKAIVSDYQMPDIDGIEFLKRVREKDKTIPFILFTGKGREEIAVKAFENGADSYI
FT                   QKGGDSKSQFAELVQKLKVVVDHRRAEVQVTTLHRLYTTLSATNKAIIHIHDKKELLSE
FT                   ICRIAVDTGGFSLAWAGIANTQTHSIEPVAIAGSDKGFLGTITISTDDTPTGRGPTGTA
FT                   FRKKSFNVCNDIERDSKKANPWRKGALEWGYRSLAAFPFATGSRNAGVITFYASEPGFF
FT                   NDQIIRLLEEQSGDISFALQTLDHEEQRRAAENHLKKSELQYRRLFETAQDAILILDGD
FT                   TGEVIDANTFILDMLGYPLEYFLGKHLWELGFLKNKSLAQDAFVRLKTQKYIRYEDLPL
FT                   ETQQGTPMHVEFISNVYAVGEKNIIQCNIRDITERKRAEDALALASKKLNLLSSITRHD
FT                   INNQLQALSEYLELSKEVLADPAALSRYIANEERIAATIGHQIAFTREYEDLGVRAPVW
FT                   QQLPEIIRLAGSQVPDNTIAFEFSTDHLEIYADPLLIKVFYNLFDNARQHGGGVTRITI
FT                   SPHISGAGLIITVEDNGKGIPGEDKPHVFERGFGKNTGLGLFLAREILSITGISISETG
FT                   VPGTGARFEIAVPNEAFRFMDP"
FT   gene            297944..299317
FT                   /locus_tag="Mboo_0310"
FT   CDS_pept        297944..299317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54832"
FT                   /db_xref="GOA:A7I521"
FT                   /db_xref="UniProtKB/TrEMBL:A7I521"
FT                   /protein_id="ABS54832.1"
FT                   /translation="MKPRFEKRLAVGMIIAALACLILLPVPIDGLKVIGSIYTGNVSPG
FT                   QTVIFPMTISLGANDPPMDMVVDVMGFGQSPDKSYVALDPSSDTSPYSARSYISIDNRT
FT                   FHLDPGASETVDATISVPGDAGPGGRYAIISIHGLPNGTGSTLVVTAINVPVMMTIDSP
FT                   GITQTGTITGLTTGTIVAGQPLALITSFKNTGNHHYANTINNVQVTDGSGKQVALLSTD
FT                   PTLYSIIPGNTVNFVVNLNAALSPGTYTMLSNVSLKDGTLLDSKTASFEVNSSYTAPVQ
FT                   ETSVALTPKNPAVLASSDGRIAVSFPAGAVISDVTVTLKPFSLDQLPGLPAGTTAGGTC
FT                   FEIDGLSGLLSKDAMISVNYSSSDLDAAGGDASKLVLARYDQSGSSWTLLPTTVNKDTT
FT                   TLSATTNQFSTWAVIASSTPGTQTGGQSKGILAPDVTTVFLSLCLTVVIFGAWKRRER"
FT   gene            complement(299473..300705)
FT                   /locus_tag="Mboo_0311"
FT   CDS_pept        complement(299473..300705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1881 Ig-like, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54833"
FT                   /db_xref="InterPro:IPR021884"
FT                   /db_xref="UniProtKB/TrEMBL:A7I522"
FT                   /protein_id="ABS54833.1"
FT                   /translation="MHGTKKNTGKRFSIVFTLALIGLVTAAIIPGVEGVSTVNLGAAGN
FT                   YTILAKSAISTTGTTSVGGDMGISPAVATYITGFGLTLDSSGQFSTSSLVTGKVYAADY
FT                   TAPTPADLTLAVSNMESAYTDASTRSPPDYTDIGSGGEIGGLTLAPGLYKFTGAVTISN
FT                   DLVLNGSASDVWIFQIPGALGISSGKHVILSGGAQAKNIFWVVGGATTLGTTSVFNGNI
FT                   LDFTAVTLNNGATLNGRALAQTAVTLDGDTLSVPTATPTPTPTPTPTPTPTVTETSSIE
FT                   ISITGTELPWALSPGTTYTENNVLQVVVNSTADWAVDASDADTTNTNGFMTDWSGSAYV
FT                   PGTKLAHALQVNANAGPYVTLPSGGSILTGTAGASQTYPLGFRQEVTYANPVLPSPHVY
FT                   RIVVTLTGTTL"
FT   sig_peptide     complement(300625..300705)
FT                   /locus_tag="Mboo_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.950 at
FT                   residue 27"
FT   gene            complement(301005..301520)
FT                   /locus_tag="Mboo_0312"
FT   CDS_pept        complement(301005..301520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54834"
FT                   /db_xref="UniProtKB/TrEMBL:A7I523"
FT                   /protein_id="ABS54834.1"
FT                   /translation="MKKILLLFLILVCIFAFPQGAIAASSTTSAILTADQMSAIEITVT
FT                   GTESPWALSPGTTFTENNTLQVVVNSTANWGVGASDADTTNTNGFMTDWSGSAYVPGTK
FT                   LAHALQVNANGGSYVTLPAGGSLLTGTAGTSQVSYPLGFQQQVTYTDPLLPNPNVYRIV
FT                   VTLTGTTI"
FT   sig_peptide     complement(301449..301520)
FT                   /locus_tag="Mboo_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            301688..302893
FT                   /locus_tag="Mboo_0313"
FT   CDS_pept        301688..302893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0313"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; KEGG:
FT                   mac:MA4589 cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54835"
FT                   /db_xref="GOA:A7I524"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A7I524"
FT                   /protein_id="ABS54835.1"
FT                   /translation="MDPAACWGHWSYVMHPDTILTRRCGKIIRGIFIVVLITSLLFFSP
FT                   AVAGDPKLTIVLTARIVPVSSAWFATNVTEGPALLPVAFTDQSTDMPVSWKWDFGDGAV
FT                   DTVRNPVHIFETPGIYTVLLTVGTMSGNSSRAAQIIDVGAPPDALGSNTLRTSAIGPGT
FT                   TTTLDFSAQAGTSIDITTNNSVQAGTPVTVTEYSSPPFPEMSLPAFTAAGRYIAISAQG
FT                   LEANVSSVTITMQEPAPLPAGVTEANLVIEFFDPATDTWTVLPCTLDTTSHTISTTSTH
FT                   LSAYGLFASPVTAAPGSGSSSGASEGGFLSGGSSSGGSGSVGLLQFFQLAPVRAPLTPA
FT                   GIHVNTPAVVPVSAQKAPVQTPAAGTSAQTSPGLPLMGIAVVVAVLAITGVALLAFARR
FT                   NT"
FT   gene            303205..303522
FT                   /locus_tag="Mboo_0314"
FT   CDS_pept        303205..303522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54836"
FT                   /db_xref="UniProtKB/TrEMBL:A7I525"
FT                   /protein_id="ABS54836.1"
FT                   /translation="MPTPHEIGKAGEGCAVELFKGKGFTIDKWDTHTLGTANIEAHSRE
FT                   GKILVQVKSAIFDEPSYLSAKEQRNVKALATRIGAVAWEAKVILNTNLDLVGDIRLRQL
FT                   D"
FT   gene            303865..305508
FT                   /locus_tag="Mboo_0315"
FT   CDS_pept        303865..305508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0315"
FT                   /product="thermosome"
FT                   /note="TIGRFAM: thermosome; PFAM: chaperonin Cpn60/TCP-1;
FT                   KEGG: mhu:Mhun_2549 thermosome"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54837"
FT                   /db_xref="GOA:A7I526"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A7I526"
FT                   /protein_id="ABS54837.1"
FT                   /translation="MSQQLGGQPIIILREGTTRNRGEEAQASNIAAAKAVATAVRSTLG
FT                   PKGMDKMLIDGMGDIVITNDGATILKEMDIEHPAAKMMIEIAKTQDDEVGDGTTSAVVI
FT                   AGELLKQAEGLLQSHVHPTVIAEGYRQAAVKSQEILAGIAIAVQPADTAMLEKVAETAI
FT                   SGKGAEAYKKLLCAMVVKAVSSIADPDGTVDIKHINVQKKVGGAVEDTVLIEGMVLDKE
FT                   RANPGMPKKVKDAKILLLNAAVEFKKTEVSAEINISRPEQLQAFLDEEAQMVHALAEKI
FT                   IASGATVLFCQKGIDDLAQHYLTKAGILAVRRVKKSDMENLARATGAALVNSIDAISPS
FT                   DLGTAGLVEEKKFSGEEMIMVAQCKNPKAVSIIIRGGSDHVIDEIERALHDALMVVSVV
FT                   VKDKKIVAGGGAPETELALQLRHYASTIGGRIQLAIEAFASAMDVIPRALAENAGLDPI
FT                   NLLVAIRAEHESGHRTFGLDVYAGKPVDMLKAGVVEPLRVKTQAITSATEAAVMILRID
FT                   DVISSSKSSAPHGGMPPGGMGQMPPGMGDY"
FT   gene            complement(305980..306561)
FT                   /locus_tag="Mboo_0316"
FT   CDS_pept        complement(305980..306561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0316"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: gme:Gmet_3517
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54838"
FT                   /db_xref="GOA:A7I527"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A7I527"
FT                   /protein_id="ABS54838.1"
FT                   /translation="MLEEIFTGNKKFQETFFKDNIAQYRELAGGEKPKVLWIGCSDARI
FT                   QTGHITNAPPGTLYIHRNMGNIAPNHDWNFAAVLEYAIIHLKVEDVVICGHSECDAIRA
FT                   LDEDLKDAYIPLWLNEAREAKNRVDSWIAPPRTQDEMKERWKQIEMENIRVQVEHLTAY
FT                   PFVKKAADEGKIKIYGIYYDLSTGVLSRIV"
FT   gene            complement(306673..307116)
FT                   /locus_tag="Mboo_0317"
FT   CDS_pept        complement(306673..307116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54839"
FT                   /db_xref="UniProtKB/TrEMBL:A7I528"
FT                   /protein_id="ABS54839.1"
FT                   /translation="MSQIKSRGPVIPSRTAVAEQSRRIRGKPAGKGDHPLPEFIDKESL
FT                   DTLSRFGEKFRLAGIEGEPWEFHELTVFNAFLEAHVRPNSTQSVQCMLLWSKWVRVFQR
FT                   QTSGFPKLIREKEFSAIIRDTFGVAIANNDAQGKIFPGIKFVP"
FT   gene            307435..308298
FT                   /locus_tag="Mboo_0318"
FT   CDS_pept        307435..308298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54840"
FT                   /db_xref="InterPro:IPR009181"
FT                   /db_xref="UniProtKB/TrEMBL:A7I529"
FT                   /protein_id="ABS54840.1"
FT                   /translation="MDNPPVDEHIFETVGKCRIKVHNGQVVEIGEPRIRGCPLAKRFEI
FT                   PVDEISKEGIKKTIERRIRSFGMCTARRKVISDKEFFGFAPAELLACGLRSGMIDAAVI
FT                   PCDGAGTVIITNPSMVLGIGGLLSGLIFTTPIPEVMDSIEENGGVVFDRATARLDPVGG
FT                   ALLAHRRGFSRIAVPVSDPKIAETIRAFYPAALIFGVHLSGITGEGARRIVAVSDLVTG
FT                   CASKTIRAIGRKKALLQVGAVIPIFALTHRGIELIMKRVLEADEKFFLDPTRFAVSCKK
FT                   QPEPLL"
FT   gene            308556..309374
FT                   /locus_tag="Mboo_0319"
FT   CDS_pept        308556..309374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54841"
FT                   /db_xref="UniProtKB/TrEMBL:A7I530"
FT                   /protein_id="ABS54841.1"
FT                   /translation="MADNEIFVESVEVLLLSEIGMSSATMIKDAYPPVSGDPYLEEGDA
FT                   GPNARVFVTKTSNRTPDEEIGSLLGEDPDDPPATTATHDFYTMILTMSMRLGDPPTTRF
FT                   INGTIDVAFPYEIKILDYSPKDKSSITALMEKCGGTISISPGLFFLVPESRNTKTPVAR
FT                   KENRFRIPVGSGEKITGTYDKKTGYSLDIPGFFLLEYQGMLKNTHDVSWEIYPPMPPRD
FT                   SVLTGEKMLAVFSLIVQTPKNVPPELKVGIECRVKGNLWGMIPIRGSTDF"
FT   gene            complement(309498..311108)
FT                   /locus_tag="Mboo_0320"
FT   CDS_pept        complement(309498..311108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0320"
FT                   /product="chaperonin Cpn60/TCP-1"
FT                   /note="PFAM: chaperonin Cpn60/TCP-1; KEGG: mhu:Mhun_0972
FT                   chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54842"
FT                   /db_xref="GOA:A7I531"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A7I531"
FT                   /protein_id="ABS54842.1"
FT                   /translation="MSQQLGGQPIIILRQGTTRNRGEEAQHSNIMAAKAIANAVRTTLG
FT                   PRGMDKMLVSSTGDIVITNDGATILSEISVQHPGAKMVVEVAMTQDDEVGDGTTTAVVI
FT                   AGALMDQAEKLLAMGLHPTVISEGYRMGMEKALNITESLSFKVDPADKKTLKKIAGTAI
FT                   TGKSIELIREKLGGIIVEAVVAITEKTGGKYSANEDDVLIKKQKGRSMDDSELVRGVIL
FT                   DKKRVSEDMPKKIAGAKVALIAMPMEIAKTQVKAKIKITSAEQMAAFSQQERDTLKKLA
FT                   DAIINAGANVVLCQKGIADPVQFFLAKHGIFAIEDVPEKDLKYAARALSGNIVNKPEDL
FT                   TAKDLGHAEVVEEDNDMEITRISGCKNPKTVSILLRGTSDYLLDELERAVVDGTRVVMD
FT                   AIEDGTYVAGGGAVETELFMKLRDYAGTVGGRVQIAIEGYATAFETIPRTLAENSGFNT
FT                   IDKLVALKNAHAKGKKTAGLNVYTGEIIDMLDEGVLEPLRSKRQSIKSASETSIMLVRI
FT                   DDMMITQSKNSAGSMPGMG"
FT   gene            complement(311390..311878)
FT                   /locus_tag="Mboo_0321"
FT   CDS_pept        complement(311390..311878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0321"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mba:Mbar_A2941
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54843"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A7I532"
FT                   /protein_id="ABS54843.1"
FT                   /translation="MRNSMENPKVHYYNEGLDFANLGLYSDAVTSFDKAIFARPDCAEA
FT                   WRKRGSALISLDRYSDALASFDKAIAINPEYANTWNNRGVALGHLGRHSEAVVSFDKAI
FT                   ALSPGYANAWNNRGNAYARLGQRDYAVASFNRALDIDPGYTVAKQNRATALKGKPGPA"
FT   gene            complement(311894..312370)
FT                   /locus_tag="Mboo_0322"
FT   CDS_pept        complement(311894..312370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54844"
FT                   /db_xref="UniProtKB/TrEMBL:A7I533"
FT                   /protein_id="ABS54844.1"
FT                   /translation="MENSLRDAGEERVAALEKKVSGVGVLVGEFTQELLDLKAITREMS
FT                   QKNKEHRLQEPGPMQEAGAREPEAAGIPQSHEGSRTGAGEIPVPPAPDEPLMVMIMQTD
FT                   GTMKPEVRRGNRDCTFAPVGYGASGGSGRYTKSMPTRPGQSRITGTFEKKPSGQ"
FT   gene            complement(312605..313159)
FT                   /locus_tag="Mboo_0323"
FT   CDS_pept        complement(312605..313159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0323"
FT                   /product="TATA-box binding"
FT                   /note="PFAM: TATA-box binding; KEGG: mhu:Mhun_0593 TatA-box
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54845"
FT                   /db_xref="GOA:A7I534"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="UniProtKB/TrEMBL:A7I534"
FT                   /protein_id="ABS54845.1"
FT                   /translation="MAGQKYESLKIENIVASGAIADSIDIVAFSEKTTNCELNKKRFPG
FT                   AVYRIEDPKIASLLFSSGKIVLTGIRNSEGLKKGLAVIVKSLNDAGVETLKEPRVAITN
FT                   MVCSYDLARYINLNKVVVTLNLENIEYEPEQFPGLVYRINDPRIVVLIFSSGKLILTGG
FT                   KNMEDIKKGLDVLTKKLESIM"
FT   gene            313468..313659
FT                   /locus_tag="Mboo_0324"
FT   CDS_pept        313468..313659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0324"
FT                   /product="30S ribosomal protein S17e"
FT                   /note="KEGG: mhu:Mhun_1491 30S ribosomal protein S17e"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54846"
FT                   /db_xref="GOA:A7I535"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/TrEMBL:A7I535"
FT                   /protein_id="ABS54846.1"
FT                   /translation="MGIKPSYIKNLGTSLLAKQREYFTKNFDENKKQLEVSASIPSKRV
FT                   RNRVAGYITRRMNAKKRT"
FT   gene            313773..314081
FT                   /locus_tag="Mboo_0325"
FT   CDS_pept        313773..314081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54847"
FT                   /db_xref="UniProtKB/TrEMBL:A7I536"
FT                   /protein_id="ABS54847.1"
FT                   /translation="MVRTMLKKDERVLIVPASGDNEGVRLVPVKKGDRVVPVPTRDGRW
FT                   ITVKLSPLNRGDKIAVVTLRNGRKVALKLEEFSDADLERRVELAGDLTIEYREGGVP"
FT   gene            complement(314125..314433)
FT                   /locus_tag="Mboo_0326"
FT   CDS_pept        complement(314125..314433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54848"
FT                   /db_xref="UniProtKB/TrEMBL:A7I537"
FT                   /protein_id="ABS54848.1"
FT                   /translation="MRVRCPFSAGNICGPGCRFLFFPCRQGHTCIRKSFFVFCGLKIHP
FT                   GRDPVLGFLPDLSFFLDQVTYTRKGPGVPAGIGHARAMDPVTARKQFCADNHTGIRG"
FT   gene            314795..317821
FT                   /locus_tag="Mboo_0327"
FT   CDS_pept        314795..317821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0327"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: mag:amb3654 hypothetical 1041 kDa protein in
FT                   HypE 3'region; TIGRFAM: PAS sensor protein; PFAM: CheB
FT                   methylesterase; MCP methyltransferase, CheR-type; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54849"
FT                   /db_xref="GOA:A7I538"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7I538"
FT                   /protein_id="ABS54849.1"
FT                   /translation="MMTKPKPKSGPVKKNVPERKSSPDNGAVPEKGEALFPIVGIGASA
FT                   GGLEAFELFFKTMPADSGMAFVLIPHLDPGHASMLSEILQRNTTMPVHEAEDQTSIRPD
FT                   HVYIIPPNKDMAIFHGVLQLSTPEQVRGMRLPIDSFFRSLAEDQGERAICVILSGSGSD
FT                   GTLGLRAVHGAGGVSFVQDPSTAKYDGMPTSASQSGLATYILPVEKITGQLVSYVKNLA
FT                   QTGVHPVPMASKAVNATRRILMLMRSKTGNDFSQYKQSTIQRRIERRMVVHNLSDMDTY
FT                   ARYLQENPAEVAILFKELLINVTSFFRDKEAFEALETEALPLLFEEKPENYIFRIWVPG
FT                   CASGEEAYSLAMLFKEKIDEFRQDFRVQIYATDIDDDAIATARAGMYPSNISLDVSPER
FT                   LRRFFTKEETGFRIKKEIREMVVFAVQNVIKDPPFTKMNLISCRNLLIYFESELQARVI
FT                   PAFHYALSTGGILFLSPSEGIGNFTDLFSPVNKKWKIYRAKPSGLSARALVAQRFAWTT
FT                   EPSKKEPGEVFLPSDKTNFAELTRRVLLASFAPPSVITDENGSIIYVHGDTGKYLQPAP
FT                   GQISTSVIDMAREGLQLDVRSAIQKASAKKTTVVVKGLRVRTNDGIRGVDLTVRPLTDL
FT                   EPARELLLISFEETKQPPAKKRRSGKSSGTGEQGSQRIEQLEQDLAYTKENLQATIEEM
FT                   QAANEELKSSNEELQSTNEELQSTNEELETSKEELQSVNEEIVTVNAELQAKIEQLTAV
FT                   QNDMKNLLENVNIGTIFLDTSLAIRRFTREAKRVFRLAAADTGRPLADIRSNIPDTDLI
FT                   ADAQGVLDSLIPREKPVRTAGGEWFLVRIMPYRTLENVIDGVVMTFSDISALKAVEAEA
FT                   RAACDYAQNIVDTIREPLVVLDSAFEVVSASGAFYRTFGVTPEKTLGKSLFALGNRQWD
FT                   IPELHELLETVLPKSTTFENFEVRHDFPGIGQRVMVLNGRKVIDDTGSIHHILLVMEDI
FT                   TPQRRGADKKPVRGSRGRA"
FT   gene            317821..318918
FT                   /locus_tag="Mboo_0328"
FT   CDS_pept        317821..318918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0328"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: histidine kinase
FT                   A domain protein domain protein; KEGG: mhu:Mhun_1048
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54850"
FT                   /db_xref="GOA:A7I539"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I539"
FT                   /protein_id="ABS54850.1"
FT                   /translation="MAFGKKDKNENEPDTNNVDPSLRTHAEEQLARTKTNAPDFAGHTP
FT                   EELIHELQVHQIELETQAEELRQAYRALEESRDKYLDLYEFAPLGYLTLSDKGIICEVN
FT                   LTGAALLGFVRKDLIRARFSTFVTESDGDTWYRYFKKVQDLEGKQVCALSLMRGDGSVF
FT                   PARLECIRIPGTRDGPPTVRVAVNDITDLRRAGDALRISNKKLNLLSGITRHDINNQLF
FT                   TINAYLEIIRKNISDPSVQKDFARITAASDRMAKIILFTKEYEQVGAKDPAWQNCHFLV
FT                   DRAARQADPGNVLVKNDLPAGLEIFADPLVAKVFYNLIDNAARHGGKITTIRFFFQEAG
FT                   ELCIIVCEDDGDGVAADEKELIFER"
FT   gene            318919..319068
FT                   /pseudo
FT                   /locus_tag="Mboo_0329"
FT   gene            complement(319110..319337)
FT                   /locus_tag="Mboo_0330"
FT   CDS_pept        complement(319110..319337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0330"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54851"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A7I540"
FT                   /protein_id="ABS54851.1"
FT                   /translation="MTRRTLDIRGKVCPHCLIAVKKETDTMKPGDDLVVTCDHPPAATK
FT                   NIPLYAKENGMSVETKTTAPGTWELHITKK"
FT   gene            complement(319460..321286)
FT                   /locus_tag="Mboo_0331"
FT   CDS_pept        complement(319460..321286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0331"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1962 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54852"
FT                   /db_xref="GOA:A7I541"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I541"
FT                   /protein_id="ABS54852.1"
FT                   /translation="MSEPIRVLLVDDESALLEVSALFLESSGDITVKTVLGAPEAMQLL
FT                   ERERFDVIVSDYQMPVMDGIEFLTEVRRHFGQIPFILFTGRGREEIVILAIDRGADSYV
FT                   QKGGETKSQFAELAHKIRMAVKRRVAESQTAESKEFLKNVIADAKEGIIVYDRDLRIML
FT                   WNRFMEDLTGLPAAEVLGKNTLELFPFHTENGNDILMKQALTGITTETQDFAFVIPSTG
FT                   KRGWVKSVFSPNYDLSGAIKGVIGIVRDVTERKQAEVALQESEERYRKIFENSPLGMIL
FT                   LTPDLRFFRVNPALAAMTGYSEEELPGMSFADITHPDHLTSDRQSLEDLTAGKIPAYTT
FT                   EKRYIRKDGSVMWGSVRVTSILDDHAALKYYAAQIEDITERRLTAEALRTTNKKLNLLS
FT                   GITRHDIANQLLVMSAYVSLLNDQQPDPAAGEYLGKMDRSLTRMNDMIGFSREYEKVGV
FT                   AAPVWQNCHSLVDIAAKQILMGDTIVKNDLPPHCEVFADPLIFRVFCNLIDNAMRHGKT
FT                   ITTLRFSVADRAGSRVIVCEDDGVGVPAEEKEVIFEQGFGKNTGMGLFLSREILDITGI
FT                   TIKETGEPGRGARFEIILPPGAFRAATIPHAV"
FT   gene            complement(322056..322499)
FT                   /locus_tag="Mboo_0332"
FT   CDS_pept        complement(322056..322499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0332"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mhu:Mhun_1792 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54853"
FT                   /db_xref="GOA:A7I542"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7I542"
FT                   /protein_id="ABS54853.1"
FT                   /translation="MIHLLYGDDDQDICTIIATFCERIGAFSVKSLNSGEAALDWLRTA
FT                   SPDVIVSDYSMPGGMNGMRFLEELRSRGNTTPFIFFSATEDLEVKKEAYREGAFSFICK
FT                   TPSGKIPIYQLIRAVGWAVARTSPEPGKRQNPGKKVVHETPDP"
FT   gene            complement(322531..323964)
FT                   /locus_tag="Mboo_0333"
FT   CDS_pept        complement(322531..323964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0333"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: mhu:Mhun_0770 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54854"
FT                   /db_xref="GOA:A7I543"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7I543"
FT                   /protein_id="ABS54854.1"
FT                   /translation="MIQRGTLQTVDTDMVHPNGQDLHLIKSILKQSPEGMSVSEIARAL
FT                   RKNKNTTGRYLDILLISGQVDMRTYGMAKVYTLSQRVPLSAMLSYSKDLIVVLDRESRI
FT                   VQINDNFLTLLRLTRKEIIGKDFASITSTDIDLHNLLTPPPSTRSEETERIVSTRLGTK
FT                   ERIFKQKSIPTVFDDGARGITVILSDTTEEILQEREIQIREERFRMMAENIQDALFIVE
FT                   NEKCTFANRRLAEITGYTFEELWDMDPMKIIVPEDRKKIEPLVDIREKSVLGPVEFQCR
FT                   IQRKDGVNRQMYIRISSLNRGEAQYHFVILTDVTDLLSKDMALARSEQRFRMMAENVQD
FT                   ALLIIESGRITYANRRACEISGYSAEEMYSLHSREIIPLEARRVMGETYKKSLAPGEPA
FT                   IKFQSWILCKNGEKRCIYGQMNSVRHSDAISTYITLTDVTAFAEHEQDLMDRIAGLEQG
FT                   GGCISPPHPDAAPGFPGQK"
FT   gene            324078..324764
FT                   /locus_tag="Mboo_0334"
FT   CDS_pept        324078..324764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0334"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54855"
FT                   /db_xref="GOA:A7I544"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:A7I544"
FT                   /protein_id="ABS54855.1"
FT                   /translation="MNPVFGSLLDQWNSTVITYVPGIVGALVVLLIGWIVGRLLGRAVR
FT                   IVLDKISEQHIVEEGADVVSIRGSFKNAGVTVGYIGDVAVRIVVYLVAILAAVNILNLD
FT                   YLSQLMMMIVEYIPHIVAFVIIFVVGFLLIDAFIDFLNRYYAQKNVQFITPVLVLVRVF
FT                   LYFVTAVLALSQLQLDLTIIYTFVTPIAWGIGIGLGAAIAIIVGFGLKNRSEAIMDQVL
FT                   SSIVKK"
FT   gene            325056..325736
FT                   /locus_tag="Mboo_0335"
FT   CDS_pept        325056..325736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0335"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: mhu:Mhun_2495 PEGA"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54856"
FT                   /db_xref="GOA:A7I545"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A7I545"
FT                   /protein_id="ABS54856.1"
FT                   /translation="MKKICVPLIVFQLVLLMVTPVFADGANGTNITTITATPATIVTTI
FT                   PAYPVNTTATPVFANATAVPVATNTTVPTETAAVPTGNTGAPSTGNLSVASSPLGADIL
FT                   IDGVLYGSTPRNVTGISSGNHIIRLTLSGYYDYEGTVYVIPDQVTDVFGTLPPLSASVS
FT                   SPSASLSPAVTSVPATTVPVQTTTTSSGDLLSNPTILAALIGIVTAGIGAFAAIFPHLA
FT                   KSKK"
FT   sig_peptide     325056..325127
FT                   /locus_tag="Mboo_0335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            326086..326733
FT                   /locus_tag="Mboo_0336"
FT   CDS_pept        326086..326733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54857"
FT                   /db_xref="UniProtKB/TrEMBL:A7I546"
FT                   /protein_id="ABS54857.1"
FT                   /translation="MKLPTISYRAVALIAIAVSVMGLVMGPASATPATTSLTGGWTGGF
FT                   AGHHAFNTTQATTRLQAVLANLTAQGVDVSPAQADLSAGNVSAAMQWLSAYHKDNPGTR
FT                   ATGSRQHAFNSTRTTGRIQSFVTKLGQTGVDVSQVQADLASGNTNAALQWMAAYHAAHP
FT                   TTNATGQTGNRTAWHGNTTGIPGHQGSWSGARHAGFGNQTTWHRGSGTRRSS"
FT   sig_peptide     326086..326178
FT                   /locus_tag="Mboo_0336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            327067..327447
FT                   /locus_tag="Mboo_0337"
FT   CDS_pept        327067..327447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54858"
FT                   /db_xref="UniProtKB/TrEMBL:A7I547"
FT                   /protein_id="ABS54858.1"
FT                   /translation="MAESKTLLFIYNTNNGVLKSFMDYCAGTASAPVTPACPLNAITTT
FT                   PGGMKEEWKRFLKDLKIPSRLLDRNEFSWEFHDLHTTFPVVLIQSGADIAVLVGTEALN
FT                   QCRDLNDLIHLMQERLSHGMMG"
FT   gene            327706..329667
FT                   /locus_tag="Mboo_0338"
FT   CDS_pept        327706..329667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0338"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: hma:pNG7155 HTR-like protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: response regulator receiver;
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54859"
FT                   /db_xref="GOA:A7I548"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I548"
FT                   /protein_id="ABS54859.1"
FT                   /translation="MYTVLYVDDEPDLLEISKLFLEQSGQFSVDILPSAPEALAAMKVK
FT                   TYDAIVSDYQMPGMDGIDFLKNVRALGDTIPFILFTGRGREEVVIQALNEGADFYLQKG
FT                   GDPTAQFAELTHKVLLAIEHRSNAEKIQSLNRLYLVISAIDRAIVQLRTKSEFLSEVCR
FT                   ILVETGGFRMAWIGIPDPGEGIIRPVASAGQVEGYLEIVRVALDDSTRGCGPTGKAYRE
FT                   GKNCICNDIVSDPCMEPWRKEALKRGYNTCAAFPFGRGSNNPGVLVLYASELGFFNDQI
FT                   ISLTNDLVADIAFALATLDHQKERESAIAALRESEEKYRLVVEDSRDAIYIHQSDRLLF
FT                   VNRQASVLTGYSHEELLTIRLWDLVHPDDREILIRNNRDRLAGNPPPHEFTARLLTKDG
FT                   TSRTCEFVVDMVMYQGSPAIMGIARDITERRKTEEALASANMKLKLLSGITRHDIRNQL
FT                   TILEGRLAFMKKKEPDSPFLEHFEKMSAAARRIASIIQFTKEYEDIGIRAPAWQDCRTL
FT                   VDTAAQQVHSGQVPVKNDLPPGTEVFADPLIVRVFYNLMDNAARYGGKITFIRFSLEGS
FT                   GNDYRIVCEDDGEGIPAEDKEKIFLQGFGKNTGLGLFLSAAILHITGITIRETGEPGKG
FT                   ARFEIIVPKGAYRFSGGE"
FT   gene            complement(329792..332107)
FT                   /locus_tag="Mboo_0339"
FT   CDS_pept        complement(329792..332107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0339"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_2672 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region,
FT                   ATPase domain protein domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54860"
FT                   /db_xref="GOA:A7I549"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I549"
FT                   /protein_id="ABS54860.1"
FT                   /translation="MYRILYVDDEPGLLEIAKLFLERSGEFDVTTMTSVGEAVKSPDVL
FT                   LFDVIVSDYQMPGMDGIAFLKTIREKTKDLPFILFTGKGREEIVVEAINNGADFYIQKG
FT                   GEPKVQFVELAHKIRQAIRRRKAENALAENRDYLNQIFSSVKAGILVIDADTHRILDVN
FT                   PTAAELMHDSRENIIGKECHRYVCPAERGKCPATDLGHPVDNSERVLITSDKKQVPIIK
FT                   YVTSVMLSGKPALLETFIDNSERKQSEEALHLAYGALQKERRELQAAYEQIAAAEEELR
FT                   GQYDELAKSNEHVRESEEKFRTLFEGANAAIFIMDRGKFLECNQRTLEIFGCSRDRLIG
FT                   HSPREFSPEFQPDKRPSAEKAGEMIDAAISGKPQVFEWVHLRCNGTPFFAEVSLNRFSF
FT                   QGHYYLHAIVRDITERKEAEEKVKESDRMIRAVFDSTFQFTGLLSPEGILLDANRTALE
FT                   FVGLSYHEVVGRPFWETPWWQGDEKRVQQLRQAVRDAAGGKFVRYEAGFESVSGAWIVT
FT                   DFSLKPILSAEGSIIRLIAEARDVSGLRKAEGAYREANGKLSILASVTSHDINNQLTAL
FT                   DGFLELAKAEGENPKTTGEYLQKAQKAVERIRYQVGFLREYESLGSHTATWQDVLACAR
FT                   SSARELDFSGISLEVSRVSGLEIYADSLFPKVFFNLFDNALRYRGTKMTRITLSAEKSE
FT                   NALLIVCEDDGDGVAADEKEKIFERGFGKNTGLGLFLVRDILSLNGITIRETGMPGKGA
FT                   RFEILVPPGGWRKQRAGS"
FT   gene            complement(332388..332801)
FT                   /locus_tag="Mboo_0340"
FT   CDS_pept        complement(332388..332801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0340"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: bca:BCE_0533 general stress protein 26"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54861"
FT                   /db_xref="GOA:A7I550"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A7I550"
FT                   /protein_id="ABS54861.1"
FT                   /translation="MPLKEQILEVISGPHPTAVATLDGKHPVVRFMVLAGFPDMTFVGA
FT                   TMKSSKKVGQLKKSHDTALAIWSGKEFSDPYVEIKAKGEIHEDVATKKKYWNPMFEQFF
FT                   KTPENPDFVVLVFTASEITYHGKNMSSVDVWKR"
FT   gene            333233..333472
FT                   /locus_tag="Mboo_0341"
FT   CDS_pept        333233..333472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54862"
FT                   /db_xref="UniProtKB/TrEMBL:A7I551"
FT                   /protein_id="ABS54862.1"
FT                   /translation="MPNTTTHDTKMTDTKLQETASKKSGPGMSAHPSAVAPKVISSPAK
FT                   HVKSSVRPSHKGEYKKDHPKAGAGMTTPPEHVPK"
FT   gene            333809..334114
FT                   /locus_tag="Mboo_0342"
FT   CDS_pept        333809..334114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0342"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: mtp:Mthe_0811 PBS lyase
FT                   heat domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54863"
FT                   /db_xref="GOA:A7I552"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A7I552"
FT                   /protein_id="ABS54863.1"
FT                   /translation="MSSTLEGLIERLSDDNEGMRWNAAEALGRLGDPRAVDPLIDTLWD
FT                   DDARVRQKAAYALGLLGDPRALGPLQKLYRIEREDARDIIQEAMEMIKRVMARDLQ"
FT   gene            complement(334143..335528)
FT                   /locus_tag="Mboo_0343"
FT   CDS_pept        complement(334143..335528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54864"
FT                   /db_xref="GOA:A7I553"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A7I553"
FT                   /protein_id="ABS54864.1"
FT                   /translation="MPGHSPPAADSKESIIVVSDVHLGGNIGSHHDKFCDFLAWITTFP
FT                   QKIPAVPCDEKEDARPATLDIAFDPLTKLVLLGDIIDLWDPKDQDRKNVILESVRPLSL
FT                   LHALPCDKVYVTGNHDADLWEMVKDDASPDKRSFPWKDGYDFSIYPRHYPPSEKTAAKV
FT                   NRGVPVNRTHYTFLHGHQFDGEQVTYVISEILKEPFDPIDTLMDLANMSVSKIFRIPAD
FT                   ILVFCLWVLSLVLVTWTVPYDAVVKNAFVLVLSLAVAVPLLLKFPAAQAVLGERKPKVW
FT                   ERALIGGLFLGPFVALVIYGAAFAAGPGILPAPASFLLPAYAVILTLFALIIVVPRLIG
FT                   CAQRKVYGLFASRDKTVEDVLDDGFVDERDTIRAEVIVFGHTHRAGYAKKTFAPPGNPA
FT                   QERSPEKLFVNTGCWADTGDTRPVDTFVYINRTGLYLLEWKGPGKINCLFHAPHERLHT
FT                   FAP"
FT   gene            complement(335604..336407)
FT                   /locus_tag="Mboo_0344"
FT   CDS_pept        complement(335604..336407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0344"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mma:MM3214 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54865"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I554"
FT                   /protein_id="ABS54865.1"
FT                   /translation="MKTVIYYFTGTGNSLAAAKKIAADLGDCELVPIVSFKDTTEDIVP
FT                   PAVRVGIVCPVYDAGLPVIVWEFAQRLSLAGTRYVFGIVTLGGSGGTAALRQLDQSVKQ
FT                   QNGRGLSAAFSVRMPGNFPPVSRPPQGKKKDGILAGADAQLKEAAGRIKKGEQVPPGFS
FT                   PFAWLMHAATYRFFSGSVHAGDKDFSVSCACTSCGTCAKVCPVGNIRMEQGRPAWQHHC
FT                   EFCCACLHFCPVEAIDLHSMRGTKGRGRYRHPAVTLEDMKVQAGR"
FT   gene            complement(336413..337666)
FT                   /locus_tag="Mboo_0345"
FT   CDS_pept        complement(336413..337666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0345"
FT                   /product="protein of unknown function DUF1700"
FT                   /note="PFAM: protein of unknown function DUF1700; KEGG:
FT                   sus:Acid_3617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54866"
FT                   /db_xref="GOA:A7I555"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A7I555"
FT                   /protein_id="ABS54866.1"
FT                   /translation="MVTTEKEYLDTLRDRLTGYLTGEDLDEILEEYAGHFAIGKSRGRT
FT                   EEELCRALGSPEDVAKEIRAAYLIHKAEQTKSAGTIWRATRATTHIHGLNFVAVLVPFI
FT                   LFAVVFGLVFIAGLALICGGAVLLLLALIKLLGLSLTLPWHLSPAPGVLTSLGLFIAGI
FT                   IVVVLDIWLAHFFGRLTIRHLRNKLPAKKDAGFFSPQQAIPQTIAIGRDGASALDLQVH
FT                   LSAGQLTLGEGAGDPVLMNLTAGNGSSTGPLAYSASMDGTTKKVWIWNRHGCFWWSGHD
FT                   WPANEPAYTWDIRVSRDVPVAIDAKNHAGRTRLALGELNLSSLTVKNSVGETQIDLTGY
FT                   HGGDFNATIKNGVGELTLRMPKDAHLSVEIHGGIGATNVRGFVVNGNVYTTSSSRPDAP
FT                   RITCRIKQGVGSITVEAV"
FT   gene            complement(337653..337979)
FT                   /locus_tag="Mboo_0346"
FT   CDS_pept        complement(337653..337979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0346"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: cac:CAC0571 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54867"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I556"
FT                   /protein_id="ABS54867.1"
FT                   /translation="MNIQFKKGVLGICVLCVLAKKDCYGYELVDEISKKIDIAEGTIYP
FT                   LLHRLKDEGLVTTYLQESGEGPPRKYYRLTDAGRTKEHEQRDEWVHFAESVNALLEERS
FT                   HGDN"
FT   gene            complement(338187..338514)
FT                   /pseudo
FT                   /locus_tag="Mboo_0347"
FT   gene            complement(338531..338815)
FT                   /locus_tag="Mboo_0348"
FT   CDS_pept        complement(338531..338815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0348"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: mac:MA0102 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54868"
FT                   /db_xref="GOA:A7I557"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A7I557"
FT                   /protein_id="ABS54868.1"
FT                   /translation="MDVLALLREHEPEIKKRFGVATIGIFGSFVRGEERPESDVDVLVT
FT                   FRKGEETFDNYMDCKFYLEDLFSRKVDLVMKGAIKKRLRPYILGEVVYA"
FT   gene            complement(339715..340152)
FT                   /locus_tag="Mboo_0349"
FT   CDS_pept        complement(339715..340152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_0135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54869"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A7I558"
FT                   /protein_id="ABS54869.1"
FT                   /translation="MKIYMDVCCLCRPFDDQTMGRIRLEVTAVQEIIRRCASREYILVT
FT                   SEAITEEISKIPDIWKRLRVEKIVSVAIEQVLIDEDIIARMHEIIAMGGGAMDSLHIAC
FT                   AERAGAVLLTTDDGMITFFKMHQNIQVHIGNPVTWLKEENK"
FT   gene            340785..341594
FT                   /locus_tag="Mboo_0350"
FT   CDS_pept        340785..341594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0350"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: mba:Mbar_A3242 DNA-(apurinic or apyrimidinic
FT                   site) lyase; TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54870"
FT                   /db_xref="GOA:A7I559"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A7I559"
FT                   /protein_id="ABS54870.1"
FT                   /translation="MEKLKLISWNVDGLRARCKAGQFIKLLQVDFDILCLQETKTPELD
FT                   IPQEIRSDKKYYSHFSEVQKGSFAGVGILSKIECRQISDNFGGTKFDKEGRILIAEYDR
FT                   FTLLNIYFPLGAGKPDTPDTLSHKLEFYDTLLGFVKELLSQKKNVIICGDFNIAHKDKD
FT                   LVNAKTTPLIVGIYPEEREKLNELERLGFVDAFRYKHPNLVRYSRWPYQNNSRELNLGW
FT                   RLDYFFVSAGLKDSITESEMLYHPGESDSHPQIAGSDHCPITLELSM"
FT   gene            341664..343568
FT                   /locus_tag="Mboo_0351"
FT   CDS_pept        341664..343568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54871"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I560"
FT                   /protein_id="ABS54871.1"
FT                   /translation="MTLNDPCGWSGSIHTFLSLSKSDWLSSLQAHHQRCMNSPADQSQI
FT                   LAWDHSFDILQRELKQLVQIKPEIGNYSIIFEYELPRERGRRPDVIILGPCVFVLEFKD
FT                   YAQLLQAHSDQVAAYARDLKNYHAGSQPYCVLSFLILARAKDQITDNENVIVLSPDHIV
FT                   DVFTLSSELEAGPLIDPRVWIAAEYSPLPSLIEAARTIWNKQPLPQIKRALSAGIPQTI
FT                   AELLSIAQAAKANNELHLALVTGVPGAGKTLVGIQLVYENHLEGSDLQNTAVFLSGNGP
FT                   LVKVLQHALKYKIFVQDVHGFLKEYGGETAKIPHEHIWVYDEAQRAWDAERVSEKRGHA
FT                   TSEPEDFLRIAERMNSWGLMVALIGEGQEIHLGEESGLPQWNDALAKMQKPWIVHCPKK
FT                   IAGTFTAAKKLATSDVLDLSVSLRSHLAEDVAQWISALLEGDLIHAKTLSESVTSQGFD
FT                   VYLTQDINVATNYVKERYKDQEDKRYGLLASSKAKNLPTWGIHNEYNYTKNMREGPWYT
FT                   DPPSSFNSCCAFRDVATEFSCQGLELDFPIVCWGDDFVWDGIWKSPPAKRSKAKDPHQL
FT                   RVNSYRVVLTRGRDGFIVFVPPEIGMQSTYEALKGAGVREITEVNTKDLIVKDGAGVV"
FT   gene            343565..344419
FT                   /locus_tag="Mboo_0352"
FT   CDS_pept        343565..344419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0352"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   mbu:Mbur_1535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54872"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A7I561"
FT                   /protein_id="ABS54872.1"
FT                   /translation="MMDKQNDYPQIDIGIKNRKIPRLRYSIIESLTDVENQEISFLDFL
FT                   TKNIKIYNGPNKELQQYCPIFFELLSNIINDKFVDWHTKIMISAALGYFVLEEDVIPDI
FT                   AENGYVDDLYLVTYVLNEIKVTQSPEIILRNWSRKEDILQLIDDVFIKASEIVGPLSKN
FT                   ILQKVGLYKFSLLSLEEYSGVYPKRYATVAREKRELIGLLAYIIQHIKGDDLYRSSYEK
FT                   IRKYIENDGNFDEIQRIIEISKLYHKIDVESIDKPEDFVKLLEQRMREARLKALKEKND
FT                   KNQ"
FT   gene            complement(344413..345495)
FT                   /locus_tag="Mboo_0353"
FT   CDS_pept        complement(344413..345495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hal:VNG7073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54873"
FT                   /db_xref="UniProtKB/TrEMBL:A7I562"
FT                   /protein_id="ABS54873.1"
FT                   /translation="MVEVEIGILQMPKELYDVIIRQKNQYEDREHAEKPDDFSKDLYND
FT                   TSYLTSFKRYIDIPLICLFYGLYKSRELPPERSTEISFGYTLEFGAKATDQIDLFNNLL
FT                   FALWVEKNPVPNEYSALIGYRQRLYGFLDRLQDLRYITKVMIPFYLQKANEPNDEKSFV
FT                   NRLKFSEYVKYEPIDFSPEYLALEFFNVQKEFMKYLKIEEIDKGAQSIDIDKIAEMKKV
FT                   GITDQLERRVDNIEIRLRQLIKSQITTKDAQFWDKIMNHELKEDVENRIRSKLHANPMI
FT                   KESDIDIFDFFTIYNYKSIMSEFWIIFEPIFRSKSDMKGQFEELTNLRNALKHNHKLTP
FT                   FEMKKGDVTLMWFEEILKNY"
FT   gene            complement(345496..347382)
FT                   /locus_tag="Mboo_0354"
FT   CDS_pept        complement(345496..347382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sep:SE0909 chromosome segregation SMC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54874"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I563"
FT                   /protein_id="ABS54874.1"
FT                   /translation="MAQDVFFEFIDIKGYRGRNFELKMNPPGEHTVFIMDGNTGKTTTI
FT                   ELIRWCFKHKESEAVGKFRHMWIEPAHVLDMMKHGPQTCTIKISFSDKKHRYLFTRVTK
FT                   GEYLNEIDDNKKIIGDRINEVLDTLEIDSGADVISGDRVNQYLREQFRFGQSVDYFCFD
FT                   GERARDLLIKASDVDNLDFLTSLINTRATHPILNHYNEQLEALKRKIYTKAKSRAPDRK
FT                   IKEYIEKIEDKEGELKAARDLLRSNRDELAPIIEAIRLKNDEISELDKKRIQIQSEKYS
FT                   EKLDYERQIDSIKQKWRDKRKFYYENSLNWLSHIDTEYLNKLKHHVREVGKLPEPYRKD
FT                   LIYACLNHKPPICQICGRELDDDASYNHVKELENLVASHEVQSFLADKVKVDNIIFFPE
FT                   KEYELLIAQYQTFKETETLKNAIVLSDEDNELVNHLNTAKNALEALLSRKRDFESNIQF
FT                   LSNEVIRLEGEKQELESNLGFFKEYQNVLKNIERTQDTIITTQESMKEKTIGIISSVLS
FT                   ESISSILGPSFSANFSKDHGLLLGENNKFSPEIGGMSGRIILAYCFAEAMTLIDPIIID
FT                   TPSGNVGTHRDPLGQHLNVNHNQVICLCLPHETLNFAPHISKNPIEIENRGE"
FT   gene            complement(347586..349376)
FT                   /locus_tag="Mboo_0355"
FT   CDS_pept        complement(347586..349376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0355"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: lsa:LSA0147 putative
FT                   DNA-repair helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54875"
FT                   /db_xref="GOA:A7I564"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I564"
FT                   /protein_id="ABS54875.1"
FT                   /translation="MDFEFKQGLNLLNYLLDLGFKTRKSDELECISYNVNLNLAIRLFS
FT                   EYPHIRKIIFHANSQNFSISTEQRGQLLKLIESEKIVINHISRNELCIHSKVYRFKKDG
FT                   NFTLGAITSANFSENSNLNFESMYISERLDFIEDLGSGVAEKLQLYEIKEKKSLPESIV
FT                   QILDSDRKIDKRFVEGLWVHQQAILEWLALRRKGIVNIPPGCGKSRIAIRYIQYLFNRN
FT                   RKTTVIILVPTITLINQWKQILKNEGIDAFEVDMDMNNIGQYFANPTEKVIITLYSRFF
FT                   EKYPIILQKISMFKPDLLTISDECHNLYSSLEDLERYYSQILRSGTPFKQSYFLSLSAT
FT                   IDSFIQENVDRFIALNGGEQNRFSISIPSFYSYWNNLNKTPCLKPIMYQPLYYNLSLSE
FT                   MQKYLELSRFVGIESQNVTLQGDNSFDAAIRRAQYVRGLEGSYKILKSYIQTHIEAFNR
FT                   GNTIIFVPTHEFAEELRTFLVNTKGWNPKSSAYVYDSKKSDMYLQHALEQFKNNLGFCL
FT                   ISEIMLSEGFDIPVISRVVLHGSHKSQRDWIQKIGRAIRFDPTNESSLAEVIDLVFCNP
FT                   TGKVLPIEEERYETLKSISK"
FT   gene            complement(349465..350637)
FT                   /locus_tag="Mboo_0356"
FT   CDS_pept        complement(349465..350637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0356"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   gvi:gll4384 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54876"
FT                   /db_xref="GOA:A7I565"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A7I565"
FT                   /protein_id="ABS54876.1"
FT                   /translation="MEKINRPIYMDSHATTPVDPRVLEAMLPYFSDIFGNAGSIDHAYG
FT                   AVAAEAVKKAREQCAHPLNAHPEEIIFTSGATEANNIAILGTAEQYAEKGDHIITCVTE
FT                   HKAVLDTCKHLQKTGKSVTFLPVDQYGLVDPGQVEDAITDKTVLISIMTANNEIGTIAP
FT                   IKEIGKIAHEHGVIFHTDAAQAVGHISIDVKEMNIDLLSFSGHKIYGPKGIGGLYIRGS
FT                   NPRVKLAPIVFGGGQEKGLRSGTLNVPGIVGLGKALAVAEKEMAKEEKQYRKWTTQMFD
FT                   AFKDAYPSVMLNGHPTKRLAHNLNVCFPGIESKALIHLLKDDVSISAGSACTTTSVEPS
FT                   HVLLAIGRTEEESHWAVRFGLGRGNTEEIIEYTIITLKDDLNKIKKISDI"
FT   gene            complement(350624..351049)
FT                   /locus_tag="Mboo_0357"
FT   CDS_pept        complement(350624..351049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_4570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54877"
FT                   /db_xref="InterPro:IPR014969"
FT                   /db_xref="InterPro:IPR038472"
FT                   /db_xref="UniProtKB/TrEMBL:A7I566"
FT                   /protein_id="ABS54877.1"
FT                   /translation="MRSSFYRLRISEKATFRLSQLKGKTGLTPNIICRIAICYSLNDPS
FT                   IPNPADYDERGQEINRYSLTGEWDTFFIALVKERCIHDKLDPEEDLYDQLRAHLNRGVF
FT                   GIFPQIKSLGDFRILLVHQAAGIKSGMLSEGHSHGKN"
FT   gene            complement(351046..353067)
FT                   /locus_tag="Mboo_0358"
FT   CDS_pept        complement(351046..353067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0358"
FT                   /product="SMC protein-like protein"
FT                   /note="KEGG: mes:Meso_4571 SMC protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54878"
FT                   /db_xref="InterPro:IPR017599"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A7I567"
FT                   /protein_id="ABS54878.1"
FT                   /translation="MLLHSLTLENIRIFKGKNRLDFTPILTSDVKKPIILIGGKNGAGK
FT                   TTLFESILLCLYGQHAPGSLMSKTKYEQYIRQIVPRSKKLEAELIPAIEIVFEFTHSGI
FT                   RNTYGVRREWSLGPKFSENLTITCEGSILSELEKDQWQDLLNELIPPRFARLFLFDGEK
FT                   IQNIVDDNDENNYLQDSFKSLLGLDIVDHLKADLGIYLSRHLRSSDISAINKQMKETTS
FT                   EIGKIEEEKEYLEQERAKVQGQSERVQLEIGKQEQLLASEGGGFARIRDDMKAEKVRLD
FT                   QFVVKTENEISELCEGLFPFAITPKYCESLKKTLIEEDKVQAHALSQEIIHANIEELNK
FT                   IIQSPAFWSDVSVPSSQKEKVREKLVDLMYQHLVTDDSVKKKKLVHHLSQHEYKQLLQW
FT                   IEEATKTTPKKMKELSEQLEKLTAQRLKIAEMINKAPSDEVIAPHITKLNELNQKIGQC
FT                   SEQLRSINESIRQIDLRLNELNRQRKKFEEEIQGAKGGSIKMELALQVTTVLNEYAKEL
FT                   QKQKINYLGDNILSCFNRLIRKDDYVQKILIDENYNIILYDADGNTIPKNLLSAGEKEI
FT                   FAVSLLWGLTLTSGRQLPFIIDTPLGRLDSEHRGNLVMDFFQHAGDQMIIFSTDTEIDK
FT                   EYFRILQPQIARAYHLDYSKKERHTSISPGYFWQEVES"
FT   gene            complement(353077..354540)
FT                   /locus_tag="Mboo_0359"
FT   CDS_pept        complement(353077..354540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0359"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: mes:Meso_4572 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54879"
FT                   /db_xref="GOA:A7I568"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017598"
FT                   /db_xref="UniProtKB/TrEMBL:A7I568"
FT                   /protein_id="ABS54879.1"
FT                   /translation="MTSKKTPNGTTDSVFDKKGLQNIYREIREVYLSDSRPWVIGYSGG
FT                   KDSTTALQLVWYAIAELPEEKRTKPVFVISSDTLVETPVIVDYLTTTLERINKTAAEKK
FT                   MPFKAFKLTPRIIDSFWVNLIGKGYPAPSTQFRWCTERLKIRTADRFILESVTKYGEVV
FT                   MILGVRKGESATRDQVMNLYKIEGSKLSHHSRFPQSYVYTPIEEFSVDDVWTYLLQKPS
FT                   PWGNNNRDLLALYKSAQDGECPLVVDTETASCGNSRFGCWVCTVVQKDRSMEALIESGE
FT                   DWMEPLLDFRNELAETQIPEKKLEYRDYRRMNGKVKFMQAGDSKKVIPGPYTLEYSKIL
FT                   LRKLLEAQKSVRKNGPNPNFSLILLEELQEIRRIWMTQKSDWNDSVVKIYEEVTGERLD
FT                   WTKDDLGSFSQSEQDLLKKICDDQKLPLRLVTKLLDVERQMQGMTRRSSIYNRIGEVLS
FT                   EDWISEDEVKKALINPKAVDTKRRSLRYV"
FT   gene            complement(354537..355679)
FT                   /locus_tag="Mboo_0360"
FT   CDS_pept        complement(354537..355679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_4573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54880"
FT                   /db_xref="InterPro:IPR017601"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:A7I569"
FT                   /protein_id="ABS54880.1"
FT                   /translation="MKVAALDEVDDLETAVFSFPAIRGTQAGREYYSAMVQLKLVPTIF
FT                   RFNESEVPAQVRAQRVLNHARIPEIAHYIISNPHDYVFSSIAASISEVPVKFVPAPQDN
FT                   PNSRVGKIIIPMGARVLINDGQHRRAAIESALKERPELGNETISVVFFIDTGLKRSQQM
FT                   FSDLNRHAVRPTKSISILYDSREAFAQSVRDIATSLPIFKDLTEFEKTSISNRSRKMFT
FT                   LSTIYQATAALLGKKTKVKKITNDEEKLASKYWNIVADNIPEWQQLIRGDVASSSLRND
FT                   FIHAHGIALHALGLAGHALIEEYPDTWEEKLENLHKIDWSRSNAEVWEGRAMNNGTISK
FT                   SQMNLALTTNYLKYILTLPLTKEEEKNEKKYQTQVRGKLR"
FT   gene            356264..356548
FT                   /locus_tag="Mboo_0361"
FT   CDS_pept        356264..356548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54881"
FT                   /db_xref="GOA:A7I570"
FT                   /db_xref="UniProtKB/TrEMBL:A7I570"
FT                   /protein_id="ABS54881.1"
FT                   /translation="MKMISAYRLRVMPDEPPSFLLVMGYTLQIPVCVMAIVFLFDLAGK
FT                   YGCFHPAAVALMGAFAAITIHAGYRLWRLLFAPALAKKRRDYFPAIVVK"
FT   gene            complement(357280..359085)
FT                   /locus_tag="Mboo_0362"
FT   CDS_pept        complement(357280..359085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54882"
FT                   /db_xref="GOA:A7I571"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A7I571"
FT                   /protein_id="ABS54882.1"
FT                   /translation="MSIKRDIGILLIITCLVGICAFFIINTTTPTSYESWNEKTVEKIG
FT                   YSRAPEGGYADFAPDDPDLYSTYYFSLALKNEHIGLMQKEQTEQWLYSREQDFLRNTSE
FT                   VSLKDLYYLTGCMKNYDIPPENQSGIISLVEQFGKSDGSYADRPGFNGSSLDTARALKI
FT                   LEFTGNNVVTANITREWLMQQWKSDQISTDEDYLLAETEILVPAFHLANIDPNEFEIDS
FT                   SQKSVEEQHALIWKSRLGDLPEKKIDLFTLNALETELRTSGGLTPDISRKVQDYVYSLE
FT                   LPDGGYNAILNNYGDAQGTYLATKLLSDIGSPVNNRTINFIKRHESRYGGFHPAFKITP
FT                   SPKDTWFAIRALTLLDPRNPTVSEIKPWLDTQLSSPHLSPENQYYVVMTYGELGESVPN
FT                   AASIRSTLEQQITTISGSASGPGDMEQIFYLLNMAKVVDLSLDSVQKDRLIRKINEIQN
FT                   ADGCYGRERSDLVTTYYALGSLDALLATPSNPDACAAWIEQGYTRDGGYRYRGENWSTN
FT                   FSYISPTWLSISSLDYLHKYPKTAGNTLQWINSSRYPNGGIQLMPKQPETEVNDATFRE
FT                   SLEYTVQGLETERILLHNGGFSRGY"
FT   gene            complement(359114..359824)
FT                   /locus_tag="Mboo_0363"
FT   CDS_pept        complement(359114..359824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A2707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54883"
FT                   /db_xref="UniProtKB/TrEMBL:A7I572"
FT                   /protein_id="ABS54883.1"
FT                   /translation="MKTLKTGVMLLALLLAAMAMVPMVNAADIQAADAHQASSDAVIDS
FT                   SLKGIVIQTDPYTYVFTGKTDNKTASVDHLMTNLNKKTKSVATASSGTPVSGANSASLP
FT                   LFGSSIYQRTTITGSYDGGWTSPYSKYVSGNLLSNWQGTSPYYADKITLASQVSASGVG
FT                   VSISMPGGSMGYQDIGGNRLAYSDYWTNAYAVTHSYTNFLAQSWATIPSIQESDSGTFR
FT                   FSYSDYTVNTYVSV"
FT   sig_peptide     complement(359744..359824)
FT                   /locus_tag="Mboo_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            360316..360690
FT                   /locus_tag="Mboo_0364"
FT   CDS_pept        360316..360690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0364"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54884"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A7I573"
FT                   /protein_id="ABS54884.1"
FT                   /translation="MASFFADSYALIEILKGNERYIPYINGNLVTTEFNICEVTFAVCR
FT                   DYPDKTRQVMARVRKMVTLLSTTDGDYCEGAAMRRKTTGAGKKLSTIDCVGYAVSRRQE
FT                   IPFLTGDREFEDIEDVEFVR"
FT   gene            360861..361202
FT                   /locus_tag="Mboo_0365"
FT   CDS_pept        360861..361202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0365"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: sru:SRU_0586 nucleotidyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54885"
FT                   /db_xref="GOA:A7I574"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A7I574"
FT                   /protein_id="ABS54885.1"
FT                   /translation="MTQGSADPRELGEIIRNIVACAHPEKIILFGSGARGEMGPSSDID
FT                   LLVIKDGEFDPGALTEEIYMHLVGIGRAVDVIVISSRDAERYRNSPYFVVYPAFRQGTE
FT                   VYHAGQALT"
FT   gene            361180..361581
FT                   /locus_tag="Mboo_0366"
FT   CDS_pept        361180..361581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0366"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; KEGG: sru:SRU_0587 HEPN
FT                   domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54886"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A7I575"
FT                   /protein_id="ABS54886.1"
FT                   /translation="MQDRLSPEDPEEWLNRARSNLAIAKNRCDAAIYREDLCFNAQQAA
FT                   EKGLKAVCIRHRIEFPYIHDMAALVTLLMKNGVAVPEPVKEAAKLTRFAIATRYPHVSG
FT                   PVREEEYQRAIAISGTVLDWCEEELRHTG"
FT   gene            complement(361938..362357)
FT                   /locus_tag="Mboo_0367"
FT   CDS_pept        complement(361938..362357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54887"
FT                   /db_xref="GOA:A7I576"
FT                   /db_xref="UniProtKB/TrEMBL:A7I576"
FT                   /protein_id="ABS54887.1"
FT                   /translation="MTSKNMIAQTETILKYCVLGLLIVFALATLFAFVINWETWFFGRK
FT                   LDGLPAGIALGVTWLAAALLAAALIKFPRMDPLLGGLTAVYFGFLFVNSSMTIQKVSYT
FT                   HQGFSPVLAAFAILSIAFFIVALIKRYQENSKIRP"
FT   sig_peptide     complement(362259..362357)
FT                   /locus_tag="Mboo_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.504 at
FT                   residue 33"
FT   gene            complement(362393..363316)
FT                   /locus_tag="Mboo_0368"
FT   CDS_pept        complement(362393..363316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54888"
FT                   /db_xref="UniProtKB/TrEMBL:A7I577"
FT                   /protein_id="ABS54888.1"
FT                   /translation="MKTLKTGGMLLALLLAAMVPMVSADDSAAQGDTSDQNIVSLYQPI
FT                   HNEIQINVSTAINERITTHDQYYKDLSSSLVKKYQTNLDSIIDILEIKTGQQLSAKQRD
FT                   TVKQIIVAEDLNKVVQENRKKELGVNATQMRILQVQPDNVQMKSGNLQLTALPNSLTLI
FT                   QVAVDVNGGTGRDGNNIAYTVNGGNQLYSIIYNTHPGSYTYYECHFRDEDVPDSASSDA
FT                   VYDAYRLAVYGTIEDTQSFIVYSNGTIEFGSNRDNGYTYGYIIGQHGSITRPFGSSTRI
FT                   YLSNVWNHAMDTYDRNSNMAKITYSY"
FT   sig_peptide     complement(363242..363316)
FT                   /locus_tag="Mboo_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            363665..363982
FT                   /locus_tag="Mboo_0369"
FT   CDS_pept        363665..363982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0369"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: mac:MA2131 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54889"
FT                   /db_xref="GOA:A7I578"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A7I578"
FT                   /protein_id="ABS54889.1"
FT                   /translation="MPISPTKHMQDTAGILDQLRGMRHELEEQYHVKRIGIFGSYAKKA
FT                   QTDESDLDLVVEFSRPIGMLAFVHLKDLLSQKFNLRIDLVTPDGLHPLIRDRVMHEVVY
FT                   A"
FT   gene            363975..364319
FT                   /locus_tag="Mboo_0370"
FT   CDS_pept        363975..364319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0370"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   mac:MA0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54890"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:A7I579"
FT                   /protein_id="ABS54890.1"
FT                   /translation="MPEKRTAALLLYDIFQAIEKIETFCAGYSFDLLMEDQRTQDAILR
FT                   NIQIIGEASKNLPQELISRHPEVDWSGLAGIRDIVTHRYFRVDWNLLWTSIHEELPVLK
FT                   AQIGKLMKEE"
FT   gene            complement(364402..364677)
FT                   /locus_tag="Mboo_0371"
FT   CDS_pept        complement(364402..364677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0371"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ava:Ava_2195 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54891"
FT                   /db_xref="GOA:A7I580"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7I580"
FT                   /protein_id="ABS54891.1"
FT                   /translation="MATISLVTSEREEIFGKIIREERKAKEISQERLARLTGLDRTFIS
FT                   LIENGKRSPTFSTILKICSAIEIDPSELFSIYEKKDPDYHVRKRGK"
FT   gene            complement(364693..364977)
FT                   /locus_tag="Mboo_0372"
FT   CDS_pept        complement(364693..364977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54892"
FT                   /db_xref="UniProtKB/TrEMBL:A7I581"
FT                   /protein_id="ABS54892.1"
FT                   /translation="MFFRIPFKKRVDTADLFSWHRALLKREFALCLKFRWLVRFFRKNP
FT                   GALVQNDILEPGGKRPGLLYRSGLTNMSHQTPDEIYAGGADKFVDYSLR"
FT   gene            complement(364993..365343)
FT                   /locus_tag="Mboo_0373"
FT   CDS_pept        complement(364993..365343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0373"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   tte:TTE0752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54893"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:A7I582"
FT                   /protein_id="ABS54893.1"
FT                   /translation="MKDDRVYLQHILDEIEYLDSLRPTITYESLLNNKTTEHAVTRSLE
FT                   IIGEAAKNVPDRIRKENPKIPWKFMAGLRDKVIHGYFAINYEIVWDVIKNKLPELEPEI
FT                   QSLCDAMGPDVD"
FT   gene            complement(365333..365659)
FT                   /locus_tag="Mboo_0374"
FT   CDS_pept        complement(365333..365659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0374"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: mac:MA0102 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54894"
FT                   /db_xref="GOA:A7I583"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A7I583"
FT                   /protein_id="ABS54894.1"
FT                   /translation="MVPQVIPQKKLKSPVFMRLGHAVPSLRSRFGVKRIGIFGSFARSE
FT                   EKRTSDVDILVEFADGQATFDNFMQLVYFLEDLLGRKVDLLTVGSIDKYIRSRVEREVI
FT                   WIEG"
FT   gene            complement(365933..366754)
FT                   /locus_tag="Mboo_0375"
FT   CDS_pept        complement(365933..366754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM2441 transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54895"
FT                   /db_xref="GOA:A7I584"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I584"
FT                   /protein_id="ABS54895.1"
FT                   /translation="MKPWPVRAVALIIFIALACVPAVTASYGGYSVAPGGAGAVQGQPQ
FT                   DPVPISFFDLTLREMLIAVALSFCPVLAYPVEIFFYLKLLAALGYRKVGQNAILWNRNR
FT                   REIFACIAANPGVRFTALERMTGIKEGTLKYHLLILEAKRRIVSFGSGRSLRYFENNGR
FT                   YSELEKKVFFHLQNPTTRRILEILAASPEVSRKDIAGIVGIAGPSITWHTRRLTGDGII
FT                   STSKKGKAVRYTFCPAGLNVFRQFTGEGAGASSGSADSRMSWREQSSKHNP"
FT   sig_peptide     complement(366680..366754)
FT                   /locus_tag="Mboo_0375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.698 at
FT                   residue 25"
FT   gene            complement(366800..367243)
FT                   /locus_tag="Mboo_0376"
FT   CDS_pept        complement(366800..367243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0376"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: peptidase domain protein; KEGG: mba:Mbar_A0651
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54896"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="UniProtKB/TrEMBL:A7I585"
FT                   /protein_id="ABS54896.1"
FT                   /translation="MKVSVATLAILVCAIVLISGVSAQDVDKSAGYSVSPAGNLRLPAV
FT                   VSPMTAGSISQGETDWYSVSVPSGKSSLTADLNWGYVPDSLSLSVIAPDGTLGPYYDAS
FT                   DSVKDGRIFLTFSRTGGIAPGTWRFKVYGETVLGIQGYNFVTY"
FT   sig_peptide     complement(367172..367243)
FT                   /locus_tag="Mboo_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            367523..368722
FT                   /locus_tag="Mboo_0377"
FT   CDS_pept        367523..368722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mba:Mbar_A0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54897"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:A7I586"
FT                   /protein_id="ABS54897.1"
FT                   /translation="MKPIKYGIILLALLLAAMAMVPMVSAMGTAITPDVATAIESNYVS
FT                   PDTAFQSATAAVKDFIGRNALDENWNGATVNPKPNIIFDVNGKKLFYLFSVEKKGNRIG
FT                   EIKIAASKVLGSSVVTIGSGAPAIDLKNIRSKATGILNQQYKNAKIDSIDLVCYNYPNI
FT                   GAIIRFTAAGSGSTSLVIDAYDYSIIPAAGQVSFYNAIPPADLAGRAARWDSEQTALKT
FT                   VSAQSLSPMATVTKTINGFTLYPQESTNWCSFATAKMISAYYGYSRTQRGIATTMGIAN
FT                   PDDGASIETTRSNYYLNTIANGGLAKMGTSISYTGMFTYDNIVSEMNSNRPIHTDRYET
FT                   SSYHARAITGYSYTTTTPVSQYLYIYDPWPTTSGAVYWENWNVFSGQPNPVHAILYVRN
FT                   "
FT   sig_peptide     367523..367603
FT                   /locus_tag="Mboo_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.623 at
FT                   residue 27"
FT   gene            368753..370075
FT                   /locus_tag="Mboo_0378"
FT   CDS_pept        368753..370075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0378"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM2469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54898"
FT                   /db_xref="GOA:A7I587"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A7I587"
FT                   /protein_id="ABS54898.1"
FT                   /translation="MKKKITITVLFVILLTLFCSAPVVGQSRTLQQTNDILLPLTSPSG
FT                   NQSPLIHIADNGNLVTVNYPYDPNFFVYDGNGSFLWNATLSAEQSPWISSVSVAPDGQY
FT                   LIVTQLVPACCHGSVTNTSSNKVILFDRSGARSWEYPTYSPPLTSTISYDNQNIFIGMN
FT                   DGRIINLDREGTACWTARVDAPVLSLTTSADSSTIVATGESNYYSNKIYGEPLNPHDLF
FT                   VLDKNGTLLWNYQTRGTNTAAISDDGSVTAVLNERNGNLLLFNRTGGRQIERSFAGTPS
FT                   AIVMSGDANLIVVRTLEGFVYGVDRNGSIVWNASLESGSQGIAITDTGNSLVLGDGKAI
FT                   AMFNITGNRLDEYPVDSEVRSIGVSPDRKSIIIGTEQNLIVIPAMEPVPRTESTALTPI
FT                   QTVHASGQVPQTPKESSVFPIILVFAVGCGIVIMLNRKGKF"
FT   sig_peptide     368753..368830
FT                   /locus_tag="Mboo_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            370341..370703
FT                   /locus_tag="Mboo_0379"
FT   CDS_pept        370341..370703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54899"
FT                   /db_xref="UniProtKB/TrEMBL:A7I588"
FT                   /protein_id="ABS54899.1"
FT                   /translation="MYQRIKSAKMKRSALPLPTPEPFRQWITVPIMYEVSTANLGVGTQ
FT                   TQDKVYYISIKVLDGSNRRVNVFVTYDGKVALVDIPYPVITPLHYPANSSWSGFVNNNS
FT                   AGCLLREIAGPGTSVF"
FT   gene            370933..371301
FT                   /locus_tag="Mboo_0380"
FT   CDS_pept        370933..371301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54900"
FT                   /db_xref="GOA:A7I589"
FT                   /db_xref="UniProtKB/TrEMBL:A7I589"
FT                   /protein_id="ABS54900.1"
FT                   /translation="MTNKDFVGIQKEKIAPLISALLCAAVGSLFVSIGLQNTGLQRYYL
FT                   SWDNPLYQIMHILIFEPLVLASLGVGFVFLVSAVFFLRNAFEGEFFVVGNADWPTGSKF
FT                   CIFLVLLWIAIHVISGFL"
FT   gene            371850..372119
FT                   /locus_tag="Mboo_0381"
FT   CDS_pept        371850..372119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54901"
FT                   /db_xref="UniProtKB/TrEMBL:A7I590"
FT                   /protein_id="ABS54901.1"
FT                   /translation="MAKSKSVTESEIPLYLLPRALAHQINRIGDSVYRISVKRTHWHHY
FT                   NISVRTRSLPKELAPGSGTGPAHSGHPPKEYRNDDGTPDPGCEA"
FT   gene            372116..372520
FT                   /locus_tag="Mboo_0382"
FT   CDS_pept        372116..372520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54902"
FT                   /db_xref="UniProtKB/TrEMBL:A7I591"
FT                   /protein_id="ABS54902.1"
FT                   /translation="MKRGSPPYRALSDALPIARRRGTTQAAVRAPENLYDFTIVSAIPL
FT                   AFVRVTYCSRIHAPAAELVNEFRDELFRLGRIPVHTDISRELWLRSRHGTWRFLRLTPD
FT                   SLIELGQDGMLLSGGNAAKNLYSREKVIFS"
FT   gene            373178..373681
FT                   /locus_tag="Mboo_0383"
FT   CDS_pept        373178..373681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54903"
FT                   /db_xref="UniProtKB/TrEMBL:A7I592"
FT                   /protein_id="ABS54903.1"
FT                   /translation="MGDFVQHTEVKSAIRTLADPIEDIASFDALVQSVIATNPFGCVPY
FT                   ISAGVTHAPVEKAKESYVVKILYQDNEAKVVGNDSGKFNTVAGFNAGAAALLADTALAA
FT                   AHGGIPARDIESETYSATIKCHDQNGELYDLTFTRSKVSLTSYEDDAIRAKVEAWADTV
FT                   PALA"
FT   gene            373974..374450
FT                   /locus_tag="Mboo_0384"
FT   CDS_pept        373974..374450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54904"
FT                   /db_xref="UniProtKB/TrEMBL:A7I593"
FT                   /protein_id="ABS54904.1"
FT                   /translation="MPDNPAREPVAKVTGIYRGKFSGLEPLTIDKPLIQEEVRRNPIFY
FT                   ELDLNPERGDENLIIDLIYDNLSPRRLPDLIRGTDIPHGIRFWPDWFSIPPYREMRDTD
FT                   GRRVYPRAPGIHTVQIRTGVQKRARIGGNRDFSPEMGGFSSPVFEFMIAGDDNV"
FT   gene            374443..375027
FT                   /locus_tag="Mboo_0385"
FT   CDS_pept        374443..375027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54905"
FT                   /db_xref="GOA:A7I594"
FT                   /db_xref="UniProtKB/TrEMBL:A7I594"
FT                   /protein_id="ABS54905.1"
FT                   /translation="MFENETQTRCAICGTGILLGAIFLLAHFPVILLIVPVGILFLGLV
FT                   ADPEETHAVWYGMLSMLGIFDVSALTDAERENYAEKRHYFWFGEVAMASILADLFAVPV
FT                   GIFLAGRAEVTLAFIGAAVLFLPLFVFLPKLIQRAMKADVDAAMEMFGKNEQTKKVFWT
FT                   LFVSMAGLVLARVIDPETARQVVGVITGVGG"
FT   gene            complement(375060..375539)
FT                   /locus_tag="Mboo_0386"
FT   CDS_pept        complement(375060..375539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0386"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG:
FT                   mhu:Mhun_1541 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54906"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I595"
FT                   /protein_id="ABS54906.1"
FT                   /translation="MTKNDDFWRWIEAALNVIGGKWKLLIVIALRDGTQRFSEISHKLP
FT                   AISERMLVKQLREMEHDGIITRKVYPVVPAKVEYSLTQSGEKLIPVLKILGIWSIIYLG
FT                   SDVAGKGLSEPVKVDPGKLRQLLEDLDGILQDADKKIKRQSNRTSQTISINSGKN"
FT   gene            375651..376346
FT                   /locus_tag="Mboo_0387"
FT   CDS_pept        375651..376346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0387"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   hma:rrnAC3474 metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54907"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7I596"
FT                   /protein_id="ABS54907.1"
FT                   /translation="MEIVPGIHQIDGVNGNCFIIVRDELTLIDTGMPKNSTKIITYIQD
FT                   VLKRKPTDIKTIVLTHFHIDHVGGASELKKLSGAKVAIHKKDADYVSGRKTPPVPRGVK
FT                   GMIVKVLIPLFFGSRPVEPDIYLNDGDTIAGLTTLHTPGHTPGSICLFDPVSKILFAGD
FT                   LLRFDGTNIKMGPLNLDQGEEQKSINKIAAIDFDIMLSGHGIPLRPEASVKIREFAKRN
FT                   TWKNGSPGK"
FT   gene            376396..377796
FT                   /locus_tag="Mboo_0388"
FT   CDS_pept        376396..377796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0388"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bte:BTH_II2230 drug resistance transporter, EmrB/QacA
FT                   family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54908"
FT                   /db_xref="GOA:A7I597"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7I597"
FT                   /protein_id="ABS54908.1"
FT                   /translation="MNTSNLPQPAESKIAFDWRFVTPLYIGSALNPVNTSFIATALVPI
FT                   AAAINVPVGQTAVLVAALYIACIVAQPAAGKLSEAFGPRRVFLAGILAVLAGGVLGGLG
FT                   HDLATLIVSRVLIGVGTSTGYPSAMLLIRQRAESAGLTGPPGGVLGGLVIAGMATAVIG
FT                   LPIGGFLVAAWGWQSVFFINVPLALVALIMAASWIPRDPPCRSIKTLRDLATRIDLAGI
FT                   TVFSGAMIALLVFLMSLPDPDWVVLGVVILLGLAFVWWEGQVSQPFIDLRLLGTNRPLI
FT                   LTYVRFALAMLCVYTVMYGVTQWLEIDKNISSADAGFIILPMSLISIVLAWLVSRLNLV
FT                   RTPLIVSAVACLAGSAGVFLFTTATPILWIVIITAIFGITMGMCASANQTTFYTQVTAD
FT                   QIGTASGLFRTFGYFGSVASSALIAIFFNPDVSDQSLHSIAAVLVILSVVGLLIVIADR
FT                   KIMALAKV"
FT   gene            377834..378301
FT                   /locus_tag="Mboo_0389"
FT   CDS_pept        377834..378301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0389"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: fnu:FN0681
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54909"
FT                   /db_xref="GOA:A7I598"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I598"
FT                   /protein_id="ABS54909.1"
FT                   /translation="MSELVLCTAMELRDLFARFIERYKHVTIEADKIEEEKIGFCDLTL
FT                   NQFYYLRGIQHNDSITLTELAHKLGVSKPSANAAITKLMKDGFVVRTRSDVDQRKFLLT
FT                   LSEKGCQVFKHKRRVFEAFIEQIEKNTTENQQKTLIKAFRIMIECSSEEKE"
FT   gene            378453..379289
FT                   /locus_tag="Mboo_0390"
FT   CDS_pept        378453..379289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0390"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein; KEGG: mba:Mbar_A3287
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54910"
FT                   /db_xref="GOA:A7I599"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A7I599"
FT                   /protein_id="ABS54910.1"
FT                   /translation="MIGITVDRDLCTRCGICSEVCTTQIIARAQNDTALPEIPFSKEAG
FT                   CLSCGHCEVFCPTGALTREHKEGVHLRHAAAPGSINPETLGTYLKSRRSIRLYRPDPVA
FT                   NETLMQILGIARYAATGSNYQPVEWVIVNDAEKVHTIAALTMDYLQESGKSDHPISGYI
FT                   PLLTDYWNKGIDIVCRGAPVLIGAHVPTGTADSTGLVETDAIIALTHVDITAPAFGLGT
FT                   CWAGRLVSVAQNYRPVKEALHIPDNRKLAGAMLAGYPKYKPVRIPERSKPLKVTWI"
FT   gene            complement(379418..380254)
FT                   /locus_tag="Mboo_0391"
FT   CDS_pept        complement(379418..380254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0391"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: pen:PSEEN2920
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54911"
FT                   /db_xref="GOA:A7I5A0"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A0"
FT                   /protein_id="ABS54911.1"
FT                   /translation="MKTKISDNNLRGRDLGQGLVRKESLTDSVDDMTKRMLVDAGIGPG
FT                   MHVLDVGCGSGDVSHLLAKLVGKEGHVIGIDRDGPSLEIARDRIRKLDLPNITFIQRDI
FT                   CELSPEPGQFDAAVARRVIMYLPEPVDAIRRISATLRPGGVVAFLEHDNTMVPGRLKPL
FT                   PLQEKVNGWIRKTIEKEGANTHIGFDLPFILESAGLTVEHIRAESIIQTPQTNYPTVAI
FT                   IRAMLPRIIQKGVATEEEIDLETLEQRLIDERTKASSLYVSDMVFTLWARKPGIPE"
FT   gene            380429..380647
FT                   /locus_tag="Mboo_0392"
FT   CDS_pept        380429..380647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54912"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A1"
FT                   /protein_id="ABS54912.1"
FT                   /translation="MQIELRKDLALQPGTFSAVIAPEKMMIDALNSHADLQCFLFLYIG
FT                   GNYSRILAGINRSSKSFEVRRGFTAHR"
FT   gene            380731..381030
FT                   /locus_tag="Mboo_0393"
FT   CDS_pept        380731..381030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54913"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A2"
FT                   /protein_id="ABS54913.1"
FT                   /translation="MIFIMPRGRPKGSKNLSPYEQIKARKIRDNLAKGGITDFDNLRDA
FT                   QILHSIYVNTDGEVFVKYEISRHPRIKNSEKKNDKGEKLIRKMEKDLSALRETL"
FT   gene            complement(381429..382559)
FT                   /locus_tag="Mboo_0394"
FT   CDS_pept        complement(381429..382559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0394"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bcl:ABC0388
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54914"
FT                   /db_xref="GOA:A7I5A3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A3"
FT                   /protein_id="ABS54914.1"
FT                   /translation="MIYPRRKAEGNRSGADAGSGPDTGPANRIFFIDNLKILLATLVVL
FT                   HHAAQPYGPGGWWIIPQEPSGFVDFVVLGIFMTVNASFFMGLFFMLSAYFIPASLQKKG
FT                   AVLFMKDRLVKLGVPILVFMFIVFPVMGILLLGYPLFSPGHLWFVALLLVFSAAYVAYW
FT                   LVKKPSLTELRDFPGTKAVLAFTGAMALLSFVVRIWWPENSWVAFNLFEPYHIVQYVML
FT                   FIAGIVAYREGWIGAIPAYTGKLWSVMAVIMVGLFPLVYFVTNGAMFSGGLTVTSLIGS
FT                   FWEAFMCVSMCIALLALFKKRFNKGSPLTKALSENTYTVYLIQLPVVVFLQYLLIGVAM
FT                   DSLIKFALVGSIGVLLSFALSHFVIRRLPYAKYVLG"
FT   gene            complement(382556..383128)
FT                   /locus_tag="Mboo_0395"
FT   CDS_pept        complement(382556..383128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA2585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54915"
FT                   /db_xref="GOA:A7I5A4"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A4"
FT                   /protein_id="ABS54915.1"
FT                   /translation="MKNGGVLLGFLPLVIYGVIAGIAGTSVSGVMIALIAAIAAFLIVG
FT                   RSDLRKGMMMAWVNVAIFSVSLIAIGVFGIAWLIPYMGILIYTTLAVFTVGSILIGRPF
FT                   TLQYAREMVDRTLWEKPRFIRANVLITGVWGGVFLVNLGFCGIAFLTPTLIGRIAQVST
FT                   YIFLAAAALFTFWYPEHVRKKIPVMVQ"
FT   gene            complement(383125..383622)
FT                   /locus_tag="Mboo_0396"
FT   CDS_pept        complement(383125..383622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0396"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mma:MM1903
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54916"
FT                   /db_xref="GOA:A7I5A5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A5"
FT                   /protein_id="ABS54916.1"
FT                   /translation="MSTKPHDAHRDPQISKLFQQWNRITNKILRSESAPQDFGTGGLLF
FT                   SSEIHTVCAIGNNPGINITDLSAQLGVTKGAISKLAKKMEEKDLIERYHKPGNDKEILL
FT                   SLTPKGKKVHIGHREYHAKEFERLSVEIEKLTEEQVRFLFEVFGFIEEMIDSTLPNREG
FT                   TS"
FT   gene            383930..384169
FT                   /locus_tag="Mboo_0397"
FT   CDS_pept        383930..384169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54917"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A6"
FT                   /protein_id="ABS54917.1"
FT                   /translation="MGSTKNPFEMRSGQEMAFMRSVKIVRLQKYGRSGLILESGETEPD
FT                   TGSDGIQKGSSGLNPGPDLGRWYEGYTAVEEGGA"
FT   gene            complement(384225..384554)
FT                   /locus_tag="Mboo_0398"
FT   CDS_pept        complement(384225..384554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54918"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A7"
FT                   /protein_id="ABS54918.1"
FT                   /translation="MRAAVFFADDRIKESFLALAASTAEDAEIYRCLNEAFDALALNAF
FT                   CGIQIPKRLIPKSYITKYGIDNLWKYNFHKNWRLMYSVAGDGKTVVALILEWLPHKEYE
FT                   RRFGY"
FT   gene            complement(384551..384826)
FT                   /locus_tag="Mboo_0399"
FT   CDS_pept        complement(384551..384826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54919"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A8"
FT                   /protein_id="ABS54919.1"
FT                   /translation="MMISGTKTAHSPQLDTVLMVESFIQEHSGEYKKRALWENLPRKMM
FT                   YQTFSTIIGYLTDSGKIAADKEGKICWIYNPELIKRLLDNSDLKIR"
FT   gene            385029..385253
FT                   /locus_tag="Mboo_0400"
FT   CDS_pept        385029..385253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0400"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   mhu:Mhun_2778 protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54920"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5A9"
FT                   /protein_id="ABS54920.1"
FT                   /translation="MQKKYQVVIEPGEDGWLVVTVPALPGCITQGKTISESEANAREAI
FT                   EGYLESLIKHQRKVPDQRRVRIREIAGEV"
FT   gene            385586..387079
FT                   /locus_tag="Mboo_0401"
FT   CDS_pept        385586..387079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_2450 APHP"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54921"
FT                   /db_xref="GOA:A7I5B0"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B0"
FT                   /protein_id="ABS54921.1"
FT                   /translation="MNLRAFFVAALIVVVLLSIVAGPVAGSYTTHVVTPGEFTNVTFQE
FT                   FMNGSSVVQDPVPLDNYDTIVFNPGYYALNNIIIMKDNLIFQSNSTSGTTQNTIIDGLG
FT                   GNYGMFWNISSSGPTNLTFKHLTLRNGYSTQSNIGGALGTYSSITIVSSDFINDTTDNS
FT                   RKGGAVEIHTDGQNLTVTGSNFTACHSSQGGALSGDESAFVIVNSSSFTNCSASGSGGA
FT                   VYATQGGVMNFCRFGNVTSGDGSIIDGGSSGHANELDLNENWWGTNNPDFLTLTQGHSI
FT                   PSAYLVLGITATPTGITTAQTSSLRANLSYDSTGAIAANNILPDGIPVIFTLLSGPAGS
FT                   ALSSGQVLTSGHAAATTFSSPAAGTAQVNASVDGFNVSVNVSVTAASSSGGGGGGGGRT
FT                   DYWVKTGTNDVGYVGTQPTPLGFGPSLTQTIPPTPVPPTMTPAVIPTTPVPVPTLPDQI
FT                   RALLQAYFAWIVLVVILIVIAIVMRRWWIRRQNPALFRK"
FT   sig_peptide     385586..385666
FT                   /locus_tag="Mboo_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.529 at
FT                   residue 27"
FT   gene            387729..390029
FT                   /locus_tag="Mboo_0402"
FT   CDS_pept        387729..390029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0402"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1846 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54922"
FT                   /db_xref="GOA:A7I5B1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B1"
FT                   /protein_id="ABS54922.1"
FT                   /translation="MYRILYVDDEPGLLEIGKLFLDSTGEFDVSTLTSAEKALESPEIL
FT                   LFDAIISDYQMPGMDGISFLKNIRKRTKDVPFVLFTGRGREEVVIEAINSGADFYLQKG
FT                   GQPTAQFAELAHKIRIAIERRRAIDSVKDSEQRLTDIIDFLPDATFAIDTTGRVIAWNR
FT                   AMEQMTGTPAEDIRGKGNYEDGMAFYGERRPMLADLLLNPDFSFEEKTYTNVRRAGTGI
FT                   TAEGPVQIRGNSLRYLWGIAGRLFDKEGKCTGSIESIRDITERKEAEKELQAAYEQIAA
FT                   AEEELRGQYEELAAGDLKLKEREAQLWAIFKEAPHAIAISDSATGKYLSVNTLFEQGSG
FT                   LAASEILGKTSAEIGFVPPEEHELLLKEFIREGGIRQKPLTAKMWDGRKADILFTAVPI
FT                   VLSTRTIVLTMVVDITDMKRIEDALRKQEQILNDAFASIKDGISLLDKTMTVIRVNKTM
FT                   EEWYSHEMPLIGRKCWEVYHGRAGPCDICPTLHTLKEGKPAKERVPLVDAGEVTGWLDL
FT                   YSYPVIDSATGEMTGVIEYVRNVTEETKAQRDLELANKKLNLLSSTTRHDILNTLTGLQ
FT                   GLVDKAASLSTSGECTHLLSQIRDRAGIIRQQIDFTGRYQEVGVHAPLWQDVNVLLSRI
FT                   LPATPRTKAGIVNDCDNVEIFSDPLLEKVLYNLVNNALKYGGPDLTTVHITSDLSAPEL
FT                   IIAVADDGVGIAAGDKDHLFQREVGQKTGSGLFLAREILSITGITIRETGTPGKGARFE
FT                   ILVPPEAWRKKRQ"
FT   gene            complement(390365..390613)
FT                   /locus_tag="Mboo_0403"
FT   CDS_pept        complement(390365..390613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54923"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B2"
FT                   /protein_id="ABS54923.1"
FT                   /translation="MVTVAYHPHFEKTIRKISDARVREHVKQQIIKVIENPSTGKPMRY
FT                   CRKQTREVYIPPFRLSYWYDKRQDTIVFLALYHKDEQ"
FT   gene            complement(390607..390873)
FT                   /locus_tag="Mboo_0404"
FT   CDS_pept        complement(390607..390873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0404"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54924"
FT                   /db_xref="GOA:A7I5B3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B3"
FT                   /protein_id="ABS54924.1"
FT                   /translation="MDVAITKMSSKGQIVIPASMRTDLPEGEKILIIREGERIILKPLT
FT                   EIEPALREDILFAEKTETAFGEYAKGNFTKKKAGDFIKEMDSW"
FT   gene            complement(391228..391965)
FT                   /locus_tag="Mboo_0405"
FT   CDS_pept        complement(391228..391965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0405"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP3577 FabG3_2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54925"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B4"
FT                   /protein_id="ABS54925.1"
FT                   /translation="MGRLDGKVAFISGGANSLGAANASLFAAEGARVIIADVLETEGKN
FT                   LAKSLGPRGTFVFLDVTDPSGWIRAAEIAENAYGPVNILVNNAGRVNHVPFDECTNQQF
FT                   GEIIEANLYGTFYGIKTIIPSMQKAGSGTIINISSVSGLRGYPMMPGCVTAHWGVRGLT
FT                   KSAALDLARYHIRVNSVHSGEVLTPATKSGDIETGHVAMNRPATPDEIARVVVFLATDE
FT                   SSFITGAEIAVDGGESAGLANCR"
FT   sig_peptide     complement(391882..391965)
FT                   /locus_tag="Mboo_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.836 at
FT                   residue 28"
FT   gene            complement(392009..392782)
FT                   /locus_tag="Mboo_0406"
FT   CDS_pept        complement(392009..392782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54926"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B5"
FT                   /protein_id="ABS54926.1"
FT                   /translation="MTNTNFREIGSKLAAAFCLSTRPLAVYGSETLPAGISPMAGINRC
FT                   FAVSLYRIATGREIPGSYIGAGATEGCCMGGLFHTGYITVPEDIKYFVSTGRKDVRGGA
FT                   AEYLKASPDLVDRCSAAAGPIHPPGKYLVVQACEALPDPLPNVLSLCIFGNGEQIRNMA
FT                   ALIHFDRDDPFSPVIVPWGSSCSTFITFPAGLAEKTPKNTAFMGPQDPTQNHSLPPEMM
FT                   ALGIPAEMAVRMAKNLDASFITRRPYVAFPRHAAK"
FT   sig_peptide     complement(392696..392782)
FT                   /locus_tag="Mboo_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.921 at
FT                   residue 29"
FT   gene            complement(392779..393618)
FT                   /locus_tag="Mboo_0407"
FT   CDS_pept        complement(392779..393618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54927"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B6"
FT                   /protein_id="ABS54927.1"
FT                   /translation="MESIIAQKAGLINEPMAILWSNTKPEGALQMKPNTFTCVLPFIAQ
FT                   VAIKGKTVVFDRETYGCPGARAGLGFGNGFYDAFGGAGIDFMSAFFAKGIESSKDPDAY
FT                   KAILKYIPEREQSKFIHGERIHKNQEKAKQYMINFPVTDIAEKYVIFTPLGKVKPAEKP
FT                   VAVIFLADPIQLSGLLCLLGAIRDELDPVWVPAQMAACQQIAAAVYFEAKKEHPRAVLG
FT                   YTDIAARENVGKTIPKQMFTFGVPYSLFLEMEEEAKDGVFDGPIWNGLAAEQKGTPA"
FT   gene            complement(393637..394314)
FT                   /locus_tag="Mboo_0408"
FT   CDS_pept        complement(393637..394314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0408"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: mba:Mbar_A3305
FT                   iron-sulfur flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54928"
FT                   /db_xref="GOA:A7I5B7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B7"
FT                   /protein_id="ABS54928.1"
FT                   /translation="MKVIKVIGINASPRGKDSNTLRLTRAVLAGAKEGGAETELVDLYS
FT                   LNIRYCTACGTCYTTGECTMLDDFSDIFDRMMNVDGIVLGAPNYIDSVPAPVKALFDRM
FT                   ADAIHCQMFTGKFGCSVCTAGGSGENEVIGYMNKTLSTLGANIAGGVGVAIGRDPSALR
FT                   KAEGEAQDLGKTLVRAIRGEVSYPDQDALHKQKREYFCQLVKYNKDRFAHEYEWYEQMG
FT                   WMK"
FT   gene            394415..394876
FT                   /locus_tag="Mboo_0409"
FT   CDS_pept        394415..394876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0409"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mac:MA0176
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54929"
FT                   /db_xref="GOA:A7I5B8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B8"
FT                   /protein_id="ABS54929.1"
FT                   /translation="MSPIENNSVTRWIQDIKIPAPLISYSYRALQKKFAKELAPYHIGW
FT                   GHFVILMSLYDNEGSSQDDLALSRGFDKTMIAKSVVKLEEEDLIRRKTDPSDRRVKRLY
FT                   LTDKSRELIPELEQIGLGINKILFKDLDEKESEVILEHFRKIALNASEM"
FT   gene            395154..395657
FT                   /locus_tag="Mboo_0410"
FT   CDS_pept        395154..395657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54930"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5B9"
FT                   /protein_id="ABS54930.1"
FT                   /translation="MTDFVQTNEIKKSVRTLTTPIQDIATFNSIVESLIASNPLGCVSY
FT                   MSAGVSHPGIEKTKEAYTVRLIYQDNEANIVGNGMHRFESLAGYNNGASALLADTALSA
FT                   AHGGIAAHDIENDTFSATIKCSDPNSEIYGLLLSRDKVTLSSYEDDSILTKVETWTDSV
FT                   PELA"
FT   gene            395740..395910
FT                   /locus_tag="Mboo_0411"
FT   CDS_pept        395740..395910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54931"
FT                   /db_xref="GOA:A7I5C0"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C0"
FT                   /protein_id="ABS54931.1"
FT                   /translation="MDNEFLGIIVGLVLPLYPLLFAIYQKIGRYDEIVEEFKKLRDEHR
FT                   HFRENCHGTEN"
FT   gene            395894..396394
FT                   /locus_tag="Mboo_0412"
FT   CDS_pept        395894..396394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54932"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C1"
FT                   /protein_id="ABS54932.1"
FT                   /translation="MEPKTETTPSDDGIPRPVARVTGLYRGTFAGLVPLTESTPLTQDQ
FT                   VRRYPVFYELDLNHAYANENLIIDLIYDNLSPIRLQDLYRGTDLPRGVRFWPDWFNIPP
FT                   YDEMHDIDGRRVYPRAPGLHTVQIRAACRKLAQIGRSRDFSLENGGSTSPVFTFRIAEE
FT                   TNV"
FT   gene            396387..396971
FT                   /locus_tag="Mboo_0413"
FT   CDS_pept        396387..396971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54933"
FT                   /db_xref="GOA:A7I5C2"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C2"
FT                   /protein_id="ABS54933.1"
FT                   /translation="MFENEVQTRCAICGTGILLGAIFLLAHFPVILLVVPVAVLFLGLV
FT                   ADPGEIHAVWNGMLSAIGIVDLSALTGTERENYAEKRQYFWFGEIAMASILAGVFAVPL
FT                   GIFLAGRAEITLAFIGAAVLFLPLFVFLPKLIRWAMKADVDAAIETFGKNEQVKKVFWT
FT                   MFVSMAGLVLARVLDPETARQGVGVITGMGG"
FT   gene            complement(397000..399187)
FT                   /pseudo
FT                   /locus_tag="Mboo_0414"
FT   gene            399902..400891
FT                   /locus_tag="Mboo_0415"
FT   CDS_pept        399902..400891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54934"
FT                   /db_xref="GOA:A7I5C3"
FT                   /db_xref="InterPro:IPR036719"
FT                   /db_xref="InterPro:IPR036734"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C3"
FT                   /protein_id="ABS54934.1"
FT                   /translation="MRHIPRKIAFLLIIVVLALLFLLPPVFAADIAPSPAVPANTTPAK
FT                   VEVGIFVNSIKNLDFARGTYTMDYYVHFRWTDPAISSSRFEVMNGQPSGANALVENYED
FT                   KSGPEKEEWYRVRSDFTIAPNNRNYPFESGSLPIVIEDSSHDTTDMIYVPLVNESGVDP
FT                   VFELPGWSIGVPGFSVINHSYPWGESFSQLTFNVPVTKNPTDAVVQTLIPPLIFCIVAL
FT                   ISFFLSEEHRELIALRYGLTTSMFISAVMFNFSQLASLPGIGGLTLFEKFMISVYLFLA
FT                   GTIVVTTLCYISLYTWKRPDLARRINWSGLAVSILVPVGVFWLLLAMA"
FT   sig_peptide     399902..399988
FT                   /locus_tag="Mboo_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(400996..401445)
FT                   /locus_tag="Mboo_0416"
FT   CDS_pept        complement(400996..401445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54935"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C4"
FT                   /protein_id="ABS54935.1"
FT                   /translation="MSDTKQADLIKSFVDYLISSQKIEVFNYSIFVNKEKDAFFVNAVP
FT                   HFPLVRLKVDNDKNKKTIEVALKITGSAADPPADLLDRVCTLGVSVTMDKDGKLRVHTD
FT                   LAQDAVFAQLPAPVTDAIRNIYSELEKGNAALQSQLQAWYDEHTR"
FT   gene            complement(401631..402566)
FT                   /locus_tag="Mboo_0417"
FT   CDS_pept        complement(401631..402566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA2648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54936"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C5"
FT                   /protein_id="ABS54936.1"
FT                   /translation="MASPVRIVRVLLYALAITTLVLSAVCISGCVGSSGTSPGETAAGP
FT                   GTAPAWRIDHAVIVVDNLTEARERFAAAGFSVVAGGEHGGNDTENALVPFEDGSYLELF
FT                   APVNPAMATEMKALVASGTFDAAMQQENAMDSRFMRHLADGPGPEDFALSSPGLNLSAA
FT                   QADAGQQGIILAGPIPMSRTRPDGIDVKWHVDVPVSGDTAAVPFLIADDTPRSYRVPGG
FT                   ADAMQPNNVTGIKRIVIRTQDQENVTQWYDTVLPGVPASTNGSATTYMLNGSTIEVRQG
FT                   AAGTQQDGIAEIVLAQGSGGELVLDNSTWE"
FT   sig_peptide     complement(402438..402566)
FT                   /locus_tag="Mboo_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.854) with cleavage site probability 0.250 at
FT                   residue 43"
FT   gene            complement(403052..403795)
FT                   /locus_tag="Mboo_0418"
FT   CDS_pept        complement(403052..403795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54937"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C6"
FT                   /protein_id="ABS54937.1"
FT                   /translation="MVCPTLQPVKKWIAPLLVLVVIAAVMCGCTQNSSPGSSPAAQPTA
FT                   AITTPEPAVPQVTTPEIAPPTAPESLNAQDTENESDEDTAGPAISAAGLPATITGLAGS
FT                   AGGPVDNCVMTHTLPDILTDPDYGLNSAATSELAGFSPGQYATIRREYSETSSTIDYCG
FT                   EGAVKTPIWTWYTISATITPNGHTLQTYNITLYADYLSTRITVVSTTGTLSPGLDYPYR
FT                   AYVPMRLDDLEKNVHFELDALPQTS"
FT   sig_peptide     complement(403697..403795)
FT                   /locus_tag="Mboo_0418"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.418 at
FT                   residue 33"
FT   gene            complement(403846..404748)
FT                   /locus_tag="Mboo_0419"
FT   CDS_pept        complement(403846..404748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54938"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C7"
FT                   /protein_id="ABS54938.1"
FT                   /translation="MKPGFLVIGGVLLFLLMVSGPAAALDPSGPAPVMNATPPSPAGAS
FT                   LPDTGANSSGELLVVTATPVPTQTVKPAPTPLVISFKWTAADSTPAAGVSNDDDEPDDS
FT                   VNPGGAQPWYAAAASLFANITGSDEPEPDTSPSGFGSIASQWASTATANAGIPNCAMMS
FT                   RLREGLNESDVERYNSTANDLLHPAHAFLKGFTPGQFAAMQRTYAEDQGFIDTCYDLNP
FT                   TPYWEIFTVNGKIMTMNVRPANFTSTLYVYSNGAKIPAINATDVYYPNRLYTYVVYVPV
FT                   RSSQASMIDAMDLEFVRAS"
FT   sig_peptide     complement(404674..404748)
FT                   /locus_tag="Mboo_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   gene            405021..405956
FT                   /locus_tag="Mboo_0420"
FT   CDS_pept        405021..405956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0420"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthases; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: mba:Mbar_A2422 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54939"
FT                   /db_xref="GOA:A7I5C8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C8"
FT                   /protein_id="ABS54939.1"
FT                   /translation="MVKIYDNITQTIGNTPLVRLNRIAPKSGATILAKIESFNPMSSVK
FT                   DRIGVAMIDAAEKAGLIKKDTIILEPTSGNTGVALAFVSAARGYRFTLVMPETMSIERR
FT                   KLAKAFGAELVLTPGAEGMKGAVAKAEQLAAENPNYFYIPQQFKNLANPEIHRKTTAQE
FT                   IWRDTGGNVDILIAGVGTGGTITGISEVIKKKKPSFCAIAVEPEASPVLSGGKPGPHRI
FT                   QGIGAGFVPDVLKRELVDEIIQVKNEDAFETTRNLAKQEGILAGISSGAALYAALTVAK
FT                   RKENKGKTIVVILPDTGERYLSIPDLFAAE"
FT   gene            complement(405982..406338)
FT                   /locus_tag="Mboo_0421"
FT   CDS_pept        complement(405982..406338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0421"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_0875 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54940"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5C9"
FT                   /protein_id="ABS54940.1"
FT                   /translation="MPDSYAENTLRFYAEKCINCRRCTEVCPHGVFAEGEKTAVLGNPR
FT                   ACMECGACAKNCPVQAISVQSGVGCASAMIRAALKGKDMDGAECSCGGPGASSCCGGEA
FT                   CEEGCRTDSQEKAV"
FT   gene            complement(406331..407368)
FT                   /locus_tag="Mboo_0422"
FT   CDS_pept        complement(406331..407368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54941"
FT                   /db_xref="GOA:A7I5D0"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D0"
FT                   /protein_id="ABS54941.1"
FT                   /translation="MAKGHCSCDCSPQVPGGVQEFLYASPAITFADRWDHFKARWGVHR
FT                   MGHIVQPGLYKLGLATPESPVIVTANYTLSFDAVRSALGRTDAWILVLDTKGVNVWCAA
FT                   GKGTFGTGELIRRIALTGLASVVSHRTLVLPQLGAPGVSAHDVQKFTGFHVEYGPVRAR
FT                   DLPEYLRTRMATPAMRRVEFTLRDRLVLTPVEFVFAALPMVIAALVLFFLAGPIAALAA
FT                   VAAVLAGTVLFPALLPWIPAKDFSTKGFLLGFVVALPFAAFFSSRVPATDGLPVIAGLI
FT                   PLFLFSAIVGYLALNFTGSTTFTSRTGVKKEIFRYVPVMALLAGLGIACWAVAGLLLYL
FT                   GAGHA"
FT   gene            407450..407836
FT                   /locus_tag="Mboo_0423"
FT   CDS_pept        407450..407836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0423"
FT                   /product="regulatory protein, ArsR"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: mbu:Mbur_2405
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54942"
FT                   /db_xref="GOA:A7I5D1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D1"
FT                   /protein_id="ABS54942.1"
FT                   /translation="MIKRAGGCSRRTGPGNDRELREIPEPVREELDRLGGPAALKKKIP
FT                   AQKELDKQSALHHALADPIRLTILYLVRDQPLCVCVIIWYLKISGPKLSYHLNILKECG
FT                   LIEGVPHGNWIIYSLTGAGRECIR"
FT   gene            408342..409283
FT                   /locus_tag="Mboo_0424"
FT   CDS_pept        408342..409283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rno:689164 similar to CG32133-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54943"
FT                   /db_xref="GOA:A7I5D2"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D2"
FT                   /protein_id="ABS54943.1"
FT                   /translation="MQPDGMSGTILQTDLRNMPMHFDIIIMHSLIGFIMEESMHIASGH
FT                   EASMHFVFMQMLSMHFAIIIMQVLMDFIMAASMDFASMHLGIIIMQSHMDFIMGAIICI
FT                   MPMVAISMNWFMHVDIIIMQSHMDFIMEESMLFGSMHSDIIIMQSHMDFIMAEFMHFAS
FT                   MHVDIIIMQSSMDFPMVLSIAGIAFMQAVIMDMQLFMDFAIAGFIGMVMGAMVMHWDMQ
FT                   RYIMVMQPFMDFCMALSIGMGFVECEVMHWDTHCDMMAWRSHIAFSMRMSMQFIIIDPS
FT                   QQLFSILDAFIIDFMLFSTWRDFLSILEVNDT"
FT   gene            409412..409660
FT                   /locus_tag="Mboo_0425"
FT   CDS_pept        409412..409660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54944"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D3"
FT                   /protein_id="ABS54944.1"
FT                   /translation="MPCALILPKKAGKHESGNAVLIPFHFPNARIPKTRPGRIVSAGTV
FT                   HCRPLLVLPGILLKKRIVVLCTDEGYPGDCTPGRMCV"
FT   gene            complement(410175..410945)
FT                   /locus_tag="Mboo_0426"
FT   CDS_pept        complement(410175..410945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0426"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mhu:Mhun_0223
FT                   ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54945"
FT                   /db_xref="GOA:A7I5D4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D4"
FT                   /protein_id="ABS54945.1"
FT                   /translation="MNDLLGIYALWYREYKVFLRERSRLVASVVNPVLWLLIIGGGFGS
FT                   VVSFGNVSFLTFLFPGILVQLSLFSAIFFGVYIVWDKKIDFLKEVLVSPLSRTSIFIGK
FT                   VLGGSTDTLIQLAILLVLGYIFSLTGIMETLPLSVNAIVLVLAFLFVITAGFASVGLIL
FT                   GSQMESPEGFQLISSFLVTPMFFLSGALFPIDNLPGWLMPFVLLNPATYAVDGIRGVLV
FT                   GLHQFSIGFDFLVVCLFSGVMILAGTYAFEKMRL"
FT   gene            complement(410942..411910)
FT                   /locus_tag="Mboo_0427"
FT   CDS_pept        complement(410942..411910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0427"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mbu:Mbur_0389 daunorubicin resistance ABC
FT                   transporter, ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54946"
FT                   /db_xref="GOA:A7I5D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D5"
FT                   /protein_id="ABS54946.1"
FT                   /translation="MPAVSIQNLTKTYGTLLAVDNLSLEIEEGEVFGLLGPNGAGKTTT
FT                   LMMLVTLIPPTSGSASVNGFDIVTRAEQVRKSIGVVFQDPSSDETLTGYENLNLHGMLY
FT                   GMPAVLREQRIEEVLALVGLTQRKDDVMKKYSGGMRRRLELARGLMHHPTILFLDEPTL
FT                   GLDPQARERIWEYVKNLAEKKNITIILTTHYMEEADRLCNRIAIIDRGKVAALGSPARL
FT                   KQEIGGDRVFLEGARGDGKDLLDLEFVRRAEPVSGGISLVVEDARRHLQEILSRSGPVE
FT                   SVDIRPVTLEDVFLHHTGREMREGSPDGNWADKAIQAGLRR"
FT   gene            412108..412800
FT                   /locus_tag="Mboo_0428"
FT   CDS_pept        412108..412800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0428"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   deh:cbdb_B17 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54947"
FT                   /db_xref="GOA:A7I5D6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D6"
FT                   /protein_id="ABS54947.1"
FT                   /translation="MNIRSVAILAGILVIIAAVAFVIFFLPGITTPPGAGGVTSLPSAE
FT                   VRSYQGTDLSAIANVPENAISGTQYINTSDYRLTVDGLVRNNTSSTYQEVLDNHPHYAK
FT                   VVTLDCVEGWSATILWGGVRVSDLIKDAGPDPRANTVIFHATDGYTTSFPLSYVTDNNI
FT                   LLADTMNNLTLDPAHGYPFRLVAEDKWGYKWIKWVDEIELSDNPNYEGYWEQRGYSNNG
FT                   DLNMSKYA"
FT   sig_peptide     412108..412170
FT                   /locus_tag="Mboo_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.415 at
FT                   residue 21"
FT   gene            412868..413971
FT                   /locus_tag="Mboo_0429"
FT   CDS_pept        412868..413971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0429"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; KEGG:
FT                   mma:MM1795 iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54948"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D7"
FT                   /protein_id="ABS54948.1"
FT                   /translation="MKPVFAHGTGAPGNEASLEPIIRKTFLWAADNCSWLRKDDLVLIK
FT                   PALNSPDPYPATTHPLAVRAVAGLLLERGARVMIGDQSGIEHVLHHKNGIIRGSSRANY
FT                   TCSGMGGLADPFVAFEDAGWDNGFFRYRSPRTASWKSGFFITKQVQEADHIVCLPRVST
FT                   HSQAGATLGLKCMVGLLREDSRMEFHANGPFNEFIKNAAKGSTLASRDDGSGKFLEKIV
FT                   EISDAVKDKLRGTLFVATKLQATFGPDCSAMRMGPFRLGKAYVVSPDPGLVFAGSDPVA
FT                   VEAFALAFLKHHKAGVPFLPAAAEKMLLSGNQNVSTLREVPVWYHPCIRHAVKIGLGRL
FT                   PEQILWTDVPDSLQESLNNLLFPGTTE"
FT   gene            414069..414956
FT                   /locus_tag="Mboo_0430"
FT   CDS_pept        414069..414956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0430"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: gme:Gmet_0807 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54949"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D8"
FT                   /protein_id="ABS54949.1"
FT                   /translation="MESTVSPEPLKPQKDPGPAIEEIIREFCRSSPENDLLFSASEPMF
FT                   DEPLVGFSSAADPLYAFFKKDIGDPYTTPIDHFRAAFLDRTITAEDLSVIAWVLPLTRQ
FT                   TKNDNRKETAQPSERWARTRLFGEKFNVALANYVAGILNAQGTDALVPSLSPAARAGIS
FT                   QKYGMATSWSERHAAFVSGLGTFGLCDGLITKKGKAMRCGSVIARIAVPPTPRPYAGHH
FT                   DWCLFYAKGTCKACIQRCPAGALSKQGHDKNRCREYLFGVTKPYILEKYNIDIYGCGLC
FT                   QTKVPCESKNPVKK"
FT   gene            415012..415650
FT                   /locus_tag="Mboo_0431"
FT   CDS_pept        415012..415650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA1947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54950"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5D9"
FT                   /protein_id="ABS54950.1"
FT                   /translation="MKNAQDKPADYAFLEKAARNIGAADAKIIAASDIVVENRVSLKCR
FT                   AGCISYGKKLTCPPYVPTPDEFRKILLEYHSALLVKFISPAEAEPDVICSIYKYWLDPA
FT                   APADKKEQAEKFWADHRTGTGSFAPAMLELERIAFNAGNPFALAFVNGSCRLCETCNTK
FT                   GGICIHPTRARIPEHAVGVNMVATAEKAGMPIRFPVEGHPELMALLLID"
FT   gene            complement(415625..416074)
FT                   /locus_tag="Mboo_0432"
FT   CDS_pept        complement(415625..416074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0432"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   lca:LSEI_2161 diadenosine tetraphosphate (Ap4A) hydrolase
FT                   related HIT family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54951"
FT                   /db_xref="GOA:A7I5E0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E0"
FT                   /protein_id="ABS54951.1"
FT                   /translation="MKLAQCPFCNPLAEEIVARNDLCYARWDRFPASKGHLLVLPFRHT
FT                   PYFFSMTKEERREMIALIEACKQVIEENFVPDGYTIGINEGLAAGQVILHCHCHCHLIP
FT                   RYIGDVPDPAGGVRKALAGTKNPQRAPAVTLLPGSTPFNRSAGAP"
FT   gene            complement(416183..416434)
FT                   /locus_tag="Mboo_0433"
FT   CDS_pept        complement(416183..416434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54952"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E1"
FT                   /protein_id="ABS54952.1"
FT                   /translation="MGRSFLSVRQGANLISARWMQWARKLRPEDRKYGERLAILAKMHS
FT                   SEAFAGCDDALEAVVFSVMVEVIREQERAGEEKKDPAH"
FT   gene            complement(416771..417748)
FT                   /locus_tag="Mboo_0434"
FT   CDS_pept        complement(416771..417748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0434"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; protein
FT                   kinase; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: lbu:LBUL_1306 serine/threonine
FT                   protein kinase with beta-lactam (PASTA) domains"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54953"
FT                   /db_xref="GOA:A7I5E2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E2"
FT                   /protein_id="ABS54953.1"
FT                   /translation="MLKEGDRIGDYTIIGLLGQGGFSQIYKALAPDKSQVILKFPDVSL
FT                   LGDQATYERFRREVAIGQKLSHPAIPKVISFVEGADSIYLVMEYIEGPSLRNYLNEKAP
FT                   LPIDEGLSFAGQLAEATDYLHAHGVCHRDLKPENIIVGPDGRIHILDFGSALLEGSRRV
FT                   TWRWASNAFGTPDYMAPEQIQGKRGDERTDVYALGMIVYEMLAGALPFEGDNPLAVMNL
FT                   HLTGTPVPPRRFRPEIPAGVEAVILKALRRDPDERYRSAGAMKKDLDHYAELDLSEFPS
FT                   DPEAAVGGGMLTNRQIWVRTILVFVGFLVIAALVVLAAYLMHKH"
FT   gene            complement(417835..418173)
FT                   /locus_tag="Mboo_0435"
FT   CDS_pept        complement(417835..418173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0435"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mtp:Mthe_0085 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54954"
FT                   /db_xref="GOA:A7I5E3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E3"
FT                   /protein_id="ABS54954.1"
FT                   /translation="MVFMKMVQAIIRSEKLDSVKKALEEKGFVAMSIIEITGRGEQKGI
FT                   TLEYRGATVEVDTLPKIMIQMAVKDEDVDPVMAIIRSAGRTGNFGDGKIFVWPLDLMAK
FT                   VRTDEVWR"
FT   gene            complement(418379..418819)
FT                   /locus_tag="Mboo_0436"
FT   CDS_pept        complement(418379..418819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0436"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mac:MA1211 P-II family nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54955"
FT                   /db_xref="GOA:A7I5E4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E4"
FT                   /protein_id="ABS54955.1"
FT                   /translation="MKKIIAIIRSENVEETKAALKGLGINGATFLHVTGRGMPEGLSPA
FT                   RSLSEERPAAFRAPDERQDGLPVPKGATLPASPPKTKPGPAGFLPQRMLIIVAHDADVR
FT                   PIINTLVAANQTGRHGDGKIFVCPMISAIRVRNGEQGDSALA"
FT   gene            complement(418816..419196)
FT                   /locus_tag="Mboo_0437"
FT   CDS_pept        complement(418816..419196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0437"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mth:MTH1561 nitrogen fixation nifhd region glnb-like
FT                   protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54956"
FT                   /db_xref="GOA:A7I5E5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E5"
FT                   /protein_id="ABS54956.1"
FT                   /translation="MKMIWAIIRPEYSQRVIDALEKTGISAMTRMNVTGHGAETELMAG
FT                   LVNYSEIPKEMLMIVLPDIDVARAVRIISTVAKTWQKENPGHGAVGDGKIFVTYVDDAH
FT                   TIRTAENKKRSPGLPATTGPPV"
FT   gene            complement(419232..420095)
FT                   /locus_tag="Mboo_0438"
FT   CDS_pept        complement(419232..420095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0438"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   mmc:Mmcs_0019 protein serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54957"
FT                   /db_xref="GOA:A7I5E6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E6"
FT                   /protein_id="ABS54957.1"
FT                   /translation="MGETGTTEPAGKVPNHLVGVIVTWRAITHQGLTRSQNEDAHWVTH
FT                   VVEGTTGTESASRYVFVVADGLGGHRGGAVASRMAIKAIKEEIHSWHGGNAERTIERAI
FT                   QKANQKIFCVAQTDPELFQKMQTTITLVVLENDSLVCGHVGDCRLYRMREGQVNVLSRD
FT                   HTLASDMLQLHLISAEQAAEHPGRHQLTRSVGGDPFLKTDVFRQQAMPGDTYLLCSDGL
FT                   WSELKEEEIRAALEGPDISRECEKLVRFALSGGAPDNITAIMFRIDVVGKQAASPFSWR
FT                   SLLGKG"
FT   gene            complement(420236..421819)
FT                   /locus_tag="Mboo_0439"
FT   CDS_pept        complement(420236..421819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0439"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_4368 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54958"
FT                   /db_xref="GOA:A7I5E7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E7"
FT                   /protein_id="ABS54958.1"
FT                   /translation="MTSSTEANQTAVPKTGTMKRTLNLTSLLVNAMALIAPGAFLWTTF
FT                   QVQAAQTNGGVTTAGEMWTGLLAALVLAFLTAISYAELANIYPKAGSGSSYYYAEASFL
FT                   EKEKAEHRKWARIVKFLVGWISHLYYWIYPGIMVAFSAILIVYIFGLFGINLSIPEQIL
FT                   VAIVFAVLNGYIAYRGITGSTMTAIIINTIQLAALIAFSILALLYRQAHPNLAYAQSVS
FT                   TILIPHNFTNLLFQSTIAILLLVGFESVTSLGSEALRPKQDIKKAILLSLIIQGAFAYL
FT                   FEYFAANYFVGPQLTGTDPTGAAISGYAAAAASGAPIGDMIRVIGDQMLGGTGFALVLI
FT                   MAATVVLALIGTTLACLNTGVRITYAMGKDKEMPTLLGILHGTYDTPHYGIWILVGVSA
FT                   ALGAYGVLNVDNLTQITLASNTGTFLLYGLTNLIALWAFFHRPDANLLKHRIVPLLGFL
FT                   ANFVMLAAIVWLGISAGGSSATDALIAIAMVIVWLVAGVIWFISNTKKQQRPIMTGNLP
FT                   QAKGLEVDDA"
FT   sig_peptide     complement(421670..421819)
FT                   /locus_tag="Mboo_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.990 at
FT                   residue 50"
FT   gene            422169..423113
FT                   /locus_tag="Mboo_0440"
FT   CDS_pept        422169..423113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0440"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: bca:BCE_3529
FT                   bile acid transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54959"
FT                   /db_xref="GOA:A7I5E8"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E8"
FT                   /protein_id="ABS54959.1"
FT                   /translation="MVKILAWIADHLLWLVLIIVAVSLLAPGPGSGLSWAVAPVLALMV
FT                   FLVSLTIGFADLREVARQPLVIAWSLVLQFVLMATFSLLLGKILFAAHPALGDGQLLLG
FT                   ALPADISAPLMVSLVGGNTALGMGMLVSAMVLVPFVLPAALSFFGGITFPVPTGYLEAE
FT                   LFGIIIVPLIAGILLNQYAEGIRRNRDAWPGFAALCYLVLLFVVISSNAGSIISLGSFA
FT                   LVLILAELLLNFFGYGVAYLTKKIFSLSRETFFCLLFIAGTKEFGIAPAAVDSMGLDRA
FT                   LVIPSAFYAVVQMISCPVMVMAKDFLAPEKTPG"
FT   sig_peptide     422169..422279
FT                   /locus_tag="Mboo_0440"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.948 at
FT                   residue 37"
FT   gene            423088..423363
FT                   /locus_tag="Mboo_0441"
FT   CDS_pept        423088..423363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54960"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5E9"
FT                   /protein_id="ABS54960.1"
FT                   /translation="MHRRKPRDNRSVAGKNDQHPDLIRTFFWCHSPVCLSSFACFSFFG
FT                   PGFSSPHPGAPYRILIREDLARVFAARACAGPDRSVVSFFPASSQE"
FT   gene            423512..424033
FT                   /pseudo
FT                   /locus_tag="Mboo_0442"
FT   gene            424148..425902
FT                   /locus_tag="Mboo_0443"
FT   CDS_pept        424148..425902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0443"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: mca:MCA2217 K+-transporting ATPase, A subunit;
FT                   TIGRFAM: potassium-transporting ATPase, A subunit; PFAM: K+
FT                   transporting ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54961"
FT                   /db_xref="GOA:A7I5F0"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5F0"
FT                   /protein_id="ABS54961.1"
FT                   /translation="MSVNDWAFLVLIGVILALLLIPTGEFMFRVYTGKKTFLSPLFVPV
FT                   EAWILKACGAGSDEEMDWKSFAVAMMIFSVIGIVFVFILQEVQQFLPLNPLGATAVPWD
FT                   LSLNTAVSFATNTNWQFYVPETTVSYLTQMIGLTVQNFMSAAVGMVVLVAFIYGFSRRS
FT                   SHTIGNFWVLLLRSIWILLPLSFVIALVLVSQGAPQTLSGPVTVPLLNATNDSGGNIIT
FT                   TQLISLGPAASQIAVKMLGTNGGGFFNANSAHPFENPTWFTDLVEIVAILLIPVSLCFM
FT                   FGKMIGSVKKGIAILIAMMILFVPLLGLGIWSEIGGNPAFTPLGISQAPSHLQSGGNME
FT                   GKEVRFGPVQSAAFSVITTVTSCGAVNSMHDSFMPLGGLVQIFDIQLGEIVFGGVGSGL
FT                   YCMLVFVIIAMFIAGLMVGRTPELYGKKIEPYEMKLSTIHILIPIFLILIGTAIAVSIT
FT                   AGTSMTANPGPHGFSEILYAFSSVSQNNGSAFAGLSSDTFYNLTTAFCMFVGRYAIAII
FT                   TLALAGAFVAKKIVPPGEGTLQDHRPLFIIWVVFTILIIGALSFLPALSLGPVVEFLIQ
FT                   MGRGVIHV"
FT   gene            425895..427997
FT                   /locus_tag="Mboo_0444"
FT   CDS_pept        425895..427997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0444"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   mca:MCA2216 K+-transporting ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54962"
FT                   /db_xref="GOA:A7I5F1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F1"
FT                   /protein_id="ABS54962.1"
FT                   /translation="MSEHLGPRVPASDRYDLYRRAIIDSFVKLDPRTLYHNVVMFTVEI
FT                   GSVITTLLWIQALFGPGEAPASFIGAVSLWLWFTVLFANFAEALAEGRGKAQAEALKKM
FT                   RQDTSGKKLNADYRLEKGKEPGSSDYTTVSSSKLRKNDVFYVKAGDTIPVDGEVIEGIA
FT                   SVNESAITGESAPVIRESGGDRSAVTGGTTILSDWLIVRVSADPGEGFLDHMISLIEGA
FT                   KRQRTPNEIALNILLVGLTAIFVVVSATLYAFSAYSVQSVGAGTTVTITVLVALFVCLA
FT                   PTTIGGLLSAIGIAGMDRLIRRNVITTSGRAIEAAGDVDVLLLDKTGTITLGNRQAVEF
FT                   IPVDDTRVEELAENAQLASLADETPEGRSIVVLAKERYGLRGRSVGETESGVEMEFIPF
FT                   TSQTRMSGVDYNGTRIRKGAADAMYAYIESNGGTVTENLKLAVDMISRAGGTPLVVAKN
FT                   GRALGVIHLKDIVKGGIKERFAQLRKMGIKTVMITGDNKLTAATIAAEAGVDDFLAEAT
FT                   PESKLKLIREYQTGGRMVAMTGDGTNDAPALAQADVAVAMNTGTQPAREAANMVDLDSN
FT                   PTKLIDIVEIGKQLLMTRGALTTFSIANDIAKYFAIIPVAFASTYPALGALNVLGLHDG
FT                   ILSAVIFNAIIIVILIPLALHGVKYRAMSAEESLRNNILIYGVGGLIAPFIGIKLIDML
FT                   LVLLGA"
FT   gene            complement(428635..429135)
FT                   /locus_tag="Mboo_0445"
FT   CDS_pept        complement(428635..429135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54963"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F2"
FT                   /protein_id="ABS54963.1"
FT                   /translation="MKTICTFCSCVVKEGNSTEDPVSHGVCPDCYDRILRTFGFNVKKF
FT                   LDELESPVLLVDADVRVLAANSLALDLVGKPVAAVRGTLCGDVLACINATRPKGCGQTD
FT                   ICPDCTFRESIKETYATGLPVNRRAAILVKKDDDILRNIPFKVSTRKDGNVVMLRLEPV
FT                   QGD"
FT   gene            complement(429194..430180)
FT                   /locus_tag="Mboo_0446"
FT   CDS_pept        complement(429194..430180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0446"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: det:DET0331
FT                   cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54964"
FT                   /db_xref="GOA:A7I5F3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F3"
FT                   /protein_id="ABS54964.1"
FT                   /translation="MNTPPRDQSSVNRTKEKTAQLSVASNTILVILKFAVGFGIGSVSI
FT                   ISEAIHSSMDLIAAVIAFFSVKKSAEPPDHVHEFGHGKFEDASGLIEALLIFIAAILII
FT                   WEALNKLLWNQGESFTPDFLIWGIAVIGISALANWYVSHRLFIVAKESESIALESDAWH
FT                   LRTDVYTSLGVFLGLILIRLTGIAIFDPLFALGVAVIILKAACDLAKRSLGDLMDQSMP
FT                   ESDEKRIREIICGHASTYAGFHDLKTRRSGPEVFIEFHLVMPGNETVTVSHDFTDHLES
FT                   DLKLEYPRSTITIHVEPCSEGKCDRCGSFCTYPGKTGKEKTGEQVQE"
FT   gene            430407..430661
FT                   /locus_tag="Mboo_0447"
FT   CDS_pept        430407..430661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54965"
FT                   /db_xref="GOA:A7I5F4"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F4"
FT                   /protein_id="ABS54965.1"
FT                   /translation="MEGRAIIPITPASLLEYSGAGLGMLGWLGVRQVGSIGAQEIGFII
FT                   WIASGLILIAWGYHTKARAIMAINAVNVIMAASALAALS"
FT   gene            430712..431026
FT                   /locus_tag="Mboo_0448"
FT   CDS_pept        430712..431026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54966"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F5"
FT                   /protein_id="ABS54966.1"
FT                   /translation="MSGERVSFVIRVAPGTREGEWNRDGDPAARSGKEDQAHAHNGENN
FT                   ESDHEDLAVPDELLVLRCFRFGPFEQFCHDRIAHTGPKKEYKKCAAEEIEDVCHKEHWW
FT                   "
FT   gene            complement(431092..432621)
FT                   /locus_tag="Mboo_0449"
FT   CDS_pept        complement(431092..432621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtp:Mthe_1075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54967"
FT                   /db_xref="GOA:A7I5F6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F6"
FT                   /protein_id="ABS54967.1"
FT                   /translation="MDSDRQVLSSEKVHLFFTAIRMAKQKNKKSEKTERSSGGGADFSL
FT                   TALKEKLISYACRYDFLLLGIILYLAYNFCTGFGWISGDVFPASILPIALLKNHNVYFD
FT                   FVASSISNPDISYAFPFVNGHYVSFFPIVTPVLVTPVYAASYILSALAGVTSPNNMYII
FT                   AKCAASFLAALAGVLIYLTGKEIFTRRIALLTTFIFAFATSTWSISSQALWQQGTVELL
FT                   LIALIYLAVKNERQSSAAYIFLMGILSALFVFNRPPESILLIPVLVYIVWYQREKIPWY
FT                   LAGGVLAGLPFLYYNYSIFGNAFGGYAENLALFTVNTGFIGHYLGLLFSPNVGLFVYCP
FT                   VLLLSIAGMYFVWKGRVSPIRTLVLAAVPAILLDILLYSFFGPWSSSAEFCYGLRFLTG
FT                   LVPVLCLFTGFFLDEWFGHGKARHQSQKKPAVIALVAALVIVSVGIQFVGTFFYGWSST
FT                   SNKSMTDERAWNATDSVIIRSYTEGSPRIAGIFWFTLPPVPPLVYFPITGG"
FT   gene            complement(432841..433161)
FT                   /locus_tag="Mboo_0450"
FT   CDS_pept        complement(432841..433161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54968"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F7"
FT                   /protein_id="ABS54968.1"
FT                   /translation="MRNTGILIAGIFLACVVCAGIPAVAAADNPHVIVNTHITEVPQVT
FT                   QQEAATISTPAPWWQTLPQQGAEQLKTWWNTIWQHQQTAATPQVSVTPTPTPAAPPDPQ
FT                   KG"
FT   sig_peptide     complement(433081..433161)
FT                   /locus_tag="Mboo_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.688 at
FT                   residue 27"
FT   gene            433585..434487
FT                   /locus_tag="Mboo_0451"
FT   CDS_pept        433585..434487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54969"
FT                   /db_xref="GOA:A7I5F8"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F8"
FT                   /protein_id="ABS54969.1"
FT                   /translation="MQKKILVIIAVCIAAIAAIAGAALLLGGSSSQPANPVGGPAVAGY
FT                   GDAPAWSSSRADTSLVAYAPVPTAVPTSVGADEQSFDTKIIRTADVTLEVQNVTSAAAT
FT                   VAAIGTGAGGYVSTTNIGTDYSGQPYGSVVIRIPAANFDSTLSGVQALGTVKSISTQGQ
FT                   DVTEEYVDVQAQITAYQNQIAQYNLIMKNATKVEDVLAVQQQIDQVQTSLDRVNGRMKY
FT                   LNSQVDYSTISVSLQEPAPVGGTQGHDFVAAINEGIAGFFAVIDAIIVFVIAVLPLAIV
FT                   GCVAYAGYRFWKGRRPAQP"
FT   sig_peptide     433585..433653
FT                   /locus_tag="Mboo_0451"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.576 at
FT                   residue 23"
FT   gene            434653..434895
FT                   /locus_tag="Mboo_0452"
FT   CDS_pept        434653..434895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0452"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54970"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5F9"
FT                   /protein_id="ABS54970.1"
FT                   /translation="MEIRPSITVGNEVCIDQYLCHRSSHCHTKHQCMDLCLMGVFVLVK
FT                   GDGVYPERSQLCCMCFLCHEFCPVQAITVRWTLRA"
FT   gene            435085..435762
FT                   /locus_tag="Mboo_0453"
FT   CDS_pept        435085..435762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54971"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G0"
FT                   /protein_id="ABS54971.1"
FT                   /translation="MKTRMFVISIICAVLLIALVLPASADDASQVTVTPAATITSAPVP
FT                   GFDPLGSFESILGLRHQDQNLTQDIHANDQQIQSNWWDNLNIFQDILGNRATVRSDQQA
FT                   DLENRSDNIGYREDIHADREDIRNDSGNQTSEEEQIADYRSDIHQDWQGNAATHEEIHD
FT                   ERNASREDWSQINSTRQQDISLRQTNAADREQIQDNRQQIRDDRDNGGSSGGSTGTASS
FT                   GSS"
FT   sig_peptide     435085..435162
FT                   /locus_tag="Mboo_0453"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(436279..436686)
FT                   /locus_tag="Mboo_0454"
FT   CDS_pept        complement(436279..436686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0454"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   mhu:Mhun_0966 hemerythrin-like, metal-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54972"
FT                   /db_xref="GOA:A7I5G1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G1"
FT                   /protein_id="ABS54972.1"
FT                   /translation="MALISWSDELSVRVNEIDDQHKKLISLMNNLHDAMRAKQGKQALE
FT                   ATLQELAAYTVYHFQTEEKYMQKFHYPQFATHKAQHDAFVKKVSDFQKEFEANRLGLSI
FT                   ELMNFLRDWVSNHIKSTDKQYSATFVENGLK"
FT   gene            436752..437642
FT                   /locus_tag="Mboo_0455"
FT   CDS_pept        436752..437642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0455"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: mhu:Mhun_1279 pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54973"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G2"
FT                   /protein_id="ABS54973.1"
FT                   /translation="MFILTVCKGWIMPQVRKISRVFVSRETFEGAGVRLHRAFGYSQIP
FT                   LFDPFLMLDDFRADRPEDYLAGFPWHPHRGIETVTYMLEGKVEHGDSMGHAGSVEAGGV
FT                   QWMTAGSGIVHQEMPKPVHGRMGGFQLWVNLPRSHKMTDPRYQEIGPIDIPRATLDNGA
FT                   EFRVICGTIGGVTGPVRDIIAEPEYLDITLPPGVLFSHAVNPGFAAAAYITGGSGKFDP
FT                   QQNKAMGNRAMVLYDDIGTSVEVRAGKEGVRFLFVSGKPLREPIAWGGPIVMNTEEELQ
FT                   RAFAEYQNGTFIKKR"
FT   gene            complement(437660..438448)
FT                   /locus_tag="Mboo_0456"
FT   CDS_pept        complement(437660..438448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1218 protein of unknown function
FT                   DUF1628"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54974"
FT                   /db_xref="GOA:A7I5G3"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G3"
FT                   /protein_id="ABS54974.1"
FT                   /translation="MPKFCPSCGMPLPDENAQNCLECGAVVRPPVPEKTEIRDPWVAVI
FT                   LSFFCAGWGQWYNGSTLGGLKFFLASLGLGILALALTFTSIVSSPVSGIMGLAFIAVLV
FT                   LLGVWIYGMYDSWTMAEKINRGETGFTGKSGMFWLPVILIILVPVLLFVSAFVATMVFA
FT                   TAGSVQHTKVVAVTAYRPDAGHIVITYQGGQDAASLQSISVTDNGAVAGGITIPAGRGL
FT                   TSLPVGMNTTVPASTQASNHIVVTGLFSDGTSQVILDITL"
FT   gene            438567..439073
FT                   /locus_tag="Mboo_0457"
FT   CDS_pept        438567..439073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0457"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; protein of unknown
FT                   function, ATP binding; Miro domain protein; KEGG:
FT                   mmp:MMP1715 putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54975"
FT                   /db_xref="GOA:A7I5G4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G4"
FT                   /protein_id="ABS54975.1"
FT                   /translation="MMAEEKYKIVVFGAFGAGKSTLIQTLDPQAKHIEAEGAGGTTTIA
FT                   LDYGRVQLGEKRIYLYGTPGQERFEFAREIIGAGMDGAILLVDATSPVDEFVEHLHTSL
FT                   KEEKIPFVVFLNKCNQVGARPDAAQEHFAGAETKTVSAKDRRGAREGLEKFVGRLRPHT
FT                   AEKKA"
FT   gene            complement(439090..439989)
FT                   /locus_tag="Mboo_0458"
FT   CDS_pept        complement(439090..439989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0458"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; KEGG: ttj:TTHA1433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54976"
FT                   /db_xref="GOA:A7I5G5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039967"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G5"
FT                   /protein_id="ABS54976.1"
FT                   /translation="MKKHASDPDLEAHATGIITRHLAHRPKAKKMWALLSKDPEVQTLW
FT                   RMANYVAATKLGMNDHGRIHATVATASALTMLDLLEGSSFTPDIITGGFGTGDDAALVV
FT                   MTAMLCHDLGNTVHREDHADMSVVIVLPILDRILPEIYGDPDQRIAIRSFVLSAIYSHH
FT                   GIPKPLTIEAALVCIADSTDMTKGRGRVAFESGSITIHSVSALSIEKVEIKKGEEKPIA
FT                   LVIHMSSPAGIFQVQEILAPKVRAGPLGDAVEVVAVTTDEAHAAGNAIVSGIRMQGGKF
FT                   VPLKDGAGRSRKSAAHNR"
FT   gene            440121..444026
FT                   /locus_tag="Mboo_0459"
FT   CDS_pept        440121..444026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0459"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1353 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54977"
FT                   /db_xref="GOA:A7I5G6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G6"
FT                   /protein_id="ABS54977.1"
FT                   /translation="MIRVLYVDDEPNLLDIGRLFLEATGEFSLDTAVSAQEGLAALEKK
FT                   PYDAVVSDFQMPGMDGIEFLKMIRSGYGHLPFILFTGRGREEVVIKAIDSGTDFYVQKG
FT                   GDPRAQFAELAHKIRQAVGRRSAEILRIASEKRLADIINFLPDATFAIDPTGTVIAWNR
FT                   AIEELTGIPSSDMVGKGNYEYSLPLYGERRPILIDLIFSPPDEIGKKYAHIVRDGTMLA
FT                   AETELPRVRGKPRILWGKAGPLYDQNGQVTGAIESIRDITDRKKAEQRLAEQYRMLTES
FT                   TSRLRRAEEVARIGHWELHLGTGTMSASENAAAIYGVDTTELPIAYVLEIPLPEYRQAL
FT                   NQALDGLVKRGEPYRIDFRIRRPLDGTFRDIHSVATYDPEKQVVFGIIQDITERKKIET
FT                   DLAATNEQLAAAEEELRGQYDTLVENQKALAASEEQYRAILDNIQDIYYRTDKDGTLIM
FT                   LSPSGALLLGYANTGEMIGRPATDYYADPAQRDLFLTAIKKEGVVTNQEITLKRKDKTP
FT                   VTVSTSSHAYLDAAGRYAGVEGIFRDISDIRKAQRERETAYEQLAAAEEELRGQYEELA
FT                   RSEQQLRDDAENFQNLVTSAPDAIYISIGERFVYVNPAMVRLLGAVSADQLIGMSLYDR
FT                   IAPQYRAGIHERARIVTGEHKPVGLKETVYLKMDGTPVPVESSVALFRYRNQPAGLVIL
FT                   RDITEYKKAERARREQEKKYRVALETTGTGFVILDSAGKVLDANQEYIRLTGHQELGEI
FT                   AGRTVTDWTAGYHKERNAEAVRQCLKDGFVRNIEIDYTGSSGIIIPVEINASVIPSVDG
FT                   IQILALCRDITERRKAESAIRESEKKYRDMFEINNAVMFIVDPVAGRIVDANAAACRYY
FT                   GYSRQEFAGLEITKINVQDTAKTKKDMAHAQVEQGAVFRFRHLKKSGEIRDVEVYSAPV
FT                   TQEGHQYLHSIIQDVTSQRQAEEALRESEEKFRDIFNNTTDAIQLHEILPDGTPGRFTD
FT                   VNDIACRMLGYTRDEILARSPQDITTAEHNPPREKIYEEQRTRGQARFETEFVAKDGTV
FT                   IPVEINTRVVTLQKKKVILAIARDITERKRAEMAIRQANRMLNLLTGITRHDIGNQLTA
FT                   LFQYIDLSKMMEQNPEIKSMIEKEEFIARNIRRQIDFTREYGELGAGNPVWQEVCGCVE
FT                   KGIQGLDLTGKEIETTGLVSFEILADPLLQKVFFNLVDNALRHGGPGLGQIRFSSYETG
FT                   SGLMVVCEDDGTGIPHNQKELIFERGYGKNTGFGLFFIREILAITGITIRETGEPGRGA
FT                   RFEMLVPPGEYRRAGPL"
FT   gene            complement(444076..444549)
FT                   /locus_tag="Mboo_0460"
FT   CDS_pept        complement(444076..444549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0460"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mtp:Mthe_0045 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54978"
FT                   /db_xref="GOA:A7I5G7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G7"
FT                   /protein_id="ABS54978.1"
FT                   /translation="MTSVQAPEKRVRLETNMGTIIIALDPDMPITAGNFETLAKKGYYD
FT                   GVIFHRVIAGFMIQGGDPTGTGRGGPGYVINDEFTAKNRNDRGTLSMANAGPNTGGSQF
FT                   FINLVGNNFLDGKHPVFGKVVEGMDIVDKIGSTKTDAGDRPISPVKILHAVVE"
FT   gene            complement(444606..445211)
FT                   /locus_tag="Mboo_0461"
FT   CDS_pept        complement(444606..445211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0461"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mtp:Mthe_0045 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54979"
FT                   /db_xref="GOA:A7I5G8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G8"
FT                   /protein_id="ABS54979.1"
FT                   /translation="MTAQYLFIVLGILTCALLFSCGCTQPATTPVQTATTAAPESTVSI
FT                   SAPDAWDHVLLETSMGNITIALDPEMPITAGNFERLAKSGFYDGVIFHRVIPGFMIQGG
FT                   DPTGTGEGGPGYTIPDEFTSHNHNLRGTVAMANTGEPNSGGSQFFINLVNNTYLDPNYP
FT                   VFGTVTSGMDVVDAIAQVPTGEKNRPITNVTILHAEMV"
FT   sig_peptide     complement(445110..445211)
FT                   /locus_tag="Mboo_0461"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.776 at
FT                   residue 34"
FT   gene            complement(445268..445945)
FT                   /locus_tag="Mboo_0462"
FT   CDS_pept        complement(445268..445945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2469 histidine kinase, HAMP region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54980"
FT                   /db_xref="GOA:A7I5G9"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5G9"
FT                   /protein_id="ABS54980.1"
FT                   /translation="MAQNCSRTTKCIAAAIVAVVIISALTAFAYYKSNETLKNTAQWGL
FT                   ESTAGVMATQINASEIQDLKPGDENTPQYQAVAAKLRNMRSMDDHLLNAYILKVNTTDM
FT                   STSFLVDDLYPLDPSGSAKIGEVYNPPDKREILEALSGPTASPAPYTDQWGSFVSAYAP
FT                   IDDSALNSNGNTYAVLGLDVSADEYTSVTDQDTWIILSGVISIIVVLGLIFILGRKAAA
FT                   DET"
FT   sig_peptide     complement(445856..445945)
FT                   /locus_tag="Mboo_0462"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.966 at
FT                   residue 30"
FT   gene            complement(445947..447440)
FT                   /locus_tag="Mboo_0463"
FT   CDS_pept        complement(445947..447440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0463"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: mhu:Mhun_3001 PEGA"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54981"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H0"
FT                   /protein_id="ABS54981.1"
FT                   /translation="MKTKEIILILVLTLCLVAVVPVTFGDNTSVTYPLTPVITDVTTEP
FT                   TFMPTVTSPVTEPTTIPTTVETTSMPGQDQGWIDVYCNVDGSQVYFNNILEGTTAGGIL
FT                   SVQVSVSGTPVQTITVTQSGYTTWTGRPSSMPSPGGHVTVYATINPLTTIPTTIPTTVP
FT                   PVSTGAIYAQSNPAGAAIYMNGNFYGYSPLTIPNLGPGTYSMKATLSGYTPDTTLVNVY
FT                   AGQTAPYYPTLQQSPQPRPTGSVSVTSTPNHAAVYIDGSYYGVTPLTVTLYPGTHQFVL
FT                   KYSGYNDYTTNVVVYAGQTQALPVSMSTATQGTVVITSIPGATVYIDSNAVGTISSSGS
FT                   LTLAGINMGNHIFKVTATGYNTWLNTVYIQANTVNTISAPLTPQGVSPTPVQPTGSLAI
FT                   SSSPSGAETYVDNLYRGTTPLTVTDLASGDHLVRLSESGYVDYTTTTTVTAGQLMPLAL
FT                   TLTAAPTPTPTPVPAPGSAQVLCILATLAGICGYMRRRC"
FT   sig_peptide     complement(447363..447440)
FT                   /locus_tag="Mboo_0463"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            complement(447592..448767)
FT                   /locus_tag="Mboo_0464"
FT   CDS_pept        complement(447592..448767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0464"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mhu:Mhun_1460 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54982"
FT                   /db_xref="GOA:A7I5H1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H1"
FT                   /protein_id="ABS54982.1"
FT                   /translation="MTFAFARRIQHAPSSFLGELFRVSSDPSIISFAGGLPSSALIDTD
FT                   GLRTAAQDVLTTDPRAALQYSTTDGYRPLREYIAARYGSRLGVPATADEIQITNGSQQC
FT                   LDLFAKIFLDPGDYVGMERPGYLGAIEAFSLYEPAFTAVPLDREGPKPEAFAKMMHDTP
FT                   VKFFYGIPNSQNPSGCTYSPERRKEIAEMIAGTSTVFYEDDAFGELFFDKKSRIPVKKF
FT                   IPENTVIAGSFSKIIAPGMRIGWLYAPQEILSAFNTAKQAADLHSNFLCQQILYRYLST
FT                   NDLDSHIHRIVEVYCRQCRLMCELFDDLMPALAHTTPEGGMFLTATLPHDLDAMDVFYE
FT                   GIRHKVAVLPGMPFFVDGGGTDTIRLNFSNADEEKIAEGMHRLVAVIRELS"
FT   gene            448898..449338
FT                   /locus_tag="Mboo_0465"
FT   CDS_pept        448898..449338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0465"
FT                   /product="C_GCAxxG_C_C family protein"
FT                   /note="TIGRFAM: C_GCAxxG_C_C family protein; KEGG:
FT                   sfu:Sfum_2781 C_GCAxxG_C_C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54983"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H2"
FT                   /protein_id="ABS54983.1"
FT                   /translation="MTLTRADDAAALFTAGYSCSQSVSAAFAEDFGIDRTTALRLSGSF
FT                   GGGMAHTDNSCGAVTGALMVIGMKYGMTDAGNPAGKEKTYAVAQEFIAEFMRRDHAIRC
FT                   TDLLGFNLSDPKQLAIARKNHIFRTKCTQYVRDAAEILEKVL"
FT   sig_peptide     448898..448984
FT                   /locus_tag="Mboo_0465"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.738 at
FT                   residue 29"
FT   gene            449867..450658
FT                   /locus_tag="Mboo_0466"
FT   CDS_pept        449867..450658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54984"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H3"
FT                   /protein_id="ABS54984.1"
FT                   /translation="MNHTRIFLIGSLCMICLVAAIMPVAADPTTGENAWNTNTEHVAAM
FT                   QAFVAYAGAKGQAQMDGAISYIGTISNGAGTTPLTSIESQFEGTVTSVQSMTSGTQIQQ
FT                   AESQLKTDRTDFMSTAKSDLKEYNGTGKAFEQSINASVMAQATTLQGLENTWWTDRQTA
FT                   RMDEFSTNDQKRNGVLANLTAKGIDVSGAQAVENQIQQEGTALNAALTDRDESAIKAAN
FT                   QDLATLNKQFESIIKSYRSGHRAKATATASPTTTITPAATL"
FT   sig_peptide     449867..449947
FT                   /locus_tag="Mboo_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 27"
FT   gene            complement(450708..452003)
FT                   /locus_tag="Mboo_0467"
FT   CDS_pept        complement(450708..452003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0467"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_1739 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54985"
FT                   /db_xref="GOA:A7I5H4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H4"
FT                   /protein_id="ABS54985.1"
FT                   /translation="MGTKADPTPFDQRLFLIFIVTFASMTAFEFIGQYLYPYEPDWRSN
FT                   LIISLFASGLAVMLAYFLLSPYYENVSILAEEIKNRHRVERDLREREERLRRTFDQSPV
FT                   GAALCSPDLRFIRVNNALCTISGYTPEELLTLSIPAITVQKESADLAGCAEALMCGRAD
FT                   LDERDLHLVKKNGDRIWVRLSVSLVRDVEGAPLYFIPMFVDIHDRKLAEDALQKTNRKL
FT                   SILSSVTRHDIKNQLTGLGVYLQMVRNEVPDNPILQGYISKLVACSEAIDRQIEFTRYY
FT                   EELGTANAGWFDVYQGILDQAIQLPLEGVMLDPGKKGIYIFTDPLIGKVYYNLIENSIR
FT                   HGVNVKTIIFDAHETNNGLVIRYTDDGIGIPDAEKEKIFLKGYGKNTGLGLFLIREILA
FT                   TTGISIAETGMTGKGAQFEILVPRGEYRLSPK"
FT   gene            complement(452150..452674)
FT                   /locus_tag="Mboo_0468"
FT   CDS_pept        complement(452150..452674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54986"
FT                   /db_xref="GOA:A7I5H5"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H5"
FT                   /protein_id="ABS54986.1"
FT                   /translation="MRYITIIMATNSEYAIIFFFLALFVVLEFSLVIIPAMLNRSKIKR
FT                   RYRQSEFDIPQVLERGASFEDRARIRSWYFDRNDSHWHTGTIPHAPPAPVHSGDRNLDS
FT                   FALRPAPRQLSAEPGTVGITAKSPDRAISNAQAGVQQAGLDDLMWIDEISELNPLLSPV
FT                   KNGSDVSEKKQ"
FT   gene            complement(453631..454401)
FT                   /locus_tag="Mboo_0469"
FT   CDS_pept        complement(453631..454401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0469"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   mja:MJ1209m DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54987"
FT                   /db_xref="GOA:A7I5H6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H6"
FT                   /protein_id="ABS54987.1"
FT                   /translation="MARDTFYRADGLEIINGDIFSTRAIPTQGIDLVVTSPPYNVDIRY
FT                   HSHDDGLTYDEYLAFSKRWMKRCFGWLKPDGRFCLNIPLDKNKGGQQSVGADLTAIAKE
FT                   CGFAYHSTIIWNEGNISRRTAWGSWASASAPYVIAPVELIVVLYKDSWKKTSGSRQSDI
FT                   TREEFMEWTNGLWTFNGERKTRIGHPAPFPVELPLRCMKLFSFVGDTVLDPFMGSGSTL
FT                   VAASRCDRKAIGVEIDAHYCELAAKRIAAEDETK"
FT   gene            454497..454997
FT                   /locus_tag="Mboo_0470"
FT   CDS_pept        454497..454997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0470"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   sfu:Sfum_0270 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54988"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H7"
FT                   /protein_id="ABS54988.1"
FT                   /translation="MSEKPEPVDYTYTPIGTIHSPFKDIVGMPIQPTGARGIRGTIEIR
FT                   SDLKGGLADLERFSRIILLYSLHRCTGYSLKVSPFLDPTPHGIFATRSPKRPNAIGFSI
FT                   VRLVGIDDCTLTIEDVDILDGTPLLDIKPYVPAFDSYPDERSGWLGAVAHNAQHAKSDD
FT                   RFQ"
FT   gene            455059..455553
FT                   /locus_tag="Mboo_0471"
FT   CDS_pept        455059..455553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54989"
FT                   /db_xref="InterPro:IPR009183"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H8"
FT                   /protein_id="ABS54989.1"
FT                   /translation="MTESEALRGIPGILRPFKEYVKSLGLNEGDQIVYYGCVGTCTPFV
FT                   ELLAVAIRGFHLRQVFVPLLDEAKAHAIHDVPDVGMQAGGEPVAVTGPKVLVIMGGLAM
FT                   PLMPVTKEQVRDLAARHTGVKVVGVCFQDMFARAGWTGTVPFDLVISAMIDKVTVTRSE
FT                   Q"
FT   gene            455633..458581
FT                   /locus_tag="Mboo_0472"
FT   CDS_pept        455633..458581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0472"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: mhu:Mhun_1061
FT                   phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54990"
FT                   /db_xref="GOA:A7I5H9"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5H9"
FT                   /protein_id="ABS54990.1"
FT                   /translation="MASFVHRIEVHYSKDPREKTRTERIRALGFGIDVLQLVDVYTIAT
FT                   VKRDLLPAELDEIGARLTNPVVQDFVVDEATHALFDYAIEIGFLPGVTDNVGTTARQMV
FT                   EDYLGITFGEGEMVSFSSLYLVRGRLSPEALAQLPATLANPLINRVSTKTRQEYGETGM
FT                   DRIIPEVRLHEIPAAGIVDLSLPDEDLLRLGKEGISDPQTGQRRGPLALDLAQLHAIRN
FT                   YFDRAGRKPTDVEIESLAQTWSEHCKHTIFASAMDDDVPKGLYKSFIQAATNEIRAEKG
FT                   DRDICVTVFTDNSGAIVFDDEYLVTHKVETHNSPSALDPFGGALTGIVGVNRDTIGFGL
FT                   GAKPCINVYGFCVGDPASEPALYRGRDRKNPIISPRQILDGVVRGVGVGGNCSGIPTPQ
FT                   GFCWFDNRYAGKPLVFAGTVGVMPREHNGQNLFEKKAEPGDLIVMMGGRVGKDGIHGAT
FT                   FSSEALDPNSPVTAVQIGDPITQKKFSDVLVKEARDLGLYRSITDNGAGGLSCSVAEMA
FT                   KECNGCHVELDRVPLKYPGMAPWEIWISESQERMTLAVSPEKSAELIDLCARRGVEATL
FT                   IGKFTGTGRCVVEYGGKTVMDIELAFLHDGLPKKHLVTRQAPVAEPAVGPLPPCPDQLG
FT                   DTLAAMIGRRNICSTEFVTIQYDHTVQGGHVLGPVQGKGRVQSVATLTKVVPGSKRAVG
FT                   LSQALFPSYAELDPYRMAGAAIDLAIRGLVATGISPESIALLDNFCWCSSDEPERLWQL
FT                   KEAARGCYDYAKAFGTPFISGKDSMFNDFSGYDAENNRVKISVPPTLLISSIGIHSDVT
FT                   KAVSLDAKISGDLVYVIGTTEEELAGSEYFAFLGAGGSTVPCLDAAAARVRYLRLSDAI
FT                   AHELVSSAYPVGHGGIGVALAKVAIAGRLGMDITLPGALRPDIFLFSETLGRFVVTVAP
FT                   DHKRAFEQALGADALLLGTTGGSRLRVTGRTFLFEQEIATLEKAYKSSFGGF"
FT   gene            458583..459416
FT                   /locus_tag="Mboo_0473"
FT   CDS_pept        458583..459416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0473"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /note="KEGG: mhu:Mhun_1062
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54991"
FT                   /db_xref="GOA:A7I5I0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I0"
FT                   /protein_id="ABS54991.1"
FT                   /translation="MPSAHAPPSQRLIGEKALIMSGYGINSEMETREALFRAGMDAEIV
FT                   HINDLIAKRVSISDYRLLVFPGGFSYGDDTGAGNAYANRVRNNLWDDLLEFLDGDNLVL
FT                   GICNGFQILANLGLVPAFDRSYVREIALMPNRSGRLECRFVTIRPASDTIWTHGIVKIL
FT                   CPVSHGEGNLSCSAETLQEIKRNRQIAFTYCRDDLSPAGGEYPYNPNGSVEDIAGLTSK
FT                   DGKVLGMMPHPERAMEFTNLYDWPLLKEQMRRSGERIPGESLNMAIFKNIVRYFE"
FT   gene            complement(459487..460206)
FT                   /locus_tag="Mboo_0474"
FT   CDS_pept        complement(459487..460206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro06644 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54992"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I1"
FT                   /protein_id="ABS54992.1"
FT                   /translation="MARKCRNCGAPAPETNSKFCDLCGAPLIEEPVTPQGLPVCPSCGA
FT                   IVSDKKAQFCDICGAPLAKQVCPSCGTPAPSSRSKFCTRCGATFGPPVPVKSRAGTISS
FT                   GAAEPEPEPVVVRSRKGHKPEPGPVPADVSEEWDPWTDGDPLYDVSAPLPIQPQPRPLT
FT                   DLERIAAGVPRPKPAKGESEDQHSSGQQKKYSHLPLVADELREEAERRRSAYDTGESKG
FT                   PSGRKGKQGKKGGLFKF"
FT   gene            460475..460786
FT                   /locus_tag="Mboo_0475"
FT   CDS_pept        460475..460786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54993"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I2"
FT                   /protein_id="ABS54993.1"
FT                   /translation="MQLPDDELTREFSDVLHVRELVGVYALDIKDVEVPLRIKILRSGS
FT                   VYYGIASLAVREKGANDYYRDSGTYPSKEAALNGAVAGFFLHLKPGASIREIKNWSVF"
FT   gene            complement(460848..461774)
FT                   /locus_tag="Mboo_0476"
FT   CDS_pept        complement(460848..461774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0476"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; KEGG: mba:Mbar_A0449 coenzyme F420
FT                   hydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54994"
FT                   /db_xref="GOA:A7I5I3"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017679"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I3"
FT                   /protein_id="ABS54994.1"
FT                   /translation="MGAELGKYKSCVSARSTDKEVLKYAQDGGIVTSLFGYALDTGIID
FT                   GAIVAANKEFYAKYPSKCIQDSSNLDMIEPWRPIPAIVNTKAELLAAAGTKYNISPNIA
FT                   LLKEATRSFGLDKIGIVGTPCQMQAVRKAQLYPVGMRDVGASIALAVGIFCMENFPYQS
FT                   ILQLVEDHAAMKLESVKKMEIGKGKFWVYGKRGQVVQLPLKVTHKYEQPGCHVCLDYVA
FT                   NLGDISTGSVGSPDGWSTIFVRSKIGEAVWAKAIADGVFETQPIEKVKPGLELVTKLAN
FT                   EKITKNKNTLEARKTFGVGKALRNPYI"
FT   gene            complement(461786..462544)
FT                   /locus_tag="Mboo_0477"
FT   CDS_pept        complement(461786..462544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0477"
FT                   /product="Coenzyme F420 hydrogenase"
FT                   /EC_number="1.12.98.1"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; NADH ubiquinone oxidoreductase, 20 kDa subunit;
FT                   KEGG: mhu:Mhun_2330 coenzyme F420 hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54995"
FT                   /db_xref="GOA:A7I5I4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR017681"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I4"
FT                   /protein_id="ABS54995.1"
FT                   /translation="MADKITVGYTHLSGCTGCTVALADNYAGLLTLLDRYVDLKYMPTL
FT                   ADVRHIQKVDVSFVEGSVCINDKLAVEEIKETREKSAVVVALGGCACYGNITRFCRGGQ
FT                   QNQPAHEAFLPIGDLIKVDVFIPGCAPTPQMIRNVAVMAYLLLKGTKEQKDLATAYLTP
FT                   LMKLAGGCEACACDIMTSVINQGLCMGCGSCAAACPVNAITMEYGKPQLERDLCIKCGA
FT                   CSAQCPRGFFNTDVISEYEAINEAIMAALQ"
FT   gene            complement(462585..463130)
FT                   /locus_tag="Mboo_0478"
FT   CDS_pept        complement(462585..463130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0478"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52, hydrogen uptake protein; KEGG: mhu:Mhun_2331
FT                   peptidase M52, hydrogenase maturation peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54996"
FT                   /db_xref="GOA:A7I5I5"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004411"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I5"
FT                   /protein_id="ABS54996.1"
FT                   /translation="MMQSEIVIVGCGNPLFGDDGFGPAVIEEMEKLILPDNVTIQDGGA
FT                   GAPHFIFNFLDPEVTKKLVVVDISDFNAKPGSISKISGDTLKPGAYIDPHSWDGVDQLC
FT                   RISAKIDTTVVMCQPAKAIKKGDADVEIGLSEDVKNAIPKAIQVILETIGVDYGTTINL
FT                   QKEGSQRGAAETCGHQER"
FT   gene            complement(463141..464454)
FT                   /locus_tag="Mboo_0479"
FT   CDS_pept        complement(463141..464454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0479"
FT                   /product="Coenzyme F420 hydrogenase"
FT                   /EC_number="1.12.98.1"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit;
FT                   KEGG: mma:MM3045 coenzyme F420 hydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54997"
FT                   /db_xref="GOA:A7I5I6"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR017682"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I6"
FT                   /protein_id="ABS54997.1"
FT                   /translation="MVLKVNDQGIIETGNWCSITPVRGVEKLAVGKTPEQVPKIASRVC
FT                   GICPIAHNLAATEAMEASIKCEIPKDAKALRNILQLANRLHSIALHDILILPDLYIPGT
FT                   ETKINPFTAEEPVRTVAKRIQRLREIGQTIGQIAGGDCIHPRNTRIGGMYRNCSEQAKT
FT                   KMYDLAKEGLVLAKAQMDFMIAVLRNYQARESVDVGGMKVPLPKTLGYHNQGYMATHAF
FT                   YGSSSLDECPTWDINRFKEVRPWDWYMGEMEVSLEEPRYPVGGTTKIGTKVNPQMEACT
FT                   GIPMYDGQPVEVGPRARLATYKNYDEKGTVGQNIAREMEYTDSLYEMIDQIDALDTCGK
FT                   VVADFIPDGDGSLGWATNEAPRGCDAHIARVKDWKVQYFSMLVPTTWNFATCSAALTGA
FT                   PWQLAEVIMRGYDPCVSCATHMIVLDEDNKVVAQKLIQ"
FT   gene            complement(464809..465789)
FT                   /locus_tag="Mboo_0480"
FT   CDS_pept        complement(464809..465789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0480"
FT                   /product="protein of unknown function DUF198"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   mhu:Mhun_2334 protein of unknown function DUF198"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54998"
FT                   /db_xref="GOA:A7I5I7"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022840"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5I7"
FT                   /protein_id="ABS54998.1"
FT                   /translation="MDKAPEQPFSGKLPDVQATSPDVRINLTRVGVKNVKKLVEVTRPD
FT                   KRPVVFISNFDVYVDLPGSLKGANLSRNFEVIDEVLQQAIDGEVNEIENLCSAVARKLL
FT                   DRHEYADRTEVLMRSEFMVKRETPVSHTTCHEVVKVHARAIAKRTFRDPIVRKSIGAEV
FT                   TGMTACPCAQNIMKERANHVLEGLGIDQKTIDAFFAEVPMATHNQRGRGFLCIETDDDQ
FT                   HVDLEKIIRILKESMSAGIYELLKRGDESAVVLAAHKNPRFVEDCVREMAKKVLSGFDY
FT                   LPGDAVVTIKQTNEESIHQHDAYAERRATLAELQDELNGDHKTSC"
FT   gene            465902..466891
FT                   /locus_tag="Mboo_0481"
FT   CDS_pept        465902..466891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0481"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: mhu:Mhun_1245 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase,
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABS54999"
FT                   /db_xref="GOA:A7I5I8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5I8"
FT                   /protein_id="ABS54999.1"
FT                   /translation="MMKKYYESDADLSVLSGKKIAVIGYGSQGRGQSLNLRDSGLDVII
FT                   GLRKGKSWDAAAKDGMNVMTVAEAAKKADIIQILLPDELQAAVYKNEILPHLSENKVLM
FT                   FSHGFNIHFGQIQPPGNVDVIMVAPKGPGFMVRRQYEEGKGVPALIAIHQDHTCKAHKT
FT                   ALAYAKGIGATRAVVLETTFREETETDLFGEQAVLCGGTASLIKAGFETLVDAGYAPEM
FT                   AYLEVCHELKLIVDLIYEGGLTNMRQYVSNTAQYGDMTRGPRVIGPEAYEAMEEILAEI
FT                   QSGEFAKEWMLENMVNRPVFNALTKADEEHLLEETGKEVRAMMPQFRK"
FT   gene            467002..467493
FT                   /locus_tag="Mboo_0482"
FT   CDS_pept        467002..467493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0482"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: mhu:Mhun_1644 transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55000"
FT                   /db_xref="GOA:A7I5I9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5I9"
FT                   /protein_id="ABS55000.1"
FT                   /translation="MRICIIYHSETGNTRHVAQHIASVIPDSRLVEVTDRAQHMALTRF
FT                   LAQCKDARGENKTEIEPSHLNVREYDLLVFGSPVWAFKPTPAIHSIIDVLENCEKKRAV
FT                   AFVTCGGRPGGSREVFKKWIEARGMNFAGFTSVNEKDIEDAAANAELITLVKSAVPKLD
FT                   "
FT   gene            467575..468189
FT                   /locus_tag="Mboo_0483"
FT   CDS_pept        467575..468189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0483"
FT                   /product="putative translation initiation factor aIF-2,
FT                   beta subunit"
FT                   /note="TIGRFAM: putative translation initiation factor
FT                   aIF-2, beta subunit; PFAM: Translation initiation factor
FT                   IF5; deoxyribonuclease/rho motif-related TRAM; KEGG:
FT                   mhu:Mhun_2335 translation initiation factor aIF-2, beta
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55001"
FT                   /db_xref="GOA:A7I5J0"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5J0"
FT                   /protein_id="ABS55001.1"
FT                   /translation="MTDSYENLLKKAYSHISEKSASSERFVVPEAKAYVEGKTTILENF
FT                   AEIADTVRRDKDHLMKYMLGELGTSGKIEGNRAIFNGKFEISQIRMIIKSYVDDYVICS
FT                   ECGKPDTRLVKDDRVLLLRCDACGGHRPVRKRKARTEPASENLEEGQVLDVEIQSLSKR
FT                   GDGVVKMGRYIMYVSNAKPGQSVKIKISRISGSIVFTERAE"
FT   gene            complement(468341..468616)
FT                   /locus_tag="Mboo_0484"
FT   CDS_pept        complement(468341..468616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0484"
FT                   /product="RNA polymerase, dimerisation"
FT                   /note="PFAM: RNA polymerase, dimerisation; KEGG:
FT                   mhu:Mhun_2336 RNA polymerase, dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55002"
FT                   /db_xref="GOA:A7I5J1"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J1"
FT                   /protein_id="ABS55002.1"
FT                   /translation="MIVKVLELEKDKARLVIQGEGHTFMNALVEEILTDPDVDVAKYTI
FT                   EFQFSDPELLVTTKNAKKNPLTVIKKACKRISSNCDDLLKNLSKQK"
FT   gene            complement(468692..469414)
FT                   /locus_tag="Mboo_0485"
FT   CDS_pept        complement(468692..469414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0485"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mhu:Mhun_2337 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55003"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J2"
FT                   /protein_id="ABS55003.1"
FT                   /translation="MKVQLLGTGDAIGTPKIGCDCPQCQHAQKTGIGRLRTSLLIEQDG
FT                   RHILVDTSPDLRQQLIRSGSPHIDAVVWTHGHYDHFMGFGEFYRVQKCPPVYAPEPVLR
FT                   YCGGTFRFLEFEQNPVEPYVPFELFGITITPFLVKHPPAYTCGFVFERGGVRVGYTSDT
FT                   NRDIPQKSLNLLENLDLLLVDALVPSHMTITKHMNYLDACTLAESLHPKAFRCIHISHM
FT                   MPWEYPHLAHDGDIFEFP"
FT   gene            complement(469416..470690)
FT                   /locus_tag="Mboo_0486"
FT   CDS_pept        complement(469416..470690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0486"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mhu:Mhun_2338 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55004"
FT                   /db_xref="GOA:A7I5J3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J3"
FT                   /protein_id="ABS55004.1"
FT                   /translation="MSGDLESLRIMEVLLTAEIFNQNPTLDLNDLTPACREIFCSGDTK
FT                   SIKRPVYVSDGLMKRTLNIADAHDKIAKNPFVSYEEFGQRLKITTLQPAAEWFLAQGGK
FT                   DLIRQNPALAFFFESFNGTGVSYQDVRKANPPYEDTRASLDTKLSKLIGEDEKLRGALD
FT                   LVIVSAPEEIEQRMEDLICSPEQTAIIHKIHHALHHRDFLNRHRIYEVGKLLFVGPPGT
FT                   GKTSLALAMSHSMHMPVLEVRLSMITSQYLGETSKNIDKIFELAKKLSPSILFIDEFDF
FT                   VAKSRVTDDHGAMKRAVNSLLKNIDRISLVKNGVLLIGATNHPQLLDEAAWRRFDEIVE
FT                   FSLPNEEMRREIIKSSTSSLSCTCDYQELAALTDGFSGADIRIMVKEALLSALMDKREK
FT                   IDSADLETGIRMIRNRDAIRNLSWK"
FT   gene            complement(470738..471622)
FT                   /locus_tag="Mboo_0487"
FT   CDS_pept        complement(470738..471622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0487"
FT                   /product="methionine aminopeptidase, type II"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: mhu:Mhun_2339 methionine aminopeptidase, type
FT                   II; TIGRFAM: methionine aminopeptidase, type II; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55005"
FT                   /db_xref="GOA:A7I5J4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J4"
FT                   /protein_id="ABS55005.1"
FT                   /translation="MKKMNDDVLDTYISAGKLASVILRESAREIRAGGSFLELVESVEA
FT                   RVRESGADLAFPLNVSLNEDAAHDTAAPGDERVFAKGEVIKLDLGVQIDGYIADTATTV
FT                   DLGNNALLLDASREALEAAIRIVKPGVTAGEIGAVIEKEITSRGYRPIANLTGHGLGQY
FT                   IQHRDPTIPNIAINGGSVLEEGTAFAIEPFATTGSGRVGEKTRIEIYSQIAEKPVRIPS
FT                   ARAAMEKVRERHGLPFSRRWLDDKKMVLALPGLVRSGILHGYPVLADIPGSLVSQHEHT
FT                   LIVTADGCIVTTR"
FT   gene            complement(471619..472752)
FT                   /locus_tag="Mboo_0488"
FT   CDS_pept        complement(471619..472752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0488"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: mhu:Mhun_2340 peptidase
FT                   M24"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55006"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J5"
FT                   /protein_id="ABS55006.1"
FT                   /translation="MAMDPLDAAMKKCGADAFVHYATGEEADMRYLTRFVMHDPFVFFK
FT                   RRRQPGTIIVPQMEAERASRESTTSVMTRTQAGLPDIVKKEKDPWKAAAKMIAGQAGKN
FT                   LLVSPALPAALLRALEEHGHVIVDNGTVERVRAIKSPGEIRLMQAVQKKTERAMALGIS
FT                   LISHATVKKGILYHNGAPLTSELVRIAMHKQLMDEGCRAVETIISCGEDTAFPHIIGSG
FT                   ALKPHEPIVIDMFPRDEASGYYADMTRTVSKGKPSQKITEMYEAVKEAQQIGIATIKAG
FT                   VSGADVHNAVVDYFKSRGYESDTRGFIHNLGHGVGLQVHELPTVGPAGGALEAGSVVTV
FT                   EPGLYYPGVGGIRLEDMGAVRARQFAGFTQFEETLIV"
FT   gene            472809..473033
FT                   /locus_tag="Mboo_0489"
FT   CDS_pept        472809..473033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55007"
FT                   /db_xref="GOA:A7I5J6"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J6"
FT                   /protein_id="ABS55007.1"
FT                   /translation="MDETAKEQFKWKFYRLAVQLNAIILLVALAILFFFLAPEPYRLPA
FT                   LIVLLALALVLSWDFVKSYRLTKAWLDEH"
FT   gene            473088..473372
FT                   /locus_tag="Mboo_0490"
FT   CDS_pept        473088..473372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55008"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J7"
FT                   /protein_id="ABS55008.1"
FT                   /translation="MLKKMKEEIELLSRHIEVARTVAEHQPIGIMKLSEILDLPSHRIR
FT                   YSLHVLEQLGYIRASPEGAVATAQTRELFAHLNEDLDDIIRLVNAMKRP"
FT   gene            473506..473578
FT                   /locus_tag="Mboo_R0005"
FT                   /note="tRNA-Asn1"
FT   tRNA            473506..473578
FT                   /locus_tag="Mboo_R0005"
FT                   /product="tRNA-Asn"
FT   gene            473584..473658
FT                   /locus_tag="Mboo_R0006"
FT                   /note="tRNA-Met1"
FT   tRNA            473584..473658
FT                   /locus_tag="Mboo_R0006"
FT                   /product="tRNA-Met"
FT   gene            474021..475052
FT                   /locus_tag="Mboo_0491"
FT   CDS_pept        474021..475052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55009"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J8"
FT                   /protein_id="ABS55009.1"
FT                   /translation="MACPVCGGDCVRPAQEVLAALPTLFVPCPFCRMQVLDKRAPLPVL
FT                   DYPEPCSCGRRFIDGVFAHLYVIMWEEGDLLPHDPLIAVGSPLIHPGLALDHPPFLPTK
FT                   SLLLLSGKVTQKTARRIVAEVPEVKGVVRTIPGIPGLASHEPGAVPCAHTLLAGCDVRA
FT                   DLFPLGEGTLVVYKQQSVIHVEFPRAGYPKVRAVAAHTGKPPVPLFIDACSGPGTLGLA
FT                   AAGLGVPHVIMNDAWYAAAFWSAVNIGVNRALFAIDDVKISVQYAEMATRPVVQMPEKI
FT                   AEARGQQILEVYQGDFRHLMSVIPRDTHLVTALDIFDKQDRGTVAALLHDWQDRVGGEV
FT                   FVP"
FT   gene            475157..475446
FT                   /locus_tag="Mboo_R0007"
FT   misc_RNA        475157..475446
FT                   /locus_tag="Mboo_R0007"
FT                   /product="signal recognition particle RNA"
FT                   /note="predicted by Rfam (RF00017), score 74.31"
FT   gene            475470..476468
FT                   /locus_tag="Mboo_0492"
FT   CDS_pept        475470..476468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0492"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   mhu:Mhun_2343 L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55010"
FT                   /db_xref="GOA:A7I5J9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5J9"
FT                   /protein_id="ABS55010.1"
FT                   /translation="MSKVTIIGATGNVGTFAAYAVSVDPHVHEILLYGREGREAFLKGL
FT                   AQDFADSFAARGTNIRVTWTTSLKDVAGSDIVVITAGTPRGPGQNRLDLALGNARIIAP
FT                   MARTIGTIAPDTKIIMVTNPVDVMTCVALKYSGLKPNQVFGLGTHLDSMRLKSLIASYF
FT                   KVHVSEVHTRIIGEHGDSMVPLWSATTIGGIKISNLPAFAHLPVQDFIQSVKTSGEQII
FT                   KNKGSTVYGPGEAIATLVKTILGDENRILTVSAYVKSEVHGIGGVCIGVPARINKNGAF
FT                   PVTIRIDESEVIAYRESVEKIRATIHQIIGELENDKDIGPAAPKRQKKTRV"
FT   sig_peptide     475470..475532
FT                   /locus_tag="Mboo_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.848 at
FT                   residue 21"
FT   gene            complement(476538..476795)
FT                   /locus_tag="Mboo_0493"
FT   CDS_pept        complement(476538..476795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0493"
FT                   /product="translation elongation factor aEF-1 beta"
FT                   /note="TIGRFAM: translation elongation factor aEF-1 beta;
FT                   PFAM: Elongation factor 1, beta/beta'/delta chain; KEGG:
FT                   mhu:Mhun_2344 translation elongation factor aEF-1 beta"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55011"
FT                   /db_xref="GOA:A7I5K0"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5K0"
FT                   /protein_id="ABS55011.1"
FT                   /translation="MGSVVAILRVMPESPDIDLEKLKKALKDALPGIKDIQEEPIGFGL
FT                   KALKLAAIVNDAGGETDALEGKLNAVPGVERAEIIEVTLN"
FT   gene            complement(477008..477634)
FT                   /locus_tag="Mboo_0494"
FT   CDS_pept        complement(477008..477634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0494"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   mhu:Mhun_2346 1-pyrroline-5-carboxylate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55012"
FT                   /db_xref="GOA:A7I5K1"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K1"
FT                   /protein_id="ABS55012.1"
FT                   /translation="MRSQVTHGGEEGSAHLTVVKLGGSLARHAREIIPVIRAARRPLLI
FT                   VPGGGVFADAVRQSEADSDTAHWMACAAMDQYGWMLAAQGIKTTSRLACPAGPRILLPY
FT                   CTMRRHDPLPHSWDVTSDTIAAWVAGRLGGDLLVLKSVDGITDEGKLVPRINKPRVTDV
FT                   VDPQCIPYVLEHRIRTFILNGTDPARIERWLRGVKVPGTCIGTTF"
FT   gene            477677..479347
FT                   /locus_tag="Mboo_0495"
FT   CDS_pept        477677..479347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0495"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   mhu:Mhun_2347 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55013"
FT                   /db_xref="GOA:A7I5K2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K2"
FT                   /protein_id="ABS55013.1"
FT                   /translation="MSFSRLSAAFLFLCFCVVTCSAVQIIEFCPDPYLPDDADEYIVLS
FT                   GDGSLDGVAVSDNHGGFRFPQGTVIHGTLTIARNGAAFEKTHGTSPDFEWQDYSPSVPD
FT                   VVSGNQLRLANTRDELLVYENSRLVQKITWPGDVKPREGQVHYLEEGTWDPRPLMLGQS
FT                   RLALTSFENVTVTAFVSPDSSLAVFSGAVDSAQHRVLANVYELTSTNITHTLTYARKRG
FT                   VDVSVLVEGGPVGGIPAAEKSAISVLNQSGIPVLAMASSEGGHVPYRYDHAKYVIIDDR
FT                   AVLVTSENFGHSGFPPAGETGNRGWGVVMEDPRLAAYFADLYQTDTSGSAITPVYGTAG
FT                   PGENYTIISRPVVFEPVTFTGARVTPVIAPDTSAGITGLLNSAQESIEIQQAYITNESK
FT                   TRLNPYLATAINASRRGVQVRVLLDSYWYNTEDEADNDEMVALINRIAATENLPLEARC
FT                   ADLGATGLEKIHNKGVIVDGRAVLVSSINWNTNSPGFNREAGVIIEQPGVAMYFRGVFD
FT                   ADWSPAVRSPHPPTDYLKIACVITVIGLLMLLYYYRHMR"
FT   sig_peptide     477677..477745
FT                   /locus_tag="Mboo_0495"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.611 at
FT                   residue 23"
FT   gene            complement(479453..479686)
FT                   /locus_tag="Mboo_0496"
FT   CDS_pept        complement(479453..479686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55014"
FT                   /db_xref="GOA:A7I5K3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K3"
FT                   /protein_id="ABS55014.1"
FT                   /translation="MVSRLVNNQGLSQSDAAKRLGVTRAAVSQYLSRKRGYGAIALSSD
FT                   LDAMIDRWALAVVTGESDINLCDVCQCALKKE"
FT   gene            complement(479758..480003)
FT                   /locus_tag="Mboo_0497"
FT   CDS_pept        complement(479758..480003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55015"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K4"
FT                   /protein_id="ABS55015.1"
FT                   /translation="MYQQTLPPSSRTVLEILDIGGAMTHKDLVTKSHLAPRTVRYALKK
FT                   LKERHLIIEKFNFRDARQIIYQNRPVTTSESQPAIV"
FT   gene            480149..480439
FT                   /locus_tag="Mboo_0498"
FT   CDS_pept        480149..480439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0498"
FT                   /product="nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; KEGG: mhu:Mhun_2351 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55016"
FT                   /db_xref="GOA:A7I5K5"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K5"
FT                   /protein_id="ABS55016.1"
FT                   /translation="MLLSLGKTPFATVYSNEVADGTLVSLTGSIDQVTVLSNGGHVILT
FT                   VNNTSVFIPAIVAGDRAFAKGTPVLLYGTVQTYRGKKEIVVNSAEDIVEIR"
FT   gene            complement(480530..481360)
FT                   /locus_tag="Mboo_0499"
FT   CDS_pept        complement(480530..481360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0499"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: pab:PAB2347 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55017"
FT                   /db_xref="GOA:A7I5K6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K6"
FT                   /protein_id="ABS55017.1"
FT                   /translation="MVSLEYLLKFIDEDAPSGDVTSDAIIPEITCHAVIRAEQEGVAAG
FT                   LEEAGTLFSHFGVEARPETRDGSTVKAGEVLLTLSGPAKKILLVERTALNIIGRMSGIA
FT                   TQTKAMADTVKAENPRCRVAGTRKTCPGLRALDKKAIVLGGGDPHRTCLSDGILIKDNH
FT                   LALVSISEAIARARAASAYRKIEIETESAHDAVTAARAGADILLLDNMSPDSIRDTIGN
FT                   LESVGLRDRVTIELSGGITAGTIRDYAQTGADLISLGALTHTVRNFSVTLEIRK"
FT   gene            complement(481379..482137)
FT                   /locus_tag="Mboo_0500"
FT   CDS_pept        complement(481379..482137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0500"
FT                   /product="aspartate dehydrogenase"
FT                   /note="PFAM: oxidoreductase domain protein;
FT                   dihydrodipicolinate reductase; aspartate dehydrogenase;
FT                   homoserine dehydrogenase, NAD-binding; KEGG: mhu:Mhun_2354
FT                   aspartate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55018"
FT                   /db_xref="GOA:A7I5K7"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR022487"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K7"
FT                   /protein_id="ABS55018.1"
FT                   /translation="MMRIGLLGCGNIGHIIARHAEGFTIPAVYDTKPERAKEIADLCNG
FT                   KAYGDFAAFLEADTDIVVEAASVGAARAHAQEVLEHKKNLVIMSVGALTDQELREGLVA
FT                   VARQTGTKIYVPSGAIFGLDNVKIGQISPISKLLLKTTKSPQSLGLDAPIRRRIFSGKA
FT                   HECIKLYPKNVNVSVAMGLAAGQDADVELWVDPAADKNIHELFIEGDFGETYIRVTNVP
FT                   SPENPATSYLAALSILSLLKNLDSPLVIGT"
FT   gene            482243..483535
FT                   /locus_tag="Mboo_0501"
FT   CDS_pept        482243..483535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0501"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: mhu:Mhun_2355 MiaB-like tRNA modifying enzyme;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme; PFAM: Radical SAM domain protein;
FT                   Protein of unknown function UPF0004-like; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55019"
FT                   /db_xref="GOA:A7I5K8"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K8"
FT                   /protein_id="ABS55019.1"
FT                   /translation="MDGNRSTRGSPDPGDLFAGLAGKRVYIETYGCRYNFGDTANLVAV
FT                   LKHYGSTVVPAPEDADAVVVNTCTVVGPTERRMLRRLSALQEKPLFVTGCMPLVQREAI
FT                   LAVCSPVIIHPDTIREASRALMTVGSESVGIVQIAQGCLGRCTYCITRRARGPLRSFPV
FT                   QEIRNKIEEYVRAGAYEIQLTAQDTSAWGRDTGQRLPDLLTALSSIPGNFRLRVGMMNP
FT                   ATTLGILDDLIDAFASDRLFRFVHLPVQSGSDRILEQMGRGYTVREFEEIVSAFRGRYP
FT                   DISIATDFIVGFPGETEEDFSRSLELIGRIRPAKVNVTRYSPRPFTGPFEEKDFPDAVK
FT                   KDRSRILNAYAEEQYVALNRPLLGTMVFCVVTEKIRPGSVMARTASYQGLVIGEELSVG
FT                   TAAVVRLKKDRKYFFMGDLLSRDPSHMRGVD"
FT   gene            483612..484148
FT                   /locus_tag="Mboo_0502"
FT   CDS_pept        483612..484148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55020"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5K9"
FT                   /protein_id="ABS55020.1"
FT                   /translation="MDEIEAGFTKMTKMIEELKKTEGQMSEEIRANDGELLRRMTVLAK
FT                   PVVKSVGLNLLKIGKQDTKGELYDPNYFTEKMIILGKCDPAPFRPDDPAKTITDQFCVL
FT                   SERGRLYELMYSNDGFLTDSYLNQIEPKAAIERYGYDVLFMLYQGMHEYLKTEQELVAA
FT                   LEKVIGFVFASKPRA"
FT   gene            complement(484248..484321)
FT                   /locus_tag="Mboo_R0008"
FT                   /note="tRNA-Ile1"
FT   tRNA            complement(484248..484321)
FT                   /locus_tag="Mboo_R0008"
FT                   /product="tRNA-Ile"
FT   gene            484455..486227
FT                   /locus_tag="Mboo_0503"
FT   CDS_pept        484455..486227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0503"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: mhu:Mhun_2358 thiamine pyrophosphate
FT                   enzyme-like TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55021"
FT                   /db_xref="GOA:A7I5L0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L0"
FT                   /protein_id="ABS55021.1"
FT                   /translation="MERHYLLGNEAIAHACLESGIGFVSGYPGTPSSEVVDVLRAQKDP
FT                   PFYLEWSVNEKVALENALAAAWCGLRAICTMKHVGLNVAADPLMTSAYTGVTGGLVILS
FT                   ADDPFAHSSQNEQDTRCYAHFARLPCLDPAGVQEAHDMVGTAFALSEEFRLPVLFRPTT
FT                   RICHSKGDVALGAVVPNERKGEFHKDPRQYVVIPAHTRILHKKLNEKQPALKKRLVELG
FT                   LNAYTISGKTAVIASGIGAAYVQELLPPNVSFMKIGAYPIDEAWLGEFAKKHEKILVIE
FT                   ELAPVVEEAVRQVAGCVPVFGKINGYAPYEGELSPGVVAGIMVKAGFLEKNPFAAPIPV
FT                   PDLPLRPPILCAGCHHRAAFYAAKKVFGPTAVYPSDIGCYTLGLQLGAVDTTICMGASI
FT                   TVGSGIAHSDPLRDVVCTIGDSTFLHTGIQGLMNAVYNGANMTVIILDNRITAMTGHQP
FT                   NPNTGVTATGVETPPVSLDAVCRACGATFVETVDPYDMTGMLRVLEDAKAKKGVKVIIA
FT                   KQMCVIVARRTGVKRGRYAVNPEICTGCGTCVRFGCPAIELVDKKARINELCSGCAVCA
FT                   RLCPVGAISLEVRR"
FT   gene            486224..486808
FT                   /locus_tag="Mboo_0504"
FT   CDS_pept        486224..486808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0504"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: mhu:Mhun_2359 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55022"
FT                   /db_xref="GOA:A7I5L1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L1"
FT                   /protein_id="ABS55022.1"
FT                   /translation="MSAGFDILIVGIGGQGTILASNILGEACLREGRPVKGAETHGMAQ
FT                   RGGSVETHIRIDGQYGPLIVPGTADLLISFDLLEALRYSHYLKAGGKMVVNRHMVLPTS
FT                   VFTQKAPVLTEDEIVGQLARFDPCLIDADRIAAESGSILAQNVVILGVASWSIPLKPES
FT                   LLGAVKKLVPPKTIEANTRAFEMGRAAGRKN"
FT   gene            486808..487527
FT                   /locus_tag="Mboo_0505"
FT   CDS_pept        486808..487527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0505"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   mhu:Mhun_2937 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55023"
FT                   /db_xref="GOA:A7I5L2"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L2"
FT                   /protein_id="ABS55023.1"
FT                   /translation="MGLLGTFEPDTLYEGDACALLKKLPAGSVDLIVTDPPFAIDFTAQ
FT                   RLNYNRTGGNVIEGYREIPAAEYGKFTRRWIKQATRALSPSGSMYVFSGWNRLRDILEG
FT                   IDAAGLVTINHLIWKYQFGVFTKNKYVTSHYHILFVVKDRKRYTFNKLDHYPEDVWVIN
FT                   REYWKGKKKTPTKLPKELVQKIIRYSSNPGDLVLDPFLGSGTVAVVARNECRHFLGFEV
FT                   VPEYVSFARDALRAGRT"
FT   gene            487967..489241
FT                   /locus_tag="Mboo_0506"
FT   CDS_pept        487967..489241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0506"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   mhu:Mhun_1002 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55024"
FT                   /db_xref="GOA:A7I5L3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L3"
FT                   /protein_id="ABS55024.1"
FT                   /translation="MTTPTSHDGISRFHTSEAKYREYSSSALTKAIDLKRISQDDADLI
FT                   LEFVQEAKATGKKITTARYFKIISVLIRLREFFPKPFRESVIKDVYAARDRIEQAKTAR
FT                   GTPFKQNTVADFIRFMKRFFMWLSENGKSEIPEKKLRDIKPPNYVYDTKTADMIFTKED
FT                   IFGMLKACQTSRDRAIIAVLYDGALRCGELGTLRWNQVVFTDVDATITVKFKTEKTRLI
FT                   PLFMAREYLAQWRNDYPGEPIGENFVFLTSGGGRNRTGRNQLQYSGIAKQIRNIAERAG
FT                   IKKHITPHLFRHSKITHLIQDGCQESMIKLLGWGHTSTDMMDKCYGHVGPSDVKKEMAR
FT                   LAGVQIDDKPRSKVLEPRQCPRCGTIAGPTQQWCPVCSCALTPEAAEKVKTATQQAEQL
FT                   PEFAMMQKQIKDLQEQIIAMQKGSA"
FT   gene            complement(489366..490007)
FT                   /locus_tag="Mboo_0507"
FT   CDS_pept        complement(489366..490007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55025"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L4"
FT                   /protein_id="ABS55025.1"
FT                   /translation="MGSTEKSHPKFLKHRSNPPIELPEEINKWELFINSRRNGRKLAEE
FT                   IRDLLNKSETRFGWEWVSFADIREHVKKSNDVTDEWIEAMLKDMQEAHLIEKMAKNDKV
FT                   SYKDKEGTCFRKRPYYRWAIYAELNQKTDKGYMNAYRRLLTEDRELKKSFDLDEFIKNL
FT                   PPKLRRGLDQIKLDTGKSDSEIINCILQEKGIKPETVRQIAKQLIDKKQE"
FT   gene            490577..491635
FT                   /locus_tag="Mboo_0508"
FT   CDS_pept        490577..491635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55026"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L5"
FT                   /protein_id="ABS55026.1"
FT                   /translation="MVESLPASPTTSPKDMEGDEKGALKSGKRGLSLSQCIVEVLRAEP
FT                   ERAYVIRDLVEQTGGCYNSVKRTLLRLSSSRKGSGPVRKVGHGLYQYDPCKEQDSLQAL
FT                   VRSGNWKIENLTFVSLGAQGGAVSLSEIALGQTKGTPPDLSQPTPHPNVPFPWKTETGH
FT                   LVTWDDYQNGTQVIRISANGAPPISPDAAILLIGNLKNFGMDNTWICKSLELNIDSYRH
FT                   RIDSSYSLQFIEGLLLKAYQHGYYTRVEIADRREVPLREVTELFHALAGGLVGLEALKE
FT                   IQGMKERLTRCEKKTDLAYTKAAKVWDGKQQTSTTTGTKKAKSAPVSSFRTGTEIKQEQ
FT                   GPAPATASGAIQ"
FT   gene            491792..492130
FT                   /locus_tag="Mboo_0509"
FT   CDS_pept        491792..492130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55027"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L6"
FT                   /protein_id="ABS55027.1"
FT                   /translation="MAGKSQTTEVKTQVLDAILETRPSEVISGRKKLLELTDDLIEETY
FT                   NRVSGERFRVREGDRERLAYLRTLVSLIALHDSLLKGSSAPSLESLDPASIRAKIAEEK
FT                   RLHDMFTF"
FT   gene            complement(492706..492969)
FT                   /locus_tag="Mboo_0510"
FT   CDS_pept        complement(492706..492969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55028"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L7"
FT                   /protein_id="ABS55028.1"
FT                   /translation="MSRKMSNEKSRTSTGYRIPPDIEKKMNQLIESGEFDTRADVITTS
FT                   LRFYFDNRNKNTKDEIKLFLASKDGRKFIADIVGQIDQNKKE"
FT   gene            493090..493425
FT                   /locus_tag="Mboo_0511"
FT   CDS_pept        493090..493425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55029"
FT                   /db_xref="GOA:A7I5L8"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L8"
FT                   /protein_id="ABS55029.1"
FT                   /translation="MFCQKCGAQNADDAAFCNSCGTQIVRLGESPKDKVIQAKIQTKRD
FT                   QIAGISQTGPILLCLLGLPCLLLYIIPGAIMIGVAIWWSSSRENEKKKLENEIKELQAE
FT                   IAAIGGK"
FT   gene            493425..494294
FT                   /locus_tag="Mboo_0512"
FT   CDS_pept        493425..494294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55030"
FT                   /db_xref="GOA:A7I5L9"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5L9"
FT                   /protein_id="ABS55030.1"
FT                   /translation="MFCQKCGKENPDNAAFCNSCGADLRSAPVAPIPQPETIISSCSAG
FT                   KRRKIILYGVIVCIVVVILIAGAISLWNNQDWNSYCSKNYPGSTYNSTTNTCENPAAST
FT                   IPSPAQIGPHAAPIYQRGDIVSTDNEGGGGTLIEGYNPANDTYVVTWVDQSLDGTWYHG
FT                   TDPTIYAVDSWDRVDLENKNPYKIGTVDPNNLPSYASSAPLVLTGNGDNITEFGTPQSG
FT                   AYIFTSTYSGQGNFVVWIKDSNGYEVGLAANTVDASTDSKMVHLDTDTYYAEVTANGPW
FT                   TLTITPPS"
FT   gene            complement(494553..494636)
FT                   /locus_tag="Mboo_R0009"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(494553..494636)
FT                   /locus_tag="Mboo_R0009"
FT                   /product="tRNA-Ser"
FT   gene            complement(494678..495646)
FT                   /locus_tag="Mboo_0513"
FT   CDS_pept        complement(494678..495646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0513"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="PFAM: PUA domain containing protein; pseudouridylate
FT                   synthase TruB domain protein; KEGG: mhu:Mhun_2268
FT                   pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55031"
FT                   /db_xref="GOA:A7I5M0"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M0"
FT                   /protein_id="ABS55031.1"
FT                   /translation="MTTTGDCEKAEKKPAMPLRHGAGIIVIDKPRGPSSHQVAAWVGTM
FT                   LGCPVGHAGTLDPQVSGILLVMLGNAVRLAPLLLKHDKEYICLMRLHKEVDRQRIDAMA
FT                   EEFSGRIYQRPPRRSAVKRLLRIRTIKKLEILDVQGRLVLFKVECDAGTYIRSLCHHMG
FT                   LALGTGAHMQELRRTRSGAFDEQCMHTLHALQDACCAAAAGDRVALDSMIVSVDAAVPD
FT                   LPAVTVRDTAIDALCHGAALAGVGVIDCDEFRKDQIVAVLSQKREFIGLGKSLAPSAAW
FT                   KPGTPGLVVAMTTVFMAPGTYPRGWKKHSRPEQAGSAPAKG"
FT   gene            complement(495643..496335)
FT                   /locus_tag="Mboo_0514"
FT   CDS_pept        complement(495643..496335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0514"
FT                   /product="uroporphyrinogen-III synthase-like protein"
FT                   /note="KEGG: mhu:Mhun_2267 uroporphyrinogen-III
FT                   synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55032"
FT                   /db_xref="GOA:A7I5M1"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M1"
FT                   /protein_id="ABS55032.1"
FT                   /translation="MKIAVTRLAGKEGRDVARCAAFGHACYSIHPLRSEIREDVVAAFA
FT                   DATDRGEFDCIFFTSALPAKILAPRLEKTPRIIAIGPETARELTQCSIACETLPGFYSR
FT                   DFVPYLGEWIKGKKIGLPRADVPNAPLIDAIAKAGGIPREFRCYRLVPTNESLDLHPAE
FT                   AVLFTSAMSYTSAVWTPRPDLLVMAIGEITADAMRCGGTFPTIVGDGSLEGTLTALNEY
FT                   CGRTRIIR"
FT   gene            496362..497630
FT                   /locus_tag="Mboo_0515"
FT   CDS_pept        496362..497630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0515"
FT                   /product="protein of unknown function DUF112,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112,
FT                   transmembrane; KEGG: mhu:Mhun_2266 protein of unknown
FT                   function DUF112, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55033"
FT                   /db_xref="GOA:A7I5M2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M2"
FT                   /protein_id="ABS55033.1"
FT                   /translation="MRICISVDLCPFSRTFWIMIEIVIGTLLGVLLGTISGLIPGVHVN
FT                   TLAGTLLGAQVLLLDVLGPLALAGTLFAALITHTFVESVPSTFLGIPDADTSLSVLPAH
FT                   ALCLEGNGEEAVRTAALGSACAMVIAVPLSVLCFLFLPALQPFFDWGIGILIIAVIGYM
FT                   IVMSESPGWALAIFSVSGLLGAFTLHYAFLGWHTIGGETAVLMPLLTGLFGISVLLVAA
FT                   QGALPAQHFLGLRVDAKTIAKSSALGTLAGIAVGWLPGLSTATANGALASIIGYEKDRR
FT                   AYILATSAANTANAFIGLAALFALSRMRNGVMVALAELPLPSMSELAVAGVLAACLAYI
FT                   VTVGLSRSAGRLNGINGRLLNRAVILFVVGLCIVLTGPFGLVVLILATILGLVPHLANV
FT                   SRVYCMGAIMVPVILYSFGIAWV"
FT   gene            497707..498576
FT                   /locus_tag="Mboo_0516"
FT   CDS_pept        497707..498576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0516"
FT                   /product="Pre-mRNA processing ribonucleoprotein, binding
FT                   region"
FT                   /note="PFAM: Pre-mRNA processing ribonucleoprotein, binding
FT                   region; KEGG: mhu:Mhun_2265 pre-mRNA processing
FT                   ribonucleoprotein, binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55034"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M3"
FT                   /protein_id="ABS55034.1"
FT                   /translation="MQSCWFGDIDAGKCTPFTGDAAAYARRVQELRASTDAIVPIDWQQ
FT                   AVVCGICRDRAEYLILLQKVCIAGSEQAVKEQYAAKDVELLQMVRTLDEMDTVINLLSE
FT                   RVADWYQIRHPSFSRKYRRTPAHVLVRSMGGRGGALGKVATGITGLADTRTALAKVVSA
FT                   RACEVMPNTSALIGGLVAARLLSQAGGLKELSRLPASVIQVLGARTALFAHIRTNAPSP
FT                   KHGIIFQHRRVHNASRETRGKVARVLAGKLAIAARLDYYRGYPDPAFLENAQARIDQAG
FT                   VGPGEVRS"
FT   gene            498573..499172
FT                   /locus_tag="Mboo_0517"
FT   CDS_pept        498573..499172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0517"
FT                   /product="fibrillarin"
FT                   /note="PFAM: fibrillarin; KEGG: mka:MK0560 fibrillarin-like
FT                   rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55035"
FT                   /db_xref="GOA:A7I5M4"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M4"
FT                   /protein_id="ABS55035.1"
FT                   /translation="MIRIGNILVSKGEGGVYGERMLEGYRVWDPYRSKLAALYLVGTGI
FT                   DLIPGMKVLYLGAANGTTVSHVADYVEVVYAVEFAPRPMQDLLEVARRRTNVIPIMADA
FT                   SRPEQYAPLVEAVDLLYQDVAQPDQAAIALANCAFLKPGGHLILMLKTRSVDIRKEPAE
FT                   IFRDTLDILISAGITVRESTWLAPYHQDHAAIVCTR"
FT   gene            499202..499927
FT                   /locus_tag="Mboo_0518"
FT   CDS_pept        499202..499927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0518"
FT                   /product="protein of unknown function DUF1614"
FT                   /note="PFAM: protein of unknown function DUF1614; KEGG:
FT                   sfu:Sfum_0878 protein of unknown function DUF1614"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55036"
FT                   /db_xref="GOA:A7I5M5"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M5"
FT                   /protein_id="ABS55036.1"
FT                   /translation="MPDNIRVYSAGPLTIIALLVIIGLVVIVVPLLFLGLVGKAFTNLV
FT                   GLSWLTATALVILILLCSLVNIPVWKVRKETIRMPHGAADQFPDAFAPTETGGLWETSI
FT                   AVNLGGAIIPVAMACMLLYRASSFMGGDTLYLQVAAATLIVAAIAYVLTRPVVGIGLRA
FT                   PLFVPGIAALLCGILFAQGLGLSAGVIAFVSTTFGILLGAGIAHLPIAGDLEVPQISIG
FT                   GSGMFGAIFIGCILSALIA"
FT   gene            499992..501797
FT                   /locus_tag="Mboo_0519"
FT   CDS_pept        499992..501797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55037"
FT                   /db_xref="GOA:A7I5M6"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M6"
FT                   /protein_id="ABS55037.1"
FT                   /translation="MALVSPMTRSRNPLLIFTSLALLLPINIYYGAGWIRCGLQWGLVQ
FT                   YQQTIASDHLISFTSDLCSVVSGALSGSGALSTLIWGSAVLLLIAALILNIVGIYRMQT
FT                   LCQRAAAGLTIAGGLGFLLADIVRYGVFLHGPEGWCIPIGIPAIITLGIWGIFTDFEAD
FT                   DKRGDPGGTRKGKRENGSWSLWLDDSQRNRDIVTLIVISLLVKAVVFFSGLLPNMPFTT
FT                   LTGDLTLYHWYATSPFHGIYPYVSYYVPYPQLFLVPVLLALIPVITLQNPVGYLFSFST
FT                   LMIITDTATLICLYSLACGFFGREKAFLCGLLYATAIAAAFLVPISYDAVPTFFLVFSI
FT                   WLLLSQKTVASYLSATAATLLKWFPACCFPFYLVYAWKNGHDMGMAKKSLAWSVLFAGA
FT                   VIAPFLILNASGFLNTYLSHVTRTPEVHSFVYYLDSVSQFLFLGVPSDIWFFVLLALGE
FT                   LVLFVWYFRGLDGEPFTLVCVIFASIFFFVLINKVFSASYIIWLTPFLALILVQSPWRI
FT                   VGFYLAQIVIYLETPVLFGIVYMPPTLGVSSGVTYSVMSNALPSFPFVFYTIKFGIFFA
FT                   LFWICISDLRKNGSIRKSQPPPDGH"
FT   gene            501876..502175
FT                   /locus_tag="Mboo_0520"
FT   CDS_pept        501876..502175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55038"
FT                   /db_xref="GOA:A7I5M7"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M7"
FT                   /protein_id="ABS55038.1"
FT                   /translation="MPGMFASGIFFGVSVSIFLHAFGFFPEPSSSCMSKGSGRPALKLI
FT                   GPIDFFAEQYAGVGGDQFPEPSASDSDFFRNPQAAGLVFSENPVTRTGITTDPG"
FT   gene            complement(502193..502265)
FT                   /locus_tag="Mboo_R0010"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(502193..502265)
FT                   /locus_tag="Mboo_R0010"
FT                   /product="tRNA-Gln"
FT   gene            complement(502318..503043)
FT                   /locus_tag="Mboo_0521"
FT   CDS_pept        complement(502318..503043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0521"
FT                   /product="thymidylate synthase"
FT                   /note="PFAM: thymidylate synthase; KEGG: mmp:MMP1379
FT                   thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55039"
FT                   /db_xref="GOA:A7I5M8"
FT                   /db_xref="InterPro:IPR014620"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M8"
FT                   /protein_id="ABS55039.1"
FT                   /translation="MRVIRAPSIGRAHEQVVKMILEKGRVLQTEDDEATVEFEEVALQI
FT                   DTPLAGPLVSPHSRFQQKFVEQYATDLLHGSHSSFEYDYHGRLFDWGERLFVDGVPVHV
FT                   DQIEYIATKLRQSPVSRRAIAITWNPVIDEKLNDCPCLQLVQCVLRDGKLCMRVIFRSN
FT                   DMLTAAGANMYALVQLQKSIAERLGVECGTYTHISLVPHIYYLRDMHDIEPFCGRGDLI
FT                   QPVQEVCRACGRCPRAKTA"
FT   gene            503555..506380
FT                   /locus_tag="Mboo_0522"
FT   CDS_pept        503555..506380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55040"
FT                   /db_xref="GOA:A7I5M9"
FT                   /db_xref="InterPro:IPR024277"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5M9"
FT                   /protein_id="ABS55040.1"
FT                   /translation="MTKRLTIALIALVALVLVAVLPASATYYNVNNTVNAPGGSVYIGE
FT                   QQLNIQPLVNSYPAGGAVSIGWWASAASVTSTAPSQQYNVSSLNPSSFYASPSGYGNYL
FT                   GNWYAINGSGTPNTTAAFFTVVDPSLAIDVWDINTSTTVSSGTVIQGDLLTFRINTNLQ
FT                   SAIDPNYRTSSVTPAVGSVDIQVKPSSGNTYASLFVNSTSGSSTYNTQNIRFQPVNQSL
FT                   WFWGIAGNGVPSTTATSGAGAIQYAWATGATDSTGNNAYPAGVYTVTAQSDINGQYDNY
FT                   LNGGAYYTGKTISQPVTVTIASNTVSISANVDSVVRSKPFSVTITGKPGATYHLWVKGV
FT                   SSLDGTYDNQPPIISANQVGVTFDNQSDSNAFAYFPTSSEFPLNANTAYANGNYTYQNG
FT                   VQLWNDVAHGTYGSTGLILGNGTFEYANVTLNSAGTRTIQWTTTNWTKAQQYTIRVEQN
FT                   FGGATGYKYDEVKVQVQKGAVTIVAAGSQSYYLGEEVQFSGTNTESQTTYLFITGPNLP
FT                   TQGGALWSTNPRYAGSANPGITNGNASDFQQVSVNGDNTWSWNWGTTTVALDAGTYTVY
FT                   AVSQPNDANHLSNAAYGTVSIIIKKPFVSATASQSTVAQGDPIYITGTAEGQPSQGVQL
FT                   WILGKNYALVATEAVNSDSSFSYEIKGATTSTMYSGQYFVVVQHPMQNGVFDVAPATAS
FT                   GTVTYPQNSNGASVYVWNDNPSNPGVFTANGATNDFALTGAGSLQGSDAAEALVQALNS
FT                   ANVDDTYTKLQFLVETPVITITPVGDHSVGDKFTITATTNLAVGDNVLFTVYSSSFQPT
FT                   DKTQSGEFSGASGTVAVTQGTSGLNALSFDVDASTFKPDEYLVTATAVGLPDTNNVPTG
FT                   TALFNVLQASAQTATPTPVASVTTAAVQTTVPTPVPTTATPTKTPTQPGFGALVALIGL
FT                   GAVALFVVRKH"
FT   sig_peptide     503555..503632
FT                   /locus_tag="Mboo_0522"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 26"
FT   gene            506606..508132
FT                   /locus_tag="Mboo_0523"
FT   CDS_pept        506606..508132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0523"
FT                   /product="putative thymidine phosphorylase"
FT                   /note="TIGRFAM: putative thymidine phosphorylase; PFAM:
FT                   glycosyl transferase, family 3; Pyrimidine nucleoside
FT                   phosphorylase, C-terminal domain; KEGG: mhu:Mhun_2262
FT                   thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55041"
FT                   /db_xref="GOA:A7I5N0"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017713"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5N0"
FT                   /protein_id="ABS55041.1"
FT                   /translation="MKYSVRILDIATRSGILLNYLDARNIGVLDGDRVQLINPKNSLAV
FT                   TAVVTTTSTLEGQGTAGVYRGTNRRLNLTEGEEIEIREADRPASLDFIKKKMDGGRLTK
FT                   EETLTIIKDVVNDEISAAELTAFITASYINPLDMEEVEHLTRAMVETGERIKFASRPIV
FT                   DKHSIGGVPGNKISLLVVPIIAASGLKIPKTSSRAITGAGGTADLMEVLANVEFSAREV
FT                   QEMTEKVGGTIVWGGATNIAPADDRIILQEYPFKIDARGQMLASVMAKKYAVGANLVVI
FT                   DIPVGSHTKVPTVQEGRKLAREFIELGERLGMKVECALTYGDIPVGYSIGPNLEVREAL
FT                   RVLEGATEPNSFIQKSVSLAGIALEMSGKAARGTGAQMAQDILSSGKALEKFRQIIEIQ
FT                   GGDPKVKSEDILPGEHQFVVNAPASGYIVEMNNVSLITLARLAGAPHDRGAGILLHAKK
FT                   GTLIKAGEPLFTIYAEREWRLQKAVEEGRHLVPVLVEGMLLDRVPSQSEV"
FT   gene            508190..509581
FT                   /locus_tag="Mboo_0524"
FT   CDS_pept        508190..509581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55042"
FT                   /db_xref="GOA:A7I5N1"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5N1"
FT                   /protein_id="ABS55042.1"
FT                   /translation="MNASRIRFLFALLCILAFCGAVQATNLLITVQDSLDNTSIPHATV
FT                   YLNGANVGLTNNAGQFLLQSGQGDFNLLVSMDGYDDWSEVVSSNTTALSVTLNRRSLLL
FT                   NVTLFDSNTLDPVSGATLVLTSANATQNAATDTYGSASFGVTAYTMYSLNITAPNYQPR
FT                   SESVEVDSTNQNVQYWLLSTNQYSFVIRDQNTNLPVTGASITVNSVLLGTTNSRGVLIT
FT                   PISRNVPLTIVVQKTGYQTLNQYLTIGPNEAVDSVSLIPVPVSGFVFVYDKQNQPVSGA
FT                   DVSLNGTVVATTSEYGSAALQNLAPGTYAIVVSKAGYLPANQQIDISSGSSQFPVTLSL
FT                   ATVSQTLYVQDSDQKNVAGAAVLLNGAYAGTTDTRGELDTQLVYNTTYNITVTHDGYLP
FT                   QTVQQIVPLGNTTTPLTITLQKNMDWGFVTLLGIGILIVLFIFVIIRLAGRRTPHHSSG
FT                   RRDEI"
FT   sig_peptide     508190..508264
FT                   /locus_tag="Mboo_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(509697..509768)
FT                   /locus_tag="Mboo_R0011"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(509697..509768)
FT                   /locus_tag="Mboo_R0011"
FT                   /product="tRNA-Arg"
FT   gene            509825..510268
FT                   /locus_tag="Mboo_0525"
FT   CDS_pept        509825..510268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0525"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mhu:Mhun_2260 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55043"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5N2"
FT                   /protein_id="ABS55043.1"
FT                   /translation="MILSAAEISRRLSSSHADEKLTIMPYTQECQQPASYDLRVADDIF
FT                   LARGTCTLVPSMERVEFPPDLAGTLRCRSSFGRRGVLLGGGFVDPGFRGQLTLCLTNMG
FT                   PEDIHLRKAERVVQMILHEVRNGNERYAGRYQDSTGAVGAKKA"
FT   gene            510265..511218
FT                   /locus_tag="Mboo_0526"
FT   CDS_pept        510265..511218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0526"
FT                   /product="Protein of unknown function DUF128"
FT                   /note="PFAM: Protein of unknown function DUF128;
FT                   Ribonuclease R winged-helix domain protein; KEGG:
FT                   mhu:Mhun_2259 protein of unknown function DUF128"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55044"
FT                   /db_xref="InterPro:IPR002846"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR036984"
FT                   /db_xref="InterPro:IPR038982"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5N3"
FT                   /protein_id="ABS55044.1"
FT                   /translation="MIRTERKYIEILRILKEHRDPVGAKRLSELMAERGFVLSDRAVQY
FT                   YLSYLDSMGFTEKIGNQGRILTPAGVLETDNALVDDRIGFVISKLERLAFRSTFDPATG
FT                   TGDVAYNLSFVQKDDLDRALVAFDEVNRAGCGFFNSYRILDDDPRVPSDCVGVITLCSI
FT                   TMDGLFQRNGIPVKMAYGGRLEIENNVPQRFRDLIGYRGTTIDPLELFISSGLTSIHDF
FT                   TRTKTGIALANVREVPRSAQGEIKQIIRLMNDCGFIYPVTMGNHIFNLPDSSYRLSIVA
FT                   YSGLNYIGNCVEQGIAIRTEIGAGNIPFSKVADINR"
FT   gene            complement(511223..513520)
FT                   /locus_tag="Mboo_0527"
FT   CDS_pept        complement(511223..513520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0527"
FT                   /product="Cell division GTPase-like protein"
FT                   /note="KEGG: mhu:Mhun_2258 cell division GTPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55045"
FT                   /db_xref="GOA:A7I5N4"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5N4"
FT                   /protein_id="ABS55045.1"
FT                   /translation="MRILALGMGGAGCRIAEALYANDRKSSKVTCVQALAIDVDSEALA
FT                   KLKALPDQAKIDFSALEPGIPGEMPGADPAAVDIGEVLARIQNMEHGETDAILVCCGLG
FT                   GRMADAVPRLVAALRESVTEPIFGLVTLPALSEGERRAAKAGDDIDAISPLLDGIILFD
FT                   NETWLKKIAARRDALVEELSKGPGLFGLGRNSPKLTPKEITDKLLNQSIIRRISLLLRA
FT                   GEFRADGGIDLAEVVLDSSEVLNTIRGMGFISVGYAVENISQGPLAFIARLRGTDSAQE
FT                   QRRSAERIIELAKQAIYQEVSVPCDMTSAAKALILVAGPSHEISMKGFMTVRKWLDRSI
FT                   AGMEMRSGDYPVTNSENVAIIVVLSGLENIPRITELREIRDQSRAGISRPASHSLNLPP
FT                   AGGDLRKTGGASAITTVWSGAEIQDEMITFPGERSSKGLVHRHHEEEEERALTQTPSRT
FT                   SSSSPAENLRHESVRPRIQEENLPKERLLHSPAPVRSDRSIDPVASRRILPGTPSGKSE
FT                   QMGSPSVQRFGQGATSSGHEPARPSAKRTLESGYEGSLPLRPSPVQRRTPVPQISHQDL
FT                   QKPAQPVLPERRDIASPQRDSRPSDTRAIVRKVVAKSPTHNTGSPREGGEQVQPEQPHK
FT                   MIIRHKKKEPLPEEGPERPLEYIDNTGLVRQEELEPVLGEDHISTSTPSEETKIGIRDR
FT                   PQPARDDIFLGKAIPTKAPLRAKDAALLQAELKPRKIRFVTDEENNTGESGQTSPSAFQ
FT                   KKGRLSPDDDRT"
FT   gene            513873..514859
FT                   /locus_tag="Mboo_0528"
FT   CDS_pept        513873..514859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0528"
FT                   /product="5,10-methylenetetrahydromethanopterin reductase"
FT                   /EC_number="1.5.98.2"
FT                   /note="PFAM: luciferase family protein; KEGG: mhu:Mhun_2257
FT                   coenzyme F420-dependent
FT                   N(5),N(10)-methenyltetrahydromethanopterin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55046"
FT                   /db_xref="GOA:A7I5N5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019946"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5N5"
FT                   /protein_id="ABS55046.1"
FT                   /translation="MTYGIEFVPGNVNVKQVVNFCKLAESKDIDFAWITNHYNNRHCYA
FT                   VLAAVAQATTTLKMGPGIMNSFTDTPAAMASFMCTLNEISDGRAVLGIGPGDLSTLPKI
FT                   AIHPEKPVARLEEAVIQFRKLVAGEQVNKSGLHFFDYDGAKLTGVTLPGKKGIPVYIGA
FT                   QGPKVLELAGKIGDGALINASNPKDFQVAIPIIQKAAEAVGKKGFDVGAYTAMSIDKSE
FT                   KKARNAAKIVAAFIAAGSPPELLTRHGLDLNNVAKIKAALGKFDFKTVGELVGDKEIDA
FT                   FTIAGTPEMVKAKCEDLTKAGVTQIIFGSPLGPDMTTSIRLLGKYIV"
FT   gene            515049..515972
FT                   /locus_tag="Mboo_0529"
FT   CDS_pept        515049..515972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0529"
FT                   /product="galactose-1-phosphate uridylyltransferase-like
FT                   protein"
FT                   /note="KEGG: mhu:Mhun_2256 galactose-1-phosphate
FT                   uridylyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55047"
FT                   /db_xref="GOA:A7I5N6"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5N6"
FT                   /protein_id="ABS55047.1"
FT                   /translation="MFTTTDVATKRGILQYREERFTGIRCRISPERVKRHTSQTLTFPR
FT                   DSADCPFCEQNIFSITPVFPDGKRILVGESVTFPNMFPFAEGHTVTVITRAHTVPEFTR
FT                   AQIADALRAQIESLLRYGGYPSINWNYLPSAGASILHPHMQGISDRCPTWLVERYLCAG
FT                   KEYRAKIGASYWDAVREQERSSDRFLFGDEILWSAHAVPVGEREVRGILPISSLKELED
FT                   YMEPLSEGILRIITFYRNLGTQAFNMSIYCCRDESEDFSAFCSLISRINPNPLSTSDSA
FT                   FMERMHCEPVIMTLPEEMGEMYRDQN"
FT   gene            complement(515989..516828)
FT                   /locus_tag="Mboo_0530"
FT   CDS_pept        complement(515989..516828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0530"
FT                   /product="Methylenetetrahydromethanopterin dehydrogenase"
FT                   /EC_number="1.5.98.1"
FT                   /note="PFAM: methylene-5,6,7,8-tetrahydromethanopterin
FT                   dehydrogenase; KEGG: mhu:Mhun_2255
FT                   methylenetetrahydromethanopterin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55048"
FT                   /db_xref="GOA:A7I5N7"
FT                   /db_xref="InterPro:IPR002844"
FT                   /db_xref="InterPro:IPR036080"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5N7"
FT                   /protein_id="ABS55048.1"
FT                   /translation="MVVKVGVAKLGNIASGVMAELLLDERADREDMQTFMATSGTKLQP
FT                   EDIDRVVSNMKAWKPDFAIVVSPNGVLPGPTGAREQLAAAGIPVIIITDDVTTKKEWEE
FT                   VKNSKFGYIIMKADSMIGARREFLDPIEMADFNGNLVKVLAITGAFRKLQLALDKVIDQ
FT                   VKAGKKGTEIELPKIVMTTDKAVDGEFTNDYALAKARAAHEIAIAVAGQNVKGCFMTKE
FT                   WEKYIPIVASAHEMMRIAAVLCDEAREIEKAGDGILRQPHKKDGVLVRKTKLVAKFE"
FT   gene            517024..517437
FT                   /locus_tag="Mboo_0531"
FT   CDS_pept        517024..517437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0531"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   mhu:Mhun_2254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55049"
FT                   /db_xref="GOA:A7I5N8"
FT                   /db_xref="InterPro:IPR004645"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR018384"
FT                   /db_xref="InterPro:IPR029291"
FT                   /db_xref="InterPro:IPR036657"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5N8"
FT                   /protein_id="ABS55049.1"
FT                   /translation="MDSMKDGLLTDRQMEVLRYRKQGMTQQQIADIIHTSKANVCTIEK
FT                   SAMENIRRAKETLEFLYTLDATHLCTIPSGTDLFEVPGMIFAEAEKAKIKVKYDTISLI
FT                   NRLREARPQSYKARCICEDVQIYITDDGEIYFG"
FT   gene            518067..519080
FT                   /locus_tag="Mboo_0532"
FT   CDS_pept        518067..519080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0532"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: mhu:Mhun_2253
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55050"
FT                   /db_xref="GOA:A7I5N9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5N9"
FT                   /protein_id="ABS55050.1"
FT                   /translation="MPKINRPRRGSLAFSPRKRAQSPIPKYKSWPEHSGAPALLGFAGY
FT                   KVGMTHVLMVDDHKDSPTEGKEIMVPVTIIEIPTMKVAALRVYTKDTYGKHALTEIWAE
FT                   PLDSQLSRRVTSPKNYDSTAAKKKYSDALAAGLVAEIYALAYTQPATMSGVPKKVPDLM
FT                   EIKVAGGDIAKQYEYAFGLLGKEIRLSNVIETGAYADITAITIGKGTQGPVKRWGVTLR
FT                   KRKHSVGGKERHVGTLGPWNPHHVRWEVPQSGQMGYQQRTEFNKRILKIGENGAEITPA
FT                   GGFLNYGVIRNAYVVIKGSIPGPAKRLIRIRPAIRQGEHVVRSPAIQFVSVQSKQG"
FT   gene            519087..519833
FT                   /locus_tag="Mboo_0533"
FT   CDS_pept        519087..519833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0533"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: mhu:Mhun_2252
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55051"
FT                   /db_xref="GOA:A7I5P0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR019970"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5P0"
FT                   /protein_id="ABS55051.1"
FT                   /translation="MKAQVKTIEGGVAKDIELPAMFSEEYRPDLIRKAVLALQSTRRQP
FT                   HGSYPYAGICSSAVGWGSGRGASHVPRLKNGSRAAKVPQAKGGREAHPPVTAKVLIKEI
FT                   NAKEKQKAFRSAVAASIRADLISSRGHRFEGTVPLIFEDKFENLAKTQEVISALTNIGV
FT                   YSDIERSKESRKVRAGRGKLRGRRYKQRKSLLIVTSGPEFRAARNLAGVDVVTVDQLNV
FT                   EHLAPGMQAGRLTVWTESAVIRLEGR"
FT   gene            519834..520085
FT                   /locus_tag="Mboo_0534"
FT   CDS_pept        519834..520085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0534"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: mhu:Mhun_2251
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55052"
FT                   /db_xref="GOA:A7I5P1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="InterPro:IPR019985"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5P1"
FT                   /protein_id="ABS55052.1"
FT                   /translation="MATLKHPFVTEKAMVLLENESKLQFLVDRKATKQDIKREIEKAFD
FT                   QKVKSVHTLMSMHGEKKAVVSFENAKAAEEILSRLGIM"
FT   gene            520096..520812
FT                   /locus_tag="Mboo_0535"
FT   CDS_pept        520096..520812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0535"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: mhu:Mhun_2250
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55053"
FT                   /db_xref="GOA:A7I5P2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5P2"
FT                   /protein_id="ABS55053.1"
FT                   /translation="MGHRITTQNRGRGGPTYRAPSHRYKAALKHIGDGTKSISGSIIDI
FT                   EHDPARNAPIALVQLEDGSKVYILVTEGIGIGETVAWGADVKVKNGNTLPLQSIPTGSY
FT                   ICNIESRPNDGGKFVRSTGVQAVVVDKIGDRIGVRMPSGKTKWFNARCRATVGIVAGGG
FT                   RVEKPFVKAGNKSHKMRNTASNWPRVRGVAMNVIDHPFGGGGHQHPGRPKTIARGTSPG
FT                   RTVGHVAARQTGRSRK"
FT   gene            520818..521237
FT                   /locus_tag="Mboo_0536"
FT   CDS_pept        520818..521237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0536"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: mhu:Mhun_2249 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55054"
FT                   /db_xref="GOA:A7I5P3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5P3"
FT                   /protein_id="ABS55054.1"
FT                   /translation="MAAPKKTQKRMPRRREEFTYRGYKIDELKAMGLSELIPLMPARAR
FT                   RKFNRGLNRGEETLLEKIRGGDEKIRTHLREMIVMPEMIGKSIEIYNGKEFLKVEFQPE
FT                   SVFHYLGEFALTRKRVTHGSAGIGATRGSKYVPLK"
FT   gene            521243..521707
FT                   /locus_tag="Mboo_0537"
FT   CDS_pept        521243..521707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0537"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: mhu:Mhun_2248 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55055"
FT                   /db_xref="GOA:A7I5P4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5P4"
FT                   /protein_id="ABS55055.1"
FT                   /translation="MARIAYSTKIEGDNLARGKANELSISPKHSIEIADFIRHQRVNDA
FT                   LAYLADVVALKKAIPFRHFNRNVAHKRGLPGNWDAGRYPVKASKAYIRILESIKKNAEY
FT                   TGLDTENLEIIHASANRGRAQKAYFPRAMGRASPKVRETVNIEIVVREVA"
FT   gene            521709..522404
FT                   /locus_tag="Mboo_0538"
FT   CDS_pept        521709..522404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0538"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: mhu:Mhun_2247 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55056"
FT                   /db_xref="GOA:A7I5P5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5P5"
FT                   /protein_id="ABS55056.1"
FT                   /translation="MAVERKFIAEGARKARVEKYLTKELKRAGFGGMDIARTPLGTQVT
FT                   IFAEKPGIVIGKGGKLVHQLTQDLAQNYGVESPQIEVQQVQNPSFNAQIMAERLANALE
FT                   RGWYFRKAGSSIMRRVMDSGALGCEVVIAGKLTGARARTQKFTEGYIKHCGEPSNTIVE
FT                   KGYAIAIKKLGVIGVQVKIVPADAKMPDHFAIIEQEKKLPAPKTTVTAVIETDNEEPAL
FT                   PDENIDEEV"
FT   gene            522408..522611
FT                   /locus_tag="Mboo_0539"
FT   CDS_pept        522408..522611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0539"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: mhu:Mhun_2246
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55057"
FT                   /db_xref="GOA:A7I5P6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5P6"
FT                   /protein_id="ABS55057.1"
FT                   /translation="MAILRAHDVSQLTDVELQEQMGKLRMELVQHYGKVSAGGATENPG
FT                   HIRELRRTIARLMTEKNRRSRV"
FT   gene            522608..522874
FT                   /locus_tag="Mboo_0540"
FT   CDS_pept        522608..522874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0540"
FT                   /product="Ribonuclease P, Rpp29"
FT                   /note="PFAM: Ribonuclease P, Rpp29; KEGG: mhu:Mhun_2245
FT                   ribonuclease P subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55058"
FT                   /db_xref="GOA:A7I5P7"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5P7"
FT                   /protein_id="ABS55058.1"
FT                   /translation="MISCQNVTRHELIGLDVLVAGATNPLHQGVSGHIIDETRNLVAIR
FT                   TQVGIKKIPKAGSLFRLSLPDNTLVEIHGSALILAPEKRLKRA"
FT   gene            522892..523218
FT                   /locus_tag="Mboo_0541"
FT   CDS_pept        522892..523218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0541"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: mhu:Mhun_2244
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55059"
FT                   /db_xref="GOA:A7I5P8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5P8"
FT                   /protein_id="ABS55059.1"
FT                   /translation="MAQNIGLNVQPPKQECKDVNCPFHGTLPVRGQVITGKVVSDKMMG
FT                   TVVVARDYLHYVRKYNRYEKRISKLHAHNPPCIQAKVGDLVKIAECRPLSKSTTYVVVE
FT                   VQQP"
FT   gene            523215..523613
FT                   /locus_tag="Mboo_0542"
FT   CDS_pept        523215..523613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0542"
FT                   /product="ribosomal protein L14b/L23e"
FT                   /note="PFAM: ribosomal protein L14b/L23e; KEGG:
FT                   mhu:Mhun_2243 ribosomal protein L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55060"
FT                   /db_xref="GOA:A7I5P9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019971"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5P9"
FT                   /protein_id="ABS55060.1"
FT                   /translation="MKAKQSKTPRALATGTKLTCADNTGARIVQIVSVFGYHGVRRRQP
FT                   KMGLGDIATVTVKKGTPDMRKKLVRAVVIRQKKEMRRPNGLRVSFDDNAVVVVDEKNEP
FT                   KGTEIKGPVAREVAERYPKLGSMATIIV"
FT   gene            523625..523990
FT                   /locus_tag="Mboo_0543"
FT   CDS_pept        523625..523990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0543"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: mhu:Mhun_2242 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55061"
FT                   /db_xref="GOA:A7I5Q0"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5Q0"
FT                   /protein_id="ABS55061.1"
FT                   /translation="MVRIESSQPRKQRKARYDAPSHMRSKFLNAPLSATLRETYEKKTI
FT                   RVIKGDTVKVTRGDHVGEEGIVDGIDTRNVKIIVHGVSSTKVDGTEVPRPIDASKVEIT
FT                   KLKLDDKRRVEKLGGKE"
FT   gene            523990..524715
FT                   /locus_tag="Mboo_0544"
FT   CDS_pept        523990..524715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0544"
FT                   /product="Ribosomal protein S4E, central"
FT                   /note="PFAM: RNA-binding S4 domain protein; KOW domain
FT                   protein; Ribosomal protein S4E-like; Ribosomal protein S4E,
FT                   central; KEGG: mhu:Mhun_2241 ribosomal protein S4E"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55062"
FT                   /db_xref="GOA:A7I5Q1"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Q1"
FT                   /protein_id="ABS55062.1"
FT                   /translation="MSDHLKRLNAPDSWHITKKTTKFVAKTAPGPHNANAMPVAVWLRD
FT                   QQGLARTMKEVKQILKQKDVVINGRPVRDPKMGIGIFDVIALPRIGKYFRVLRDLKGRH
FT                   KTVEIDAEAAQKRLCKIENKTIVPGGKVQLNLRYGANIIADNTYKSNDSVVISLKPEDR
FT                   FKILEHYPFVAGNMATIIGGRHSGKVARIIEIIKTPGSVPNKVILEDEKTKERFDTITP
FT                   YIYMIGKETVSKASWGLDQ"
FT   gene            524721..525218
FT                   /locus_tag="Mboo_0545"
FT   CDS_pept        524721..525218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0545"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: mhu:Mhun_2240
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55063"
FT                   /db_xref="GOA:A7I5Q2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5Q2"
FT                   /protein_id="ABS55063.1"
FT                   /translation="MRDVHIDKVVVHMGVGESGEKLVKAENIMKTITKQTPIRSVAKMT
FT                   QPAFNIRKGAPIGCKVTLRGKPAEDFIKTSLNIVNKTIFESQFDKSGNFSFGIEEHTDF
FT                   PGMSYDPQIGIFGMDINVVLERNGIRITRRRMQKKKLPEKQRVKKEDAIAFLKKEYSVE
FT                   VR"
FT   gene            525219..525374
FT                   /locus_tag="Mboo_0546"
FT   CDS_pept        525219..525374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0546"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: mhu:Mhun_2239
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55064"
FT                   /db_xref="GOA:A7I5Q3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Q3"
FT                   /protein_id="ABS55064.1"
FT                   /translation="MGGERKKIYGRGANECKMCGRKQGLVRRYHIMFCRQCFREWAQKM
FT                   GFKKMN"
FT   gene            525389..525781
FT                   /locus_tag="Mboo_0547"
FT   CDS_pept        525389..525781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0547"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: mhu:Mhun_2238
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55065"
FT                   /db_xref="GOA:A7I5Q4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5Q4"
FT                   /protein_id="ABS55065.1"
FT                   /translation="MTRLNTIADGMSALKNAGDTGKSEVTIEPASKLLGAMLRIMQDAG
FT                   YIAGFEFIEDGRGGQLKVHLTGKINKCGAICPRFSVQLDEMEYWEKQYLPGKNFGLMIL
FT                   STSHGVMSHVQARREGIGGELLGYVY"
FT   gene            525791..526315
FT                   /locus_tag="Mboo_0548"
FT   CDS_pept        525791..526315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0548"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: mhu:Mhun_2237
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55066"
FT                   /db_xref="GOA:A7I5Q5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019907"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Q5"
FT                   /protein_id="ABS55066.1"
FT                   /translation="MASVRKVRIPDGVKVKLEQSQLTITGPKGALVRSVRFPQVSVTCD
FT                   GKEITIATESGRKEITAMVGTFEAHAKNMCRGVTDGFEYRMKVVYSHFPIQLKLQGQRL
FT                   EIANFLGEKKARYADIAEGVIAKVANDEVVLTGIDREKVGNTAANIEHATHIRNRDPRV
FT                   FQDGIYMVQRG"
FT   gene            526324..527064
FT                   /locus_tag="Mboo_0549"
FT   CDS_pept        526324..527064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0549"
FT                   /product="Ribosomal protein L32e"
FT                   /note="PFAM: Ribosomal protein L32e; KEGG: mhu:Mhun_2236
FT                   ribosomal protein L32e"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55067"
FT                   /db_xref="GOA:A7I5Q6"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR036351"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Q6"
FT                   /protein_id="ABS55067.1"
FT                   /translation="MTTETKRLIRVRTEKGAVFKRHGFGTKPQLSDSWRKPRGQHNKQR
FT                   EQKKAKGNLPKPGFGSPIAVRGMHPSGFFEVLVFTEKDLENLDVKTQAIRISAGVGARK
FT                   RKALQEKAAASGIKILNARVIKERVAEEKPAEPAKEAAKAKKDAKENPAKKSASKVTSS
FT                   KKKGTEEKKPVKSAPSKAKPAAKETEKKAEKAEKPKAKESAKAPAKKPAAKEAEKKPAT
FT                   AAKKSPAEKTAPKKKSSSGVKKNE"
FT   gene            527057..527509
FT                   /locus_tag="Mboo_0550"
FT   CDS_pept        527057..527509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0550"
FT                   /product="Ribosomal protein L19e"
FT                   /note="PFAM: Ribosomal protein L19e; KEGG: mhu:Mhun_2235
FT                   ribosomal protein L19e"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55068"
FT                   /db_xref="GOA:A7I5Q7"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR015973"
FT                   /db_xref="InterPro:IPR015974"
FT                   /db_xref="InterPro:IPR023638"
FT                   /db_xref="InterPro:IPR035970"
FT                   /db_xref="InterPro:IPR039547"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Q7"
FT                   /protein_id="ABS55068.1"
FT                   /translation="MSDVASQKRIAASILKCGVNRVWFDPERLSDIQNAISREDLRGLI
FT                   TDGAIKAHQKKGVSRGRARVRTAQRAYGHRKGAGKRKGAQGARTPSKRSWIQKIRAIRK
FT                   VLVTLRDEGTIDRHLYRVLYRKAAGGQFRSVAHMKAQMEIIAGRLK"
FT   gene            527511..528035
FT                   /locus_tag="Mboo_0551"
FT   CDS_pept        527511..528035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0551"
FT                   /product="ribosomal protein L18P/L5E"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG:
FT                   mhu:Mhun_2234 ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55069"
FT                   /db_xref="GOA:A7I5Q8"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5Q8"
FT                   /protein_id="ABS55069.1"
FT                   /translation="MATGPRYLVAFRRRREGRTDYYQRTKLVVADAPRMVVRRTNRHII
FT                   VQLVTAEMEGDKTLVSANSAELEKYGYTGATANTPAAYLTGLLFAAKAKKAGQDSAILD
FT                   IGLNRATPGARVFAALKGAVDGGLEIPYGESILPSEDRLKGEHIAAYNEKAGDIVKNVE
FT                   QVAAAIKKELV"
FT   gene            528036..528653
FT                   /locus_tag="Mboo_0552"
FT   CDS_pept        528036..528653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0552"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   mhu:Mhun_2233 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55070"
FT                   /db_xref="GOA:A7I5Q9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5Q9"
FT                   /protein_id="ABS55070.1"
FT                   /translation="MAYEKAEWRPVTGLGKQVASGEIKSIDQVLESGRPIKEPEIVDMF
FT                   LPDLEDEVLDIAMMQRMTDSGRRVQFRAVVIVGNRNGYIGFGQGKDVQVGDAIKKAITK
FT                   AKMNLVKVRRGCGSWECGCAVLHSIPMQVEGTAGSVRVTLKPAPQGIGLVTGDISKKVL
FT                   ELAGIKDAWTFARGQTRTTINFAKATFNALKETNMIRTGRSE"
FT   gene            528654..529118
FT                   /locus_tag="Mboo_0553"
FT   CDS_pept        528654..529118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0553"
FT                   /product="ribosomal protein L30P"
FT                   /note="TIGRFAM: ribosomal protein L30P; PFAM: ribosomal
FT                   protein L30; KEGG: mhu:Mhun_2232 ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55071"
FT                   /db_xref="GOA:A7I5R0"
FT                   /db_xref="InterPro:IPR005997"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5R0"
FT                   /protein_id="ABS55071.1"
FT                   /translation="MYAVVQVRGVVNTRKDIKDTLKMLRLHHINHCVLVADTPENLGMI
FT                   RKVKDYVAYGEVDAATLETILKTRGRVIGDDPLTDEYIKSNSSTYSSIVEFAQALAKGE
FT                   SRLRDIPGLKPVLRLHPPRKGYKTTKRTFVQGGALGYYGPEINTLLYKMR"
FT   gene            529123..529551
FT                   /locus_tag="Mboo_0554"
FT   CDS_pept        529123..529551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0554"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mhu:Mhun_2231
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55072"
FT                   /db_xref="GOA:A7I5R1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR027386"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R1"
FT                   /protein_id="ABS55072.1"
FT                   /translation="MPTNKRSKYRGSRTCGGGTHKNRRGAGNRGGRGRAGINAHHFVKW
FT                   YVEMGGPVFGKDGFFHNPATSVSAMDVGIIDQIVPSLLAQGIAKQEGDAVAINAADIGI
FT                   EKVLGSGRVIRKLNISAAAFSAQAKAKIEKTGGKAQVI"
FT   gene            529577..531010
FT                   /locus_tag="Mboo_0555"
FT   CDS_pept        529577..531010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0555"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: mhu:Mhun_2230 SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55073"
FT                   /db_xref="GOA:A7I5R2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R2"
FT                   /protein_id="ABS55073.1"
FT                   /translation="MGDLLDRMEPILAAMPAVKSPEGHVHFKNKLLWTLGILILYFALT
FT                   NIQLFGLAPSSQDLFTAWRALLAGANGSIVYLGIGPIVTASIVLQLLKGADILHIDTSE
FT                   ARGQVMYMGLQKILILVMIVIEAAPNLIGGFMQPDPTIAAQFFGGNLFAVSLLIFIQIC
FT                   IGGVLIFLMDEVVTKWGIGSGVGLFIIAGISQALVNGFINWTAVSDPYPVGFFPRLVAV
FT                   VLDGANFLQYFGTNLLAFATTIIIFLIIVYVESTRIEIPLAHAQVRGARARFPVKLIYA
FT                   SVLPMILVRVLQANIQMIGMFLSNIGITILGKFNGQTPQGGLMYFLAPINGPTDWMWWT
FT                   TDLGHAPWEVLLRMGIDTTFMVVGGAIFALFWIKTAGLDSKDVARQIQLSGMSIPGYRR
FT                   NPQVLEKYLDRYIPRVTIIGGVFIGILSVVANLFGVIGAVSGTGLLLTVSITYRLYEEI
FT                   ASQQIMEMYPFMRTFFGKE"
FT   gene            531032..531604
FT                   /locus_tag="Mboo_0556"
FT   CDS_pept        531032..531604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0556"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: mhu:Mhun_2229 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55074"
FT                   /db_xref="GOA:A7I5R3"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R3"
FT                   /protein_id="ABS55074.1"
FT                   /translation="MAGKKVIITGVPGVGKTTVINEALAKLKSEGVDYQPINFGSFMFE
FT                   VAKNEGLVANRDQMRTLDRADQKRLQQHAAQAIAKIPGNVMIDTHASVKTPKGYLAGLP
FT                   EWVLRELMPDVIILVETDNDQILMRRLTDDTRNRDKEGARSISEHQEFNRSIAAAYAMM
FT                   TGCTIKIIINSDHLLDFAAAEMADVLR"
FT   gene            531629..532240
FT                   /locus_tag="Mboo_0557"
FT   CDS_pept        531629..532240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0557"
FT                   /product="protein of unknown function DUF106,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF106,
FT                   transmembrane; KEGG: mhu:Mhun_2228 protein of unknown
FT                   function DUF106, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55075"
FT                   /db_xref="GOA:A7I5R4"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR038978"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R4"
FT                   /protein_id="ABS55075.1"
FT                   /translation="MDFGKFWEKYGLYVALLFMFVMMWTYTVPWLRTGVGKGIDGVFAP
FT                   VVTEFNIPFFILIVILSALTGLYSSIIQKYTIDYERMTEVQDRMKEFQKEYREAMLSQD
FT                   EKRIKKLDVKKDRMMKEQLELSQQQFKPMGYILVLTVPIFFWLLYRLQEATTTITLPYY
FT                   GTLSLTAPLIWVIPVWMVWYMICSITISQVIRKSLNIGGI"
FT   gene            532243..532791
FT                   /locus_tag="Mboo_0558"
FT   CDS_pept        532243..532791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0558"
FT                   /product="cytidylate kinase, putative"
FT                   /note="TIGRFAM: cytidylate kinase, putative; KEGG:
FT                   mhu:Mhun_2227 cytidylate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55076"
FT                   /db_xref="GOA:A7I5R5"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5R5"
FT                   /protein_id="ABS55076.1"
FT                   /translation="MRITVSGLPGSGTTSLSRYLSERYGFTMISAGEVFRQCAKEHNME
FT                   LAEFGRLAEKDPAYDKMIDARQKEIAEKSDNIIVEGRLSGWMVENADLKIWLFAPISCR
FT                   LDRIVFRDQIADVETAKAITLEREHCEAIRYQQYYSIDINDHSVYHLILNSEHWGVDDL
FT                   GKIVAAAIDQLKKTPFAAS"
FT   gene            532984..533412
FT                   /locus_tag="Mboo_0559"
FT   CDS_pept        532984..533412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0559"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mhu:Mhun_0456 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55077"
FT                   /db_xref="GOA:A7I5R6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R6"
FT                   /protein_id="ABS55077.1"
FT                   /translation="MNSDYEIRVDLASIWDPADIVALYRAGGWWKDEYDPGEIPRLIRG
FT                   SFAFAVAVDPAKGKAVGMGRVISDGVSDAYVQDIVVLPEYRNRDIGTRIVALLLETCQR
FT                   AGLTWIALIAEPGSEVFYLPLGFSRMVGHVPLIYRGEA"
FT   gene            533412..534350
FT                   /locus_tag="Mboo_0560"
FT   CDS_pept        533412..534350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA1791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55078"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R7"
FT                   /protein_id="ABS55078.1"
FT                   /translation="MLSQEDFRPVTLADRAFFERHYARYPQSHSDNTFTNMVCWNHIAQ
FT                   YRYAYVNGSVILASTLFGVTRFRPPIGPRDPDLMRDVIRFAMEFADDTPMVLIDPETAR
FT                   WMKELDPSLTLVPDRNHSEYVYLASDLAELPGKHYLKIRNQINKFRKNCSHTIEPVTGE
FT                   NREEVMQFLVKWCEWKGCENDLVLAHEKDAVFYAIEHFTELPLRGLMIRVDSQVAAISL
FT                   FERLNEDTALVHFEKGLPDCEGIYKAVNQATAALLVHEVKYINRESDLGVAGLREAKLR
FT                   YHPHHMVDVWSLKSKEDASASNRTSLQVSEL"
FT   gene            complement(534423..535046)
FT                   /locus_tag="Mboo_0561"
FT   CDS_pept        complement(534423..535046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0561"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: tac:Ta0019 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55079"
FT                   /db_xref="GOA:A7I5R8"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R8"
FT                   /protein_id="ABS55079.1"
FT                   /translation="MIRSIDMTDIISGIIYAFAALFIILDPILSVPIFAGMTKGQSARE
FT                   IHKQAFIAVAVAGILMYIFLVFNTAIFSVLGLTLSTFQIAGGILLFLLGMEMALGIDLC
FT                   KSKEQVPTAAGVVIGTPLLCGPGAITTVMLLSNDYGILIPFIAISLSLAATWVILYYSA
FT                   AIQNILGTVITDIMGRVLGMLVAGIAVKIIFSGIIGTLGLSIHI"
FT   gene            535253..535840
FT                   /locus_tag="Mboo_0562"
FT   CDS_pept        535253..535840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0562"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   tma:TM0659 rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55080"
FT                   /db_xref="GOA:A7I5R9"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5R9"
FT                   /protein_id="ABS55080.1"
FT                   /translation="MPGTRKSTGSAGKKPASRAKPPATSSARPKKAAAATTTVAAKKSP
FT                   VAKKTKAGSAKPGTKSPAKKIPAYKLKRYRCRLCGYVYSPLRGEPHNGIPAGTPFEDLP
FT                   EDYVCPVCGYEGRGKIGKWGFDEWAPTRYICSICGYVYDEKRGEPHRGIKPGTKFDDLP
FT                   DDYKCPVCAQDPKINVQFGKVLKQGFEPLYTG"
FT   gene            535989..536444
FT                   /locus_tag="Mboo_0563"
FT   CDS_pept        535989..536444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55081"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S0"
FT                   /protein_id="ABS55081.1"
FT                   /translation="MHNSQDPVMQQKREVLARFLGVGTADLRVSNGHLYGFKAFFYGND
FT                   AAYLVLSDAEATRAAENSVQEKLWLICLESLFAYFDIDSTPPDLVGKIKTKEIRQANEE
FT                   IKKLIHHTCGMEPLKKRMLAFGNRKNLLADYDQAEHYLDGFFIYRLY"
FT   gene            536581..537189
FT                   /locus_tag="Mboo_0564"
FT   CDS_pept        536581..537189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0564"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   mba:Mbar_A2604 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55082"
FT                   /db_xref="GOA:A7I5S1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S1"
FT                   /protein_id="ABS55082.1"
FT                   /translation="MDTAALLEEAHRLARIGRYNEALAEYDKALESDPSNTTALERKGG
FT                   VFYALGRHEDALACYDRALAINPHLLTTWYEKGYTLRKIGRYVEAITCFEQALALDPEY
FT                   MLALANKGYALNELGRFDQALACFERLLETSPSNIRAMTAKGIALTGLGRNKEALATFD
FT                   QAIGLNAINSFVWQHRAEALRRLGRTAEAEESLRHISGT"
FT   gene            537918..538226
FT                   /locus_tag="Mboo_0565"
FT   CDS_pept        537918..538226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55083"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S2"
FT                   /protein_id="ABS55083.1"
FT                   /translation="MGVWQLNSSSHSPDKDKDQDPDQDQVRTNLVENWTFYPDGTFAES
FT                   HTSVGSDMPPIYDNGIWTYLGNSSYVVSMNGEEMHLIRTGNILTNEDDQCVFNRIES"
FT   gene            complement(538311..539348)
FT                   /locus_tag="Mboo_0566"
FT   CDS_pept        complement(538311..539348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0566"
FT                   /product="tetrahydromethanopterin S-methyltransferase, MtrH
FT                   subunit"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, MtrH subunit; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, MtrH subunit;
FT                   KEGG: mhu:Mhun_2175 N5-methyltetrahydromethanopterin"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55084"
FT                   /db_xref="GOA:A7I5S3"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S3"
FT                   /protein_id="ABS55084.1"
FT                   /translation="MFKFEKEQKVWDFNGTKIGGQPGEYPTVLGASIFYNKQEIVLDDH
FT                   TGKIDKVKAEALWNRCQELSDLTGVPHFIQIIAEYGEAFESYFSWFDSIDNKTAFLMDS
FT                   SAPKALAHACKYVTEVGLAHRAIYNSINGSIPPENVEALKNSDVDAAIVLAFNPGDPSV
FT                   AGREKVLTEGGVAGQTKGMLQIAEECGITRPILDTAATPLGLGSGGSYREILACKAIHG
FT                   LPTGGAYHNMTVSWTWLKRWKGTSKTPSVQAAGYKGKDALLEQMGHHYIGGMDGMRQAA
FT                   WSAPDIGCNMIASTLGADLIMYGPIENVEAMITAQAYTDITVLEATRQLGVECKSESHP
FT                   IFKLI"
FT   gene            complement(539364..540104)
FT                   /locus_tag="Mboo_0567"
FT   CDS_pept        complement(539364..540104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0567"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit A"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit A; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, subunit G;
FT                   Tetrahydromethanopterin S-methyltransferase subunit A, N
FT                   terminal domain protein; KEGG: mhu:Mhun_2174
FT                   tetrahydromethanopterin S-methyltransferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55085"
FT                   /db_xref="GOA:A7I5S4"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR005866"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S4"
FT                   /protein_id="ABS55085.1"
FT                   /translation="MADKKSPATGWPLVKGDFHSGDANSPVAVITMGSHLDEQGICDAG
FT                   AAMCGSCKTENLGLEKVIANYIANPNIRFVLLCGTEVKGHLSAQSLVALHKGGVKDGRI
FT                   VGAEGAIPFIENLNDAAIKRFQEQVSIVNIMETEDLNAIKAKINELKAKDPGAFAADPL
FT                   VVEVKEAAAGGAEVAAAGANPQFLEIEKRLDKIEKRLEFVDAEVAQRVGRKIGRDIGIL
FT                   YGLVAGLVVFVMLLFMLQKLMALV"
FT   gene            complement(540116..540316)
FT                   /locus_tag="Mboo_0568"
FT   CDS_pept        complement(540116..540316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0568"
FT                   /product="tetrahydromethanopterin S-methyltransferase, F
FT                   subunit"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55086"
FT                   /db_xref="GOA:A7I5S5"
FT                   /db_xref="InterPro:IPR013347"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S5"
FT                   /protein_id="ABS55086.1"
FT                   /translation="MAEEEKSAGPVRMVAIDNMVENVRYKSQILARTNKVESASSTNGL
FT                   IAFVAGLLVAVILIVVPALLI"
FT   gene            complement(540322..541047)
FT                   /locus_tag="Mboo_0569"
FT   CDS_pept        complement(540322..541047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0569"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit A"
FT                   /note="TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit A; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase subunit A, N
FT                   terminal domain protein; KEGG: mhu:Mhun_2172
FT                   tetrahydromethanopterin S-methyltransferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55087"
FT                   /db_xref="GOA:A7I5S6"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S6"
FT                   /protein_id="ABS55087.1"
FT                   /translation="MADKKSPASGWPLVKGDFHSGDANSPVAVITMGSHLDEQGICDAG
FT                   AAMCGSCKTENLGLEKVIANYIANPNIRFVLLCGTEVKGHLSAQSLIALHKGGVKDGRI
FT                   VGAEGAIPFIENLNDAAIKRFQEQVSIVNIMETEDLNAIKAKINELKAKDPGAFAADPL
FT                   VVEVKEAAAGGGEEAGGEVRPISGEMALITARIKVIEKMVTDIGYRDRFAAGVYAGKIE
FT                   GLMIGLIVSFALIGFMWVG"
FT   gene            complement(541049..541342)
FT                   /locus_tag="Mboo_0570"
FT   CDS_pept        complement(541049..541342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0570"
FT                   /product="Tetrahydromethanopterin S-methyltransferase
FT                   subunit B"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase
FT                   subunit B; KEGG: mhu:Mhun_2171 tetrahydromethanopterin
FT                   S-methyltransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55088"
FT                   /db_xref="GOA:A7I5S7"
FT                   /db_xref="InterPro:IPR008690"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S7"
FT                   /protein_id="ABS55088.1"
FT                   /translation="MGYVVVLPEFGLVADPVVGIVTTAGESLSPVLDKVAILEASADDL
FT                   VNMLSGEGNYVASFPGREKTLAIGGSINAFWYGLAIGLLVAGVIAFQLIKVS"
FT   gene            complement(541344..542195)
FT                   /locus_tag="Mboo_0571"
FT   CDS_pept        complement(541344..542195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0571"
FT                   /product="Tetrahydromethanopterin S-methyltransferase,
FT                   subunit C"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase,
FT                   subunit C; KEGG: mhu:Mhun_2170 tetrahydromethanopterin
FT                   S-methyltransferase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55089"
FT                   /db_xref="GOA:A7I5S8"
FT                   /db_xref="InterPro:IPR005865"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S8"
FT                   /protein_id="ABS55089.1"
FT                   /translation="MTVKVEVIEGGVPHNKILIAGVIATLVCLYLSYLNVLTNTEMFSF
FT                   FGGLAAVAALIWGSHTIKVLCSYGIGTGVPSAGMIAFGSGVIAMLLATKFGVAAPIVAL
FT                   VLAAVIGLILGYLANEVLNMKIPAMIQALTELAIVGALTIMGFAVLITGSFTFTGLTTG
FT                   SVTLFGALSMPSYQLSFIGGGLTAVAFLLGSIAIQHPFNACLGPGWKQDRMLMLTAECG
FT                   FLSMIVAAIMSFALVSAGSAIISLIIALIGWVYTYCEYIRLSKRDAYAWLDSKPIPDVE
FT                   GH"
FT   gene            complement(542205..543038)
FT                   /locus_tag="Mboo_0572"
FT   CDS_pept        complement(542205..543038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0572"
FT                   /product="Tetrahydromethanopterin S-methyltransferase,
FT                   subunit D"
FT                   /note="PFAM: Tetrahydromethanopterin S-methyltransferase,
FT                   subunit D; KEGG: mhu:Mhun_2169 tetrahydromethanopterin
FT                   S-methyltransferase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55090"
FT                   /db_xref="GOA:A7I5S9"
FT                   /db_xref="InterPro:IPR005779"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5S9"
FT                   /protein_id="ABS55090.1"
FT                   /translation="MTAVAAKPAAGSAINPTAMVIGIVMLIILLGIAYVVSPGLGLMAL
FT                   IGVVIGGVLIGFGVHFVPVGGAPAAMGQAPGIATGVAMLAAGAGLAGLFGGAWAADQGF
FT                   VIAIITGGVGGGMMMAITCMMVNFVYIFGMGIPAASGKVLKDPITGDSQPEYKSQGTEG
FT                   HGLPFVSFVGGVLGGVLGGAGGTLIYLELLSLYKATLPNIMSISAAQALPIAVATAGIF
FT                   AIGMFLVNSVLTAYNITGTIEGPHDPKFKRWPRSVVASAVASALCGLVAILIVTF"
FT   gene            complement(543035..543940)
FT                   /locus_tag="Mboo_0573"
FT   CDS_pept        complement(543035..543940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0573"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit E"
FT                   /EC_number="2.1.1.86"
FT                   /note="KEGG: mhu:Mhun_2168 tetrahydromethanopterin
FT                   S-methyltransferase; TIGRFAM: tetrahydromethanopterin
FT                   S-methyltransferase, subunit E; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55091"
FT                   /db_xref="GOA:A7I5T0"
FT                   /db_xref="InterPro:IPR005780"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T0"
FT                   /protein_id="ABS55091.1"
FT                   /translation="MVDNIVFGIGITALAGALATVAGSAEDTESNIGSQGDPNSQVQLA
FT                   PQMGFVHRIFNKAVAGEPPAYGLWCALGAGLAWAFLAMQINAVLAIVLGSLLAVFVQGI
FT                   YATTAYLGRTASLSKFGQPVYVDILKSMTTVAMAHAFVAVFCTVTICYLINVALGHPFP
FT                   LPLLGFIWGITLGAAGSATGNPYYGKERQYQNQKFGAGVPISASGNIVRYAEAGERNSI
FT                   DNGFFTAKFGGPASGLCFGLIVFLELWRTILFDKIGAGWGAIIVGVLIILVFTVVDRYI
FT                   EVWARKNYGPYTAPVKEAAP"
FT   sig_peptide     complement(543866..543940)
FT                   /locus_tag="Mboo_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.480 at
FT                   residue 25"
FT   gene            complement(544356..544859)
FT                   /locus_tag="Mboo_0574"
FT   CDS_pept        complement(544356..544859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55092"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T1"
FT                   /protein_id="ABS55092.1"
FT                   /translation="MADFVQNHSVKCAIRMLAGPIPDIGVLNAIVQSVIVHNPFGCSAY
FT                   MTRNGHQAPVKKVRETYTARIAYRDSTAKTVGVASETYNTVAGFNDGVVALLANTANTA
FT                   AHKGNPVRTPDADSYSATLRCHDPTGEIYYVNLSRRQVTLSSYEDERIRTRIENWADSV
FT                   PALG"
FT   gene            complement(545091..546620)
FT                   /locus_tag="Mboo_0575"
FT   CDS_pept        complement(545091..546620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0575"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: pfu:PF1829 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55093"
FT                   /db_xref="GOA:A7I5T2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T2"
FT                   /protein_id="ABS55093.1"
FT                   /translation="MTLLDEVNTLVNKTYNSIAVPNIIESKVVHFAKTGTHQFENYEIA
FT                   IIDTPIVQRLRYISQLGLAYSVFPTARHTRFEHSLGVSIMVDKMFKSLEENHQLEHIRD
FT                   RNIRKNNYIELRIAGLLHDIGHGPFSHVSEIIMSEYEPIEKEAIKEGCKPHELLAYKML
FT                   QTEKFQNFFAELNKHYKIDISPSNIANYIIGKVDNPKDDQYLADLINGQCDADKLDYIA
FT                   RDSNFTGVKLALGIDRLLLSLGVDKISCFDGMKRKLIVNEKGLMPLEQILIAKIMLNYS
FT                   IYLHQKVRAIDYMIIPLLRKIVREKKEISGHTIKSPLDFLLIDDYDILNFASSDTETSN
FT                   LCKSIKMRKIFKRSLVISPKTIDRKRTDNFQDLFLDLIKYSEKPQDMLNLNQNLIERIG
FT                   ENCTQFDVAIDLPKTPKLGELDQKIIKLHDGFVAVSEDIKTGWLESYLANKWKGHIFSN
FT                   EKYRQRAQDKGIELFEEEFGLKFNEFATKDAKITFEYKKDSRDLSDFGIGL"
FT   gene            complement(546627..547016)
FT                   /locus_tag="Mboo_0576"
FT   CDS_pept        complement(546627..547016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55094"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T3"
FT                   /protein_id="ABS55094.1"
FT                   /translation="MVLAIDKTRIFPDDKIRIILKYAFEERKNTHFTFNDEKLHTIIYK
FT                   AKQVHPELFEEFNFRMNGTYPYSQLLERIIHRAKISRVIKTENPDFSEIQIRENSKNYV
FT                   EQNLQPKIDSTDLSILKDLGHQLSS"
FT   gene            complement(547271..547504)
FT                   /locus_tag="Mboo_0577"
FT   CDS_pept        complement(547271..547504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55095"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T4"
FT                   /protein_id="ABS55095.1"
FT                   /translation="MYTKKVNIGRAGPGPREKRETAQVPKITGGGGGGGYPLPLIRKKP
FT                   GHPPPFKYKKRAIRIFQNNPNISHSRRRFHAK"
FT   gene            547616..547999
FT                   /locus_tag="Mboo_0578"
FT   CDS_pept        547616..547999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0578"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mac:MA2011 glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55096"
FT                   /db_xref="GOA:A7I5T5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T5"
FT                   /protein_id="ABS55096.1"
FT                   /translation="MPNLTHFMIPADDVDRAKRFYAALLNWKIDPVVPSRDPGGIAAMQ
FT                   YHEITTGPVEPGALNTGGLYKRHQKEPILSFVRVEDIEGVVSKVEMLGGKIMMPVSEIP
FT                   GVGLTAMILDTEGNLIGIWTPIE"
FT   gene            548155..548742
FT                   /locus_tag="Mboo_0579"
FT   CDS_pept        548155..548742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0579"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   ava:Ava_2799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55097"
FT                   /db_xref="GOA:A7I5T6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T6"
FT                   /protein_id="ABS55097.1"
FT                   /translation="MRRLAASSNEPVTVVRIHYVKAGCEPQFEAELRKYMGAFTSIPAN
FT                   LGITIFRPGEYHDGIYRLVYKFASRDALDAWHATPIYRAWLETEKTLTIAPPHTEELSG
FT                   LETWFTLPGQNVLRPPTKARQAVVTWIAALPVSIIITLVTDPFLDNQPFLVQKVVFITL
FT                   LVIILTWGVMPLATRLFARWLYSDSYPPMGSD"
FT   gene            complement(549105..550274)
FT                   /locus_tag="Mboo_0580"
FT   CDS_pept        complement(549105..550274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0580"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mhu:Mhun_1560 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55098"
FT                   /db_xref="GOA:A7I5T7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024018"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T7"
FT                   /protein_id="ABS55098.1"
FT                   /translation="MKNPFHVMIIPTLGCPSKCKYCWSSEEGSPIMSVETVHEIVVWLQ
FT                   DIPRDRVTFTFHGGEPLLAGADFYRQALPLLADGLAQMHPEFAMQTNLWRMTPEIADAL
FT                   AAYRVPIGSSIDGPEAITDSQRGDGYYQKTMKGYGIAKAHGLDVRFICTFTNKSVKNKE
FT                   EIFQFFLDKGFTLKLHPALPSIRSENPKEWALEPSEYGELLVYLLDQALDHMGEIEVMN
FT                   INDLCRCVFVRRGSVCTYVDCMGSTFAIGPDGSIYPCYRFVGMPEYVMGNVADRPSLET
FT                   LMESPAGKLMLAFKDYVDTACAECKHIKYCRGGCPYNAMAPTPGRIEGVDPHCTAYTRI
FT                   FDEIGDRLNREMFAAPPMEMGGFGMPSVQKPAKKEKPGVMTLMRRNAMR"
FT   gene            complement(550358..551068)
FT                   /locus_tag="Mboo_0581"
FT   CDS_pept        complement(550358..551068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0581"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   mhu:Mhun_0901 protein of unknown function DUF169"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55099"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T8"
FT                   /protein_id="ABS55099.1"
FT                   /translation="MSSEKIAVNYHEASESLKKILNLKGSPVAIRFAPTKADIPAGIPA
FT                   LDKTIRHCSMVNMARMEQKIFYATADRHDCNGGAWSLGLKEITPTLKNGEFYFKLGKFD
FT                   SDAACKRTIERIPHLETGETYATLYAPLETTPFSPQVIVIVTTPRNMLKLAQSSLFRLG
FT                   GRICAEFAGIQSVCADATAYPFLSGRPNFSLGCDGSRRFSGIGDDELVMGFPAEMLPEL
FT                   VTALPIVTGAAGSK"
FT   gene            complement(551246..552931)
FT                   /locus_tag="Mboo_0582"
FT   CDS_pept        complement(551246..552931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0582"
FT                   /product="Coenzyme-B sulfoethylthiotransferase"
FT                   /EC_number="2.8.4.1"
FT                   /note="PFAM: methyl-coenzyme M reductase, alpha subunit
FT                   domain protein; KEGG: mhu:Mhun_2148 coenzyme-B
FT                   sulfoethylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55100"
FT                   /db_xref="GOA:A7I5T9"
FT                   /db_xref="InterPro:IPR003183"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR015811"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR016212"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5T9"
FT                   /protein_id="ABS55100.1"
FT                   /translation="MAKAKIERTQKLFLKAMKEKFAEDPQATSTVFARAGLEQSPRKME
FT                   FLKEGQKVALDRGISMYDPKRCHCGGIPLGQRQLMTYEVSGTGVFVEGDDLHFVNNAAM
FT                   QQMWDDIRRTIIVSLDLAHGTLQKRLGKEVTPETINEYLHVLNHAMPGAAVVQEHMVET
FT                   HPALVDDCYVKIFTGDDEMADDIEPQFVLNLDKLFPAKQAAALKAAVGKSMWQAVHIPT
FT                   TVSRTCDGGTTSRWSAMQIGMSFIGAYKMCAGEAAVSDLAFAAKHAGVIQMADILPARR
FT                   ARGPNEPGGIKFGHFGDMIQADRKYPNDPVKATLEVVGAGAMLFDQIWLGSYMSGGVGF
FT                   TQYATAAYTDNILDDYCYYGLDYVKKNHGGLGKAKLTQEAVSDIASEVTLYGMEQYEQY
FT                   PTALEDHFGGSQRASVLAAASGISASLGTFNSNAGLNAWYQSMLLHKEGWSRLGFFGYD
FT                   LQDQCGSANCMSVRPDEGCLGELRGPNYPNYAMNVGHQGEYAAIASAAHYGRQDAWVLS
FT                   PLMKITFADPSLKFDFSEPRREFARGAIREFMPAGERSLIIPAR"
FT   gene            complement(552938..553702)
FT                   /locus_tag="Mboo_0583"
FT   CDS_pept        complement(552938..553702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0583"
FT                   /product="Methyl-coenzyme M reductase, gamma subunit"
FT                   /note="PFAM: Methyl-coenzyme M reductase, gamma subunit;
FT                   KEGG: mhu:Mhun_2147 methyl-coenzyme M reductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55101"
FT                   /db_xref="GOA:A7I5U0"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U0"
FT                   /protein_id="ABS55101.1"
FT                   /translation="MAYKPQYCPGQTQVAENRRKQLDPNHKLEKIRDVTDKDLVLIMGH
FT                   RAPGSAYRAVHPPLSEQQEPACPIRKIVTPTDGAKAGDRVRYIQFSDSMYNAPCQPYQR
FT                   SWLESYRYRGIDPGTLSGRQIIECRERDLEKYAKELVNTELFDPALTGVRGCTVHGHSL
FT                   RLDENGLMFDMLQRCILDKKSGVIKYVKDQVGVPLDSEVKVGKAQDEKWLKSHTTMYHS
FT                   LVGTGFRDDAEYVEYIQRIHALRVKYGFMPKE"
FT   gene            complement(553710..554348)
FT                   /locus_tag="Mboo_0584"
FT   CDS_pept        complement(553710..554348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0584"
FT                   /product="Methyl-coenzyme M reductase operon protein C"
FT                   /note="PFAM: Methyl-coenzyme M reductase operon protein C;
FT                   KEGG: mhu:Mhun_2146 methyl-coenzyme M reductase operon
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55102"
FT                   /db_xref="GOA:A7I5U1"
FT                   /db_xref="InterPro:IPR007687"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U1"
FT                   /protein_id="ABS55102.1"
FT                   /translation="MPIGRVTQVVDCREAMGMGKGGGLAQRGTISECRYPDVIVVGMSP
FT                   GRRHVTKPVCDITSGLRQQGVEYSISTLVLNAGSGVPPDAPNIAGGVIGAYFGLTDKEI
FT                   VQIERHKVAILHHGNVRSHVVAKVRYVLEACDVKAIVVSQSPIDYEDLAKEGVKTAMVM
FT                   PPADKIRTKGTVMAIISGVTRGQTPTREKMAEVISSVMRIVKKKEPTLE"
FT   gene            complement(554348..554818)
FT                   /locus_tag="Mboo_0585"
FT   CDS_pept        complement(554348..554818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0585"
FT                   /product="Methyl-coenzyme M reductase, protein D"
FT                   /note="PFAM: Methyl-coenzyme M reductase, protein D; KEGG:
FT                   mhu:Mhun_2145 methyl-coenzyme M reductase, protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55103"
FT                   /db_xref="GOA:A7I5U2"
FT                   /db_xref="InterPro:IPR003901"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U2"
FT                   /protein_id="ABS55103.1"
FT                   /translation="MTEATFPQCRIVTERLLNPETTELLLNRLVDIPGIRRMVLNGPRL
FT                   PAIVTYGPAKGMPNPHSMRRAIHVGDQDMDLQVHVGTVLLEVESRDVIPALKAACEEVF
FT                   THFAFRIQEGKYMKTEPSLVDYCKYGPDADKSVLGLADPSSKSRPTIIQGIK"
FT   gene            complement(554836..556149)
FT                   /locus_tag="Mboo_0586"
FT   CDS_pept        complement(554836..556149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0586"
FT                   /product="Methyl-coenzyme M reductase, beta subunit"
FT                   /note="PFAM: Methyl-coenzyme M reductase, beta subunit;
FT                   KEGG: mhu:Mhun_2144 methyl-coenzyme M reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55104"
FT                   /db_xref="GOA:A7I5U3"
FT                   /db_xref="InterPro:IPR003179"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR022679"
FT                   /db_xref="InterPro:IPR022680"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U3"
FT                   /protein_id="ABS55104.1"
FT                   /translation="MAKYKDTIDLYDDEGKLLKSNVTIDKISPLTNKGALELIDLTKRT
FT                   VAVNLGGIEEALKTGKMGGKSNQILGRGLNYSIVKDADAISAKIKDMIQVTDGDNTKIT
FT                   KIGGGKMLLVEVPSSRINASATYDATSTSVASATTYALIDQYKVNMFDGSYVKGAVWGT
FT                   YPQTMDMQGGNVVSILSIPQNNEGLGYALRNIPANHAVMMTHRNAMQGAALSATFEQAG
FT                   EFEMGAAIGPFERAQLLLYAYQGLNANNIVYDLVKKNGKTGTIGTVVQSLVERAIEDKV
FT                   IKAGKKGKSGYIFYDTKDPMLWNAYASAGTLAATMVNCGAGRFAQAVSATLLYFNDLLE
FT                   HETGLPGSDFGRAMGVAVGFSFFSHSIYGGGGPGGFNGNHVVTRHAAGVGMPCIVAACA
FT                   LDAGTQMFGPEATSKVYQDTFGQIDAFKRPIQTIAKGV"
FT   gene            complement(556535..556993)
FT                   /locus_tag="Mboo_0587"
FT   CDS_pept        complement(556535..556993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0587"
FT                   /product="methyl-viologen-reducing hydrogenase, delta
FT                   subunit"
FT                   /note="PFAM: methyl-viologen-reducing hydrogenase, delta
FT                   subunit; KEGG: mhu:Mhun_1839 methyl-viologen-reducing
FT                   hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55105"
FT                   /db_xref="GOA:A7I5U4"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U4"
FT                   /protein_id="ABS55105.1"
FT                   /translation="MSAPGDFPIPKRGPGFWQPKILGMVCNWCSYAGADLAGGGRIQYP
FT                   PDVRIIRVMCTGRFDALFVLKAFADGADGVLISGCHFGDCHYLEGNYKAAKRMFMVKRL
FT                   MKSIGLDDRRFRMTFVSASEGAKWGKVITDVVKTINELGPSPITENQQ"
FT   gene            complement(556994..559078)
FT                   /locus_tag="Mboo_0588"
FT   CDS_pept        complement(556994..559078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0588"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1838 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55106"
FT                   /db_xref="GOA:A7I5U5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U5"
FT                   /protein_id="ABS55106.1"
FT                   /translation="MKQEVKKQAPAPAAAASAPAAAGSTTKQEARIGVFICHCGTNIAG
FT                   SMDIPAVEEYAKTIPNVAYVDNYKYMCSMPGQTVISKAVHEHKLTGVVVAACTPRLHEP
FT                   TFRTATKDAGLNPFRFEMANIRDQNSWVHMHDREGSTEKAKDAVRIAVAKAALLQDLYP
FT                   KSVPVEKTAMVVGAGVGGMQAALDLAAAGIKTYLIESDMSIGGRMSQLDKTFPTLDCSQ
FT                   CILTPKMVDVGRSDKIELMTWSEVHEVEGYIGNFDVTIRKKARGVMTPKEAEARGIVGG
FT                   GCNGCGDCDTVCPVVKPNEFEIGMKPRKAIYINHPQVVPLIYTIDFNTCVKCGLCVTAC
FT                   GPEKRAIDLEMKDEFIKVKVGTVILATGYDIFPIEKKEEWGYKRYENVITSLEFERLIC
FT                   ASGPTGGHLVRPSDGETPKRIAFVLCAGSRDNTGIGKPYCSRFCCMYSLKHAHQITEKI
FT                   PGAIPYIFYMDIRSFGKMYEEFYYRIQDEGAKFIRGRVANILEDPKTKNLHVYADDTLL
FT                   DRPVDMEVDLVVLAAAIQPKEDTNRTRKLFGVSCSMDGWLLEAHPKLNPCGTTTAGVFL
FT                   AGVCQGPKDIPDTVAQAEGAASAASIPIHMGEVELEPYFAMCIEEKCAGCGMCVNLCPY
FT                   SALSLVEKDGRTVMQVTEAKCKGCGTCGGFCPGGAIWMQHFTTPQIVAQIDAFLLGGEQ
FT                   "
FT   sig_peptide     complement(559010..559078)
FT                   /locus_tag="Mboo_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.918 at
FT                   residue 23"
FT   gene            complement(559162..560085)
FT                   /locus_tag="Mboo_0589"
FT   CDS_pept        complement(559162..560085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0589"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein; KEGG: mhu:Mhun_1837
FT                   protein of unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55107"
FT                   /db_xref="GOA:A7I5U6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017678"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U6"
FT                   /protein_id="ABS55107.1"
FT                   /translation="MSESKANHTFALYLGCIAPNRYPGVESAAIKGCKKLGIDLVPLKG
FT                   ASCCPAPGAFGSIDLNVFYAMAARNLVLAEQMKTDIALVCNGCYKSIWEVNHKLKHNQD
FT                   LRDGVNEVLKEVDMEFKGTINVYHLAELLYNDKYAGVAKIKDTVVNPLTGARIAVHYGC
FT                   HLTKPHKDREFEKEVMLNTEHPVWMEELVAALGATPVEYRNKMQCCGAGGGVRGYDIVH
FT                   SLDITNEKLINLKEVKVDALTDICPFCQLQFDRGQIEIQEKFGVSYGLPVLHFAELLGL
FT                   AQGMSPQELGLDLHAISCEPFLQKVL"
FT   gene            complement(560092..560673)
FT                   /locus_tag="Mboo_0590"
FT   CDS_pept        complement(560092..560673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0590"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: mhu:Mhun_1836 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55108"
FT                   /db_xref="GOA:A7I5U7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017680"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U7"
FT                   /protein_id="ABS55108.1"
FT                   /translation="MVRTKGYPEALEKKLHDQRYYREDSTADFMKRVEASSRTIAHMCY
FT                   QCGTCTGSCPSAPRSTYRIRKFMRRAVLGFETEALTDPDLWLCTTCYSCTDRCPRDIAP
FT                   TDVIMSMRNMAFTHDIIPVNFLKTVTAIYASGHGVPNNDVNRAAREKLGLTRDPPTTHM
FT                   YPEYMPAIRKILDHYHLKENADRIIKEREG"
FT   gene            complement(560686..561858)
FT                   /locus_tag="Mboo_0591"
FT   CDS_pept        complement(560686..561858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0591"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1835 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55109"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U8"
FT                   /protein_id="ABS55109.1"
FT                   /translation="MALFPKFSKKRDGVNVVMEQRLLQNVNNLILNSETCTGCGICVDA
FT                   CPEEAIVLGLVGASRRGAINYATPIDVDETKCSYCGVCVIMCPFNALTLKVDNQERLPI
FT                   LEKEGFPQYDMKAEINEEKCVRCTICEEVCPRDAIDRNVPAYEGTYKGPVAGAKDRQTA
FT                   LKAKTTFTVDKEKCTTCGICGALCPAIRVKHKEYTAEIGKVEGDVIWDETKCDACKVCV
FT                   EACPQECITVEREIVSDKLDGKVSIVQDNCCTCTWCSRNCPSEAITVEKIFEGDIEFHA
FT                   EKCPGGCSTCAEICPANAIYLPSEKPAAEMGHHIEASIAVNKDYCILCGACVNACPGED
FT                   IIILKRTGIRTKGKETDLFRKIKDKLFTKRTSKVKESVAGQVGIKLMEKA"
FT   gene            complement(561882..562148)
FT                   /locus_tag="Mboo_0592"
FT   CDS_pept        complement(561882..562148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0592"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mhu:Mhun_1834 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55110"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5U9"
FT                   /protein_id="ABS55110.1"
FT                   /translation="MVFAVQIKTYHRTGCSNCVVACPVDALELHPVVPEQTEPICTVRE
FT                   SVPTLPGCNEVLPARCRVCVQMCPHDNIRLTGPWETRAKAKVQ"
FT   gene            562418..563302
FT                   /locus_tag="Mboo_0593"
FT   CDS_pept        562418..563302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0593"
FT                   /product="Formylmethanofuran--tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /EC_number="2.3.1.101"
FT                   /note="PFAM: formylmethanofuran: tetrahydromethanopterin
FT                   formyltransferase (Ftr); KEGG: mhu:Mhun_1808
FT                   formylmethanofuran--tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55111"
FT                   /db_xref="GOA:A7I5V0"
FT                   /db_xref="InterPro:IPR002770"
FT                   /db_xref="InterPro:IPR014053"
FT                   /db_xref="InterPro:IPR022667"
FT                   /db_xref="InterPro:IPR023447"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V0"
FT                   /protein_id="ABS55111.1"
FT                   /translation="MEINGVTIDDTYAEAFPTWVCRVIITAVTKDWALKAATEATGFAT
FT                   SAIGCPCEAGIESILSGSETPDGRPGVSILICASKKKLKEQVVERLAECVLTAPTTAVF
FT                   NGITDAEEKIPVKLHFFGDGYEYQKEVGGRKCWVIPIMNGEYVGEEEFGIVKGVAGGNF
FT                   FIMGENQMAALVAAEAAVDAIDEVKGVITSFPGGIVASGSKVGSLKYKFMPASTNEKYC
FT                   PTLREKVADTKIPAGVKAVYEIVIDGVDEKSVAAAMGAGVRAAVKVPGVKFISAGNFGG
FT                   SLGPFKIELFKVI"
FT   gene            563336..564352
FT                   /locus_tag="Mboo_0594"
FT   CDS_pept        563336..564352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mth:MTH1391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55112"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V1"
FT                   /protein_id="ABS55112.1"
FT                   /translation="MESYKYFIAESSVNENFGDNMIILTPGDVKQRFGPLFSKKFLVMV
FT                   DETAGRAEILEQCHARGTIEWDAMNRSRAGGAVAACAVEGSTMTIQARLGRYPVNFGAA
FT                   AGTIGGQALEAVEVNGDEVITTWAGIAGAGVGIAACLPQAPGVIRAEYPSEDDLKVGGA
FT                   RTNHVRIVSPLYEKVSFGIDDTDTKQEGATWVMALKCAEACLLEGVEFLDMRLIQLNPA
FT                   VPHKTTNCVGSALNFAARPGSIGALREFVCTFVEEHTFSKDTGIAFSRGIRTGQESPFH
FT                   AAIKTEILTVQKAEEEAQRLGIEFLDHNGRKGRIGALGAVLWADRGIEAAGLYGEHL"
FT   gene            564336..565232
FT                   /locus_tag="Mboo_0595"
FT   CDS_pept        564336..565232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0595"
FT                   /product="domain of unknown function DUF1743"
FT                   /note="PFAM: domain of unknown function DUF1743; KEGG:
FT                   mhu:Mhun_1804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55113"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR017674"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V2"
FT                   /protein_id="ABS55113.1"
FT                   /translation="MVNISDPYVIRYPQIVAVADESGSSVELVEFFDCIGGAMWTQHHY
FT                   AKSPLVTGVRCVGSSTRFLLRPGTVDLALEGSRFPAGISGVSVTGDEIAVTYIGMGGGG
FT                   VGATSCRAAARGVLREQCDPSGGGKVASATLWLPRRQRLLIGVDDTDTAEAGATWTLVH
FT                   NIARAVEDEQSAYLSHTIVQLFPVAYRTKNCVSLVTEFATTEPERLIERFRELLQKYTL
FT                   SQKTGMAVYTGFSPSDELVEYGRSVKRGEVAPDRVQNIRDPRLRIVMNGRGITGAVAAL
FT                   PFFTRYEEALELCSGKN"
FT   gene            565214..566182
FT                   /locus_tag="Mboo_0596"
FT   CDS_pept        565214..566182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0596"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mhu:Mhun_1803 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55114"
FT                   /db_xref="GOA:A7I5V3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V3"
FT                   /protein_id="ABS55114.1"
FT                   /translation="MQWEELKAQLLEAGSARLSGEPAEDYIAQSTAGPGAGGKGAVFFT
FT                   MGSHRVKFAINPTSPIEIVHRGNGVADLYFGERQIPGNLLRPGLHCPDQAFITVTEGCI
FT                   FSCRYCSVPQMPARRKTVEEIMGLVESVRHRISAISLTSGVMGSIEEEEAYVCEVIDHL
FT                   RFFSLPIGVSVYPTDQTPGRLRALGVAEVKFNIETATPDLFAKICPGLDYNHVWQVLDR
FT                   SVELFGKGRVFSNVIVGLGETDAEMEACINQLASHGVIPVLRPLNPVAGCAGMPRPPAD
FT                   RLRRLFSIHRQALARAGLDTAGALTMCTTCAGCDLVPGRDE"
FT   gene            566179..567450
FT                   /locus_tag="Mboo_0597"
FT   CDS_pept        566179..567450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0597"
FT                   /product="indolepyruvate ferredoxin oxidoreductase alpha
FT                   and beta subunits-like protein"
FT                   /note="KEGG: mhu:Mhun_1802 indolepyruvate ferredoxin
FT                   oxidoreductase alpha and beta subunits-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55115"
FT                   /db_xref="GOA:A7I5V4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V4"
FT                   /protein_id="ABS55115.1"
FT                   /translation="MKGTEALAAAISSGTDRQYTVPGYPITELGALTGAELVINEKTAL
FT                   EYALGDSLAGRRAAVIVKHVGMNACADPLVQATVQGIRGGVLLVAGDDPESKGSQTAQD
FT                   SRYYGELAELPVIEPDENTCFTGVEAALTASETFSRVALLRLTPHLLDAEVDGEPVPRN
FT                   NKSGRIADPALTMHGRATAANEIYRAMFAWSDVSPLNRWKGGTLGAGSAPGDSRIVTVN
FT                   PVSSRAREISEIHEIGRPFVRDHRTVAAPGPQGKPESRNDRGFSRTFCITCPYLPLLRL
FT                   LKERGMQVICDAGCSVFSLNPPYELGLASYGMGASIAVAARSTHVALIGDYALLHSGIN
FT                   ALIDVYEKRRPLLCIVMKNHCAAMTGGQTVSDPVPYIRWADPVVCPAGDEHRLREVIRA
FT                   PDAPMTVVVEADCPKGAHHETVEC"
FT   gene            567431..568561
FT                   /locus_tag="Mboo_0598"
FT   CDS_pept        567431..568561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0598"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   mhu:Mhun_1801 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55116"
FT                   /db_xref="GOA:A7I5V5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V5"
FT                   /protein_id="ABS55116.1"
FT                   /translation="MKPWNVEICDVTLRDGEQTPGVSFSCEEKVDIARTLDRIGIEVIE
FT                   AGFPAVSENEKKCVKTIAGLGLDSRICGFARAKKEDIATAIDCGVDMVSIFIPTSDLHV
FT                   RVKFKKPRENVLEDALAMIDFARDQGVAVRFAAEDASRTDAAFLKEVYGKAADHGAVLL
FT                   SFADTVGCLIPDEMRTIMTDLVSSVDRPFCAHCHNDMGCAVANTITAAQAGAFQLHTTV
FT                   NGIGERSGNASLEEVLVILRTKGGIDRYDLSHLTALSRKVEKYSGIALPKNKPVTGELA
FT                   FSHESGIHIAAILEDPATYEYFLPDMVGSERHFILGKHTGRKALEHVLSSLGENLSETQ
FT                   VCRVLDLVKEHSEQKCNITPEILRKLIRQAQREVSS"
FT   gene            568558..569769
FT                   /locus_tag="Mboo_0599"
FT   CDS_pept        568558..569769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0599"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: mhu:Mhun_1800 3-isopropylmalate dehydratase;
FT                   TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55117"
FT                   /db_xref="GOA:A7I5V6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V6"
FT                   /protein_id="ABS55117.1"
FT                   /translation="MSTLSERILGAAAGEYVDRKVDRAYAHDGTGVLALEAWKEMGRDR
FT                   MGKETGYYIQFDHIAPANNGLTATLQHELRNFAKRSSMHFSDVGCGICHQLMAEGEVLP
FT                   GEIAVGADSHTVMLGAFGAFATGVGATDMAAIWLTGETWFRVPESVGIHLTGNLTGAAE
FT                   AKDLALAYVGKLGTDGATYQALEFIGEGVRHLSMDERFVLSNLSVEAGAKAGLFYADEV
FT                   TLRYLKEHGLDTVSQEYESCSYCRELDFDLTDIVPLVSVPHRVDTVKPADAVAGVPLDQ
FT                   VFVGTCTNGRYSDLARFARLVKGKKVAVRTLVVPASAAILEKAIRTGVLADIVAAGCTI
FT                   GTPGCGPCLGYHMGVLGEGEICLSTANRNFKNRMGVGAEIYLGSVATAAASALVGEIAS
FT                   PEVG"
FT   gene            569769..570239
FT                   /locus_tag="Mboo_0600"
FT   CDS_pept        569769..570239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0600"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   mhu:Mhun_1799 3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55118"
FT                   /db_xref="GOA:A7I5V7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V7"
FT                   /protein_id="ABS55118.1"
FT                   /translation="MQGKGPAICLPGDIDTDLVIAGRYLRTKDKSVWATHVLEDLDPTL
FT                   APRLKGAVIVAGKNFGCGSSREQAAFALREAGVIAIIAPSFGRIFFRNAINIGLPLIES
FT                   TLTCTEGTPVAFDLSAGWVDTEGKRHAIRPLSARMQEILEAGGLVEYWRAHQ"
FT   gene            570236..571036
FT                   /locus_tag="Mboo_0601"
FT   CDS_pept        570236..571036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55119"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V8"
FT                   /protein_id="ABS55119.1"
FT                   /translation="MIFPEHCKFVGVAAEKPCGDRVYVLSRYLLRETEGGYELLEVVLD
FT                   PAQDRVMREIISSRVLATPAEIFSYPEKVQLNDRTRLVRLAQESGYRCTVFTGLEENMT
FT                   FVLDPDLSGFLTLHVYDVLPPRPTLSASLKEMEALGLFGELSVIFDHHIRDITTVPADV
FT                   YPCRAAGYTRTLDADPLRGGERVAGCLTAQQFCTECYGTDFTLENICPLEQIAEEPFIA
FT                   RCCRAEREGVGTWNGKFGAIVHWGASPAKIARSVQEVVSRWSAR"
FT   gene            571033..572010
FT                   /locus_tag="Mboo_0602"
FT   CDS_pept        571033..572010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0602"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: mhu:Mhun_1797 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55120"
FT                   /db_xref="GOA:A7I5V9"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5V9"
FT                   /protein_id="ABS55120.1"
FT                   /translation="MTRIAIVEGDGIGHEVIPVAHQALELLHPEYDYFPVDVGYGRWEQ
FT                   TGCPCADADIAALKTADAVLFGAVTTPPMRDYQSVVLRIRKALDLYANLRPVKSDGFDI
FT                   LIVRENTEGMYSGIEEIGPDRATTLRVVSRTGTERIVRAAIRCAGQRRGKLTIGHKANV
FT                   LKSDVFFRDICIAEAQNAGVEYNDKYIDALGLDILQHPGAYDVVVTTNIFGDIISDVSS
FT                   YLVGGLGLVPSANIGDRYALFEPVHGSAPDIAGKNIANPIAALRSAAMLLAHIGDQEGA
FT                   ERIESAIGTVISSGILTRDIGGSAGTWEFGEAVLKALGNCPVGR"
FT   gene            complement(572069..572425)
FT                   /locus_tag="Mboo_0603"
FT   CDS_pept        complement(572069..572425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0603"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55121"
FT                   /db_xref="GOA:A7I5W0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W0"
FT                   /protein_id="ABS55121.1"
FT                   /translation="MRRGVHLAIGVLAFCLYAGLESQLYGMSPGLVFLGLCAVFTGSLM
FT                   PDLLERPTSSRHRGFFHSKRALTGSAAVFCLAALLFLLPEIPYRTVIYALSAFTLGYLL
FT                   HLCADSLTRRGLPA"
FT   gene            complement(572693..573175)
FT                   /locus_tag="Mboo_0604"
FT   CDS_pept        complement(572693..573175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0604"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1260 protein of unknown function
FT                   UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55122"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W1"
FT                   /protein_id="ABS55122.1"
FT                   /translation="MAFRCQQCGECCSYMGEIIGIEERIDPVRFRIRFSVTGEERRVTL
FT                   DPDKADLFCTQDIMAIRPMACPFLRFHKPHEACCTVHGTRPDLCRQYDCFRVLILDREG
FT                   VPCGKVPDRSRVLSTQDAGLHGIWRQEVAGVDIPSESAWEAHVEEVFSRAGYRVVR"
FT   gene            573492..574064
FT                   /locus_tag="Mboo_0605"
FT   CDS_pept        573492..574064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55123"
FT                   /db_xref="GOA:A7I5W2"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5W2"
FT                   /protein_id="ABS55123.1"
FT                   /translation="MDIGTFWSVAAIPLLILVARIAEASLESVRTIYISKGHANLAAYV
FT                   GIVKTGIWLISTGLVLTDLMQFWNLFAYLAGYGMGTVLGMEIENLISIGYVIVRLITPS
FT                   DPQALMSRLSTLGYGMTRIEGTGSFSGSVSIIFMIVPRKELSRLLSIISREYPDLLYTI
FT                   EDVRNIKDGARIFYQDPKRRILSFFGM"
FT   gene            574137..574628
FT                   /locus_tag="Mboo_0606"
FT   CDS_pept        574137..574628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0606"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: sfu:Sfum_2571
FT                   methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55124"
FT                   /db_xref="GOA:A7I5W3"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W3"
FT                   /protein_id="ABS55124.1"
FT                   /translation="MIQNTPKTEGGAGVVPIFDPETGRVEERTVIQKTDAEWQAQLTPE
FT                   QFSVARKQGTEYAFTGKYHDCKAPGTYCCACCGTPLFSSDTKFDSGTGWPSFSAPVSPL
FT                   NVRTHTDRSNGMVRTEVLCARCRAHLGHVFDDGPKPTGKRYCMNSAALDLHVAPGEKTC
FT                   "
FT   gene            574724..575281
FT                   /locus_tag="Mboo_0607"
FT   CDS_pept        574724..575281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0607"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   mhu:Mhun_0168 protein of unknown function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55125"
FT                   /db_xref="GOA:A7I5W4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7I5W4"
FT                   /protein_id="ABS55125.1"
FT                   /translation="MDLLTSSLIGIGLSMDCFAVALAIGTSERLPLVRSALVIAASFGI
FT                   FQAGMTIAGWIAGASLYTEISSYGSWIAFLLLAGIGIKMIYDGIREEHEPTLSGLHAIP
FT                   VILLSLATSIDAFAAGVSFGVLGSTVLMPALAIGLVCFVVSCAGVFCGMRLEKLLGNRT
FT                   EIFGGVILILIGIQILTDILPL"
FT   gene            575355..575945
FT                   /locus_tag="Mboo_0608"
FT   CDS_pept        575355..575945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0608"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; KEGG: lip:LI0571
FT                   dsRNA-specific ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55126"
FT                   /db_xref="GOA:A7I5W5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W5"
FT                   /protein_id="ABS55126.1"
FT                   /translation="MKSMEKKENLAELERIIGYHFFEQQHLIRALTHSAYANEVIQKNR
FT                   ICLTQDAYSTLGDAVLKTSLILFLMEKGLQEKGAITRAKEQLEDNASLAQIGRRLKIRR
FT                   FVRLGRGEKDLWKSGEDTILADTVEAIIGAVYLDSDASLGVVRQCIGAWLEPELARVRR
FT                   EEPPREKVRVPPFSISRRARPRGTKRRSQQSSK"
FT   gene            complement(575866..577110)
FT                   /locus_tag="Mboo_0609"
FT   CDS_pept        complement(575866..577110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0609"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: cac:CAC1852 magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55127"
FT                   /db_xref="GOA:A7I5W6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W6"
FT                   /protein_id="ABS55127.1"
FT                   /translation="MGYERSHRGSTLPPARGHVYPRRIAIRKQHRYAPDLTGETQEMPF
FT                   MPEQGTPSEEPQDTQKEPSPQAMSPGPLNFCIILTRDGRIDRLIDRPLEEYFAALPEAS
FT                   IAWIDYSTKDDAGEIERIAQQAGFSKLPIPKLSTGFYSAYEDYDTELGIMLPSVTMKND
FT                   NMTVHPLFVLIRENFILTVHSEDINRLLRFSRYAQPFFKRISSACTCDKITLMLERIID
FT                   ENNDRNFEYLREIEMHGDAISKSLIEENIAKRQIAHRIYRMKHVLIDYLNVLWATKDVI
FT                   NSLQYGDADLITNDEKLLGRIGILSDNIERHIELSEQMSNVLASGLEVMQSIYNNQLQS
FT                   LNNRFALVTAYLTVLGTAFLVPNTIATIAGSGVMGGQMAAQWWYIPLLATSTIVATAVS
FT                   FLWVVHVWRSRKEEL"
FT   gene            577141..577629
FT                   /locus_tag="Mboo_0610"
FT   CDS_pept        577141..577629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0610"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mac:MA0616 2-cys peroxiredoxin, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55128"
FT                   /db_xref="GOA:A7I5W7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W7"
FT                   /protein_id="ABS55128.1"
FT                   /translation="MEQQQLIRTGDPARNFELKDQNDSTFDLFEQSGKKVLLSFHPLAW
FT                   TPYCSAQMKSLEENRDILASLGTMAVGLSVDTVPCKKAWAENLGITHTPLLCDFWPHGH
FT                   VAMTYGIFRDANGFSERANIIIDENRKVTFVKIYPLHSVPDIQEIITFLQHPTNLRAS"
FT   gene            complement(577689..578168)
FT                   /locus_tag="Mboo_0611"
FT   CDS_pept        complement(577689..578168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55129"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W8"
FT                   /protein_id="ABS55129.1"
FT                   /translation="MPIPARMVGTKTGDCVVVGVASGEEEEAACRVGCALAVIEVVGIV
FT                   VGGTVAGVPFTESAAVPAAAVVAKGTVVEEAVVTVVVTEEMDVAFVVAVGTGALAIDPT
FT                   IADTGIATAKARTRVHNRIRFNEKCGVIREHWMPGDMRIMERGLQIPSSTDEVSG"
FT   gene            complement(578246..580168)
FT                   /locus_tag="Mboo_0612"
FT   CDS_pept        complement(578246..580168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0612"
FT                   /product="Porphyromonas-type peptidyl-arginine deiminase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; Porphyromonas-type peptidyl-arginine
FT                   deiminase; KEGG: mhu:Mhun_0034 porphyromonas-type
FT                   peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55130"
FT                   /db_xref="GOA:A7I5W9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5W9"
FT                   /protein_id="ABS55130.1"
FT                   /translation="MPETTRTIALIQMEIGPDPDRNLNEARERVEKAAQNGAQFICLPE
FT                   LFRTRYFPQQIGTPVQSLAETIPGESTDVFTRIAKEYKAVIIVPVFERSPLGHLENAAV
FT                   VIDADGSLHAPYYKVHIPQDPKFFEKGYFYPGNHYAVHATRYGKIAVLICYDQWFPEAA
FT                   RCVSLEGAEIIFYPTAIGNPCTEQPSEGDWQEAWEIIQRSHAIANSVHIAAVNRAGGEG
FT                   NIRFFGGSFICDAFGKVLARAGDANETITATADLELNESIRDSWGFFRNRRPDTYGAVC
FT                   ARVPEHDATAPIPRKGDTPRKLGYSMPAEWEPHEAVWLSWPHNKFTFPDLDRVEEAYIR
FT                   FIAGIAPSERVELFVPTPMANRMVKARLRTAGVDLSRVTLRTIQYADVWIRDYGPTFVV
FT                   NPALKRSAMVHWRFNAWGEKYPDQIADGHVPDDMNRWLGLPVFTPGIILEGGSIDTNGR
FT                   GTVLTTQACLLNRNRNPELTKDEIEEYLKEYLGVVKILWLNRGVAGDDTDGHVDDIARF
FT                   VSPTTIVCAYEENPKDENYAALNENYEILRAATDQEGNPFTIIKLPMPAPVMSEEDRCP
FT                   ASYTNFYIGNTVVIVPVFDDPQDKEALRILQELFPDRTVMGVNARAMVEGYGTFHCATQ
FT                   QQPRT"
FT   gene            complement(580316..581425)
FT                   /locus_tag="Mboo_0613"
FT   CDS_pept        complement(580316..581425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0613"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: aba:Acid345_4575
FT                   ABC multidrug efflux pump, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55131"
FT                   /db_xref="GOA:A7I5X0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X0"
FT                   /protein_id="ABS55131.1"
FT                   /translation="MMPGILKSAIAIFRRDIKKFLSNPFIIMMTLLMPIMYLVVFGNAM
FT                   GGTLTHIPVGVVQEVPPYNDTPLFTSAAYQLNHISQGSNNDAEKLLDVTVYTDEVQAKQ
FT                   DLANGKISAVVVFPASVSNDNAVRLYVDSSDSVTPSLVEEAVTSVLQGLGANNPITVDK
FT                   IYGDIKYIQFFGVGVIMMAIFSATSFGGGLALIRDRENGIHEGYLVTPIKRSSIVVGII
FT                   ASGTVRAFVAGFTIFWIDLLVTGIILQSFQDFLLVLLVIFIACVGVTSLVVSFASRFSA
FT                   QQEYQSVIVFLNLILFMTSGAFYPVTGMPGWLRWITTINPEYYGVNALRSIILRNQGLN
FT                   VIGIDLIALLIFSTAMIILGVVTYRRTLE"
FT   sig_peptide     complement(581285..581425)
FT                   /locus_tag="Mboo_0613"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.890 at
FT                   residue 47"
FT   gene            complement(581422..582546)
FT                   /locus_tag="Mboo_0614"
FT   CDS_pept        complement(581422..582546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0614"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mbu:Mbur_0389 daunorubicin resistance ABC
FT                   transporter, ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55132"
FT                   /db_xref="GOA:A7I5X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X1"
FT                   /protein_id="ABS55132.1"
FT                   /translation="MPLFGHKKDLVPAAPAFPESPTGTSVSPFGNPQVHQVSTDGSEII
FT                   RIEHLSKVFKSKIKTVIAVNDVSFEVKRGEIFGLLGSNGAGKSTLIRILTTLLAPTSGQ
FT                   AFVNNYDITRDPESIRAIIGVCPQNYTSDLELTAYDNLEFYGKLQNVPDSTLPARIMEL
FT                   LTMAGLADRAYMPVATFSGGMKRKLEIVRAFIHRPLILFLDEPTIGLDPEARREVWQQI
FT                   MMLNRENTTIILTTHYMDEAEKLCGRIAFVERGKLIALDTMENLRKLIPAGDLIEISID
FT                   HMDPLAEEEIRTLDLVNAVTVVEHNVTISATNGSQAILSILGVFDKYRIPVISISIRSP
FT                   SLEDIFIYLTGKGLDNGSGEENDAAGPGGRRRGP"
FT   gene            complement(582552..582995)
FT                   /locus_tag="Mboo_0615"
FT   CDS_pept        complement(582552..582995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0615"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: bcz:BCZK3880
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55133"
FT                   /db_xref="GOA:A7I5X2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X2"
FT                   /protein_id="ABS55133.1"
FT                   /translation="MTQDMRDRTADALLALIPLYYKNVIRHRPPIAGIQLAQVHTLGIL
FT                   TKAGSLTMSEIGSRLYISRPYMTRLADQMIADGLVERRPDPDDRRVIKLAITEKGKKYL
FT                   RQSITWFKNDLKKNLSGLSDSDIGKLCTALEDTYRILSSLQAG"
FT   gene            complement(583145..583777)
FT                   /locus_tag="Mboo_0616"
FT   CDS_pept        complement(583145..583777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0616"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rru:Rru_A1198 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55134"
FT                   /db_xref="GOA:A7I5X3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X3"
FT                   /protein_id="ABS55134.1"
FT                   /translation="METGAFINGIIIGIALAAPVGPIAFVCIQRSLAYGRLHGIASGLG
FT                   IATADTIYAAVTAFGLALISDFLLARQWFFRLFGGLALIVVGIKIFLAGPPEISPAPES
FT                   ESFITDYSTMLAITLANPLTIVFFTIIIPGFGVVLSGTTGVTPALFVTGVFLGEIGWWI
FT                   FLCGTLGSMREYLTRERLHLINRLAGFVIAAFGGVMIASLFITSDIL"
FT   gene            complement(583937..584185)
FT                   /locus_tag="Mboo_0617"
FT   CDS_pept        complement(583937..584185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55135"
FT                   /db_xref="GOA:A7I5X4"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X4"
FT                   /protein_id="ABS55135.1"
FT                   /translation="MPAAQTNDGEMGMYTDFLSVGMVTVIGLMAGTAIGIFIGYLAKLQ
FT                   RPSWADMTNREKKLNIVLVIACSAICITGLAWRFLLN"
FT   gene            584334..585401
FT                   /locus_tag="Mboo_0618"
FT   CDS_pept        584334..585401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0618"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55136"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X5"
FT                   /protein_id="ABS55136.1"
FT                   /translation="MISLRFYRIYDIGREIDIDWLEKSLARNYFTARTSFVRVKPKSIM
FT                   IESSPLLIRMLPVTVEREGRSYEFSAVARVYDIGVISLCFIYDDEQADHRELEEIAFRF
FT                   AGQEGLSDFFLQYLNTLGEIIKPHIKNFAIDPDFYEDYTIYVTDRRDDTIDPVPLLLGD
FT                   RTCVSPQIREDIIKNSLSYSNEDLAVISWDSALLCGPESPTDIIDLIEFANVQVLELRY
FT                   YDRELTREMARMYDDIEHADRLSWFNRGGQYHAIMKHQMKTSAEISETIEKVDNLIKVT
FT                   EDVYYARVYAAALKILRSGQWSESVSRKIDVIRENYSMLSDEVRIQHSHFLEWVVILLI
FT                   AFEIVVMLWERVFAG"
FT   gene            585923..586522
FT                   /locus_tag="Mboo_0619"
FT   CDS_pept        585923..586522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0619"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: mhu:Mhun_1937
FT                   TspO and MBR like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55137"
FT                   /db_xref="GOA:A7I5X6"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X6"
FT                   /protein_id="ABS55137.1"
FT                   /translation="MGVADPAEGDEEPLPLFALRPAPAPTGIFIIPVSHHSPMNMPRSR
FT                   TAILFIACIALPLIVGVAGSVFTVGSIAGWYVGLNKPVFTPPAWVFAPAWTVLYILMGC
FT                   ALFFVVKEGTGTSLARQGLILFFAQLALNFGWSLVFFGIHAVAAALAVLLLLIVLIAAT
FT                   TLVFRRISVPAAWLLVPYLVWCCFAASLNAGILLLN"
FT   gene            complement(586643..586810)
FT                   /locus_tag="Mboo_0620"
FT   CDS_pept        complement(586643..586810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55138"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X7"
FT                   /protein_id="ABS55138.1"
FT                   /translation="MYMQTNENKIRRIRDKLTRIGIKETDITDEKLLASYDISATGQLC
FT                   GVKSPHPREP"
FT   gene            complement(586899..587294)
FT                   /locus_tag="Mboo_0621"
FT   CDS_pept        complement(586899..587294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0621"
FT                   /product="translation initiation factor eIF-1A"
FT                   /note="KEGG: mhu:Mhun_2969 translation initiation factor
FT                   eIF-1A; TIGRFAM: translation initiation factor eIF-1A;
FT                   PFAM: S1, IF1 family protein; SMART: Eukaryotic initiation
FT                   factor 1A (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55139"
FT                   /db_xref="GOA:A7I5X8"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X8"
FT                   /protein_id="ABS55139.1"
FT                   /translation="MDMLIICNDVYIHGVGGITDNNKKKADTGFEETGAVNPDGTPVVR
FT                   VRLPKKWNNEMFGSADLMMGANHIRVRCFDGVTRMGRIKGKIKKRVWIREGDTLIIVPW
FT                   NFQDDKCDIIYRYLPPQVDWLRKNRYL"
FT   gene            complement(587346..588443)
FT                   /locus_tag="Mboo_0622"
FT   CDS_pept        complement(587346..588443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0622"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   mhu:Mhun_1469 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55140"
FT                   /db_xref="GOA:A7I5X9"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5X9"
FT                   /protein_id="ABS55140.1"
FT                   /translation="MDGQTGDAGQRIVLHADMDCFYAAVEMHDHPEIAGKAVVVGADPQ
FT                   GGAGRGVVSTASYEARAFGVRSAMPISQAYRLCPGAVYLRPDMARYAAVSAEIMGIFKE
FT                   TGYRVQQVSIDEAFLDISPVRSFDTARDLAVRLKQTIRDRVGITCSLGVAPSKIVAKIA
FT                   SGHQKPDGMTVVTPDSARDFLAPLPIRKIPGIGGKTGAQIEALGITTIGNLATCDIQVL
FT                   VGAFGRSAGLLREAALGHDNSEVVERDGVKSISKETTFANDTEDPKEIAATMELLVREV
FT                   AQAIADEALQFKTVTIRVRYAGFVSKTKARSLLHYHNDEAAIRAAAGELLRELWDGKPI
FT                   RRLGLRLSTLRHQDSRQQTLFGSCR"
FT   gene            complement(588477..589709)
FT                   /locus_tag="Mboo_0623"
FT   CDS_pept        complement(588477..589709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0623"
FT                   /product="Protein of unknown function DUF650, N-terminal
FT                   domain"
FT                   /note="PFAM: Protein of unknown function DUF650, N-terminal
FT                   domain; Protein of unknown function DUF651, archaea-like;
FT                   KEGG: mhu:Mhun_1571 protein of unknown function DUF650"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55141"
FT                   /db_xref="GOA:A7I5Y0"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y0"
FT                   /protein_id="ABS55141.1"
FT                   /translation="MRISLQRMILGKGAYLKQLTAATMQMKSVEVGKELAGSSPPSVFI
FT                   GSYNYPDIYAGPMIAPMHGDTGIMDRPEEWISRCSQEEIIGYRMNLVRGKRLNNAFDLD
FT                   NRFVEKLQEIVLSEHSIESEASFETTPAGFSFSEEHTPFGPSAPLERFEIEEERWDSSL
FT                   EKVFYDTDLLSRDAILGLHRQGMAFSTIQKAFSAGTMGHGGNRHLVPTRWSITACDTMI
FT                   GDHLLKNVKQCPVIDTVRLYEYASLNNRYAVILLPTAWQYEWTEAFLHVLGNEEYVFSD
FT                   YEGFKRKTGYSSLGGCYYSCKMAVLEELAREQRQAGVIVLREALPGYVPMGVFNVRENV
FT                   RSAMQEPPKEFEDLKGALGHVAERFTLPVQRFVTETTLLQDSLRQKQCTLSDFTPHKKV
FT                   PSLPDGAEGTG"
FT   gene            589850..590377
FT                   /locus_tag="Mboo_0624"
FT   CDS_pept        589850..590377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0624"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE;
FT                   KEGG: mhu:Mhun_0801 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55142"
FT                   /db_xref="GOA:A7I5Y1"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y1"
FT                   /protein_id="ABS55142.1"
FT                   /translation="MFDMLFAPTWSPYIAGAGIGILVCLSFLMCNRPLGTSSAYAKAWG
FT                   LLEKAVDPAVEEKKEFYREEIPPRVDGVLMLLPGILIGAFLSAALSGQLHLSLVPLLWA
FT                   GAFGNNAILRVVVAFLGGIVLAFGARWAGGCTSGHGISGTSQLALSSIVSAACFFIGGI
FT                   ITAFLLFHGSGV"
FT   gene            590384..590944
FT                   /locus_tag="Mboo_0625"
FT   CDS_pept        590384..590944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0625"
FT                   /product="YeeE/YedE family protein"
FT                   /note="KEGG: mhu:Mhun_0802 YeeE/YedE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55143"
FT                   /db_xref="GOA:A7I5Y2"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y2"
FT                   /protein_id="ABS55143.1"
FT                   /translation="MSLCTRIHNDGKTQLVLGLCIGILFGFLLQKGGVTSYDVIVGQLL
FT                   LENFTVVKVMLSAVIVAMIGIHLLVRFGYAELHVHPGSWGSNLIGGLIFGVGFALLGLC
FT                   PGTVAGAAGTGALDALVGGIPGMLVGSGLFISLYPKIKPILCRAPFAAQTLPEFLHLNR
FT                   WIVIVVVEVCMIGILLLFAGIGL"
FT   gene            591035..591328
FT                   /locus_tag="Mboo_0626"
FT   CDS_pept        591035..591328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0626"
FT                   /product="protein of unknown function DUF1294"
FT                   /note="PFAM: protein of unknown function DUF1294; KEGG:
FT                   mac:MA2252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55144"
FT                   /db_xref="GOA:A7I5Y3"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y3"
FT                   /protein_id="ABS55144.1"
FT                   /translation="MIPVSLISVAIGLYVVVNASVFCLYGYDKHAARTGRWRIPESTLL
FT                   GSALIGPFGAFGAMLLFRHKTRKRKFLLVPVFLMLHIIGILYLAGVPVLPVP"
FT   gene            591390..591878
FT                   /locus_tag="Mboo_0627"
FT   CDS_pept        591390..591878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0627"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   cac:CAC2876 deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55145"
FT                   /db_xref="GOA:A7I5Y4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y4"
FT                   /protein_id="ABS55145.1"
FT                   /translation="MRTNRHQYFLDLAQRCANQGTCLRRNFGAIIVDEYNTIVSTGYTG
FT                   APRKQMDCTELNRCWRKDHNIPSGSNYERCRSVHAEMNAMLQAGKLARGCTLYLAGFDV
FT                   STGELTQIWPCFLCSKMIVNSGITNVIMRTTPDEFKEMDPMVLYQMRSRESLGDDSPS"
FT   gene            592004..592816
FT                   /locus_tag="Mboo_0628"
FT   CDS_pept        592004..592816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0628"
FT                   /product="acetyltransferases and hydrolases with the
FT                   alpha/beta hydrolase fold-like protein"
FT                   /note="KEGG: mhu:Mhun_1567 acetyltransferases and
FT                   hydrolases with the alpha/beta hydrolase fold-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55146"
FT                   /db_xref="GOA:A7I5Y5"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y5"
FT                   /protein_id="ABS55146.1"
FT                   /translation="MPDRCIPVVLVHGWKSHPGIWNRLFPRLREQDIPVWTFDYTSLDG
FT                   ALMEELAGALGGFIAARRKEENYTGSIDMVCHSIGSCVARFLLEVNDGPARSGRVRQLI
FT                   AIGPPNNGSALAELFCDPVIGPEITCRLTDTFVPRNFDPAADSIVQACRPGSATMAALR
FT                   AAGLRPDIAYRVICAENIARTPLFFPCLEGKTFELQQDGGWEMTFAGDGIVPHADSVLP
FT                   GATLDIVPALPSALKEDPGRYCHLQLPRAPEVVDRVMAYLRPGPAVPD"
FT   gene            complement(592838..593368)
FT                   /locus_tag="Mboo_0629"
FT   CDS_pept        complement(592838..593368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_0765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55147"
FT                   /db_xref="GOA:A7I5Y6"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y6"
FT                   /protein_id="ABS55147.1"
FT                   /translation="MTLENPDFKGDTPCPSVHPADRIQQFFVRPFFLTLTIGLPFCTFK
FT                   GLFGIAAIQAGTLSNPPLAAFGWLVLGWAIVDFAMNALRATGDLLHVPTPLEYCTLAEI
FT                   GRFLHRPMVFLAADTLISFSIICLMLWSGWITQMTPIESALWYAATTLNLISISLVSLY
FT                   NEAKRTAREEGSP"
FT   gene            593429..593842
FT                   /locus_tag="Mboo_0630"
FT   CDS_pept        593429..593842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55148"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y7"
FT                   /protein_id="ABS55148.1"
FT                   /translation="MSIGAGRLKDDGPAPAMVTSVVLSLRNGESLAMSPRHEPEPTPHD
FT                   HKKHDNSSHEDHPDSPDKTRHAELQAHHAGAGPAIHPSHHPQKKAELPPRHHPHTGPEN
FT                   KALNQDHGTHEDRPRPGKIAKKEEPARSGKSPR"
FT   gene            complement(593973..594737)
FT                   /locus_tag="Mboo_0631"
FT   CDS_pept        complement(593973..594737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0631"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55149"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y8"
FT                   /protein_id="ABS55149.1"
FT                   /translation="MEKNAAGIPGLPNHRMLILSAFCVCLLCVSVSADYTIADLSGSIV
FT                   RGHQFTVDITGNPDTAYYVWLTGTWSLSGEAYDEPPVIVANQANVQQDPDNGPYTIGSY
FT                   KYYNGNGRTILDDVAPSSSLVPCTSYYALVTTDDSGQAVVAFETSVNTALRSYSVRVEN
FT                   PTSVNNNTLLVQQGGTTVTGGSMSIYASGSRPPRPTFPPTTVPTPTPTPTPTETTPVAT
FT                   PATTVPATTTAPLDSAILILALGAGVCAVRYR"
FT   sig_peptide     complement(594636..594737)
FT                   /locus_tag="Mboo_0631"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.912 at
FT                   residue 34"
FT   gene            594854..595810
FT                   /locus_tag="Mboo_0632"
FT   CDS_pept        594854..595810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0632"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mba:Mbar_A2486 ATP-binding protein; TIGRFAM:
FT                   daunorubicin resistance ABC transporter ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55150"
FT                   /db_xref="GOA:A7I5Y9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Y9"
FT                   /protein_id="ABS55150.1"
FT                   /translation="MHAIEVSHLKKTFGTLTALNDISFCVEEGETFGFLGPNGAGKTTT
FT                   IRILTGISYPTAGTASIFGHDIGRETIAARQSMGIVSETSNVYDDLTAWQNMIFSAELY
FT                   HVSREVREKKAKELLTTFDLYERRNDKARGFSKGMKRRLTIAMGLVNSPRLLFLDEPTS
FT                   GLDVQSNLIIRDVVTGLIGEGVTVFLTTHNIEEANMMCDRVGIVNRGTIAAIDAPERLK
FT                   KTIQSVQSIVLSFDRTAAGQLDDLHHLAMVNDAVKEGDKFRLYTEDPATVIEAVMEYAR
FT                   AGGLRVLSISTLGPSLEDVFIKLTGLQRTGGVVHAID"
FT   gene            595797..596576
FT                   /locus_tag="Mboo_0633"
FT   CDS_pept        595797..596576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0633"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mba:Mbar_A2485
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55151"
FT                   /db_xref="GOA:A7I5Z0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z0"
FT                   /protein_id="ABS55151.1"
FT                   /translation="MPSTEGRNPAGAWVLRLQHELSAAWAISRKDMITYYIKPNIIVSG
FT                   ILFPLFMFLAFAIGKNAPPGTLIPGLIAITLLFSASSIEPVSIPIERRVKTFDRLLSAP
FT                   ISLHSLVFGESMSGFLYSLGIACLPLLIGIVAFGTPIQNVPVLIIAMALTAFCFATLGT
FT                   LFAAYPTENVGEVMSMLNTVRLPLIFISGVFIPISEIPQIGQVIALFSPLTYGNDMITY
FT                   AYTGTSLFSPVWDVVALFIFILLFQFVANRLYKKFNE"
FT   gene            complement(597041..597364)
FT                   /locus_tag="Mboo_0634"
FT   CDS_pept        complement(597041..597364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55152"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z1"
FT                   /protein_id="ABS55152.1"
FT                   /translation="MKYTPRHVKKFLEEGKIDPELWKIHFPHLLPSHVPDCSECEDKKN
FT                   DLCQGNKNPVDCFLGIYAEEEAKKAADPDKKAHKEKSKGFFPKGKRSKVPAGANITFDQ
FT                   SKM"
FT   gene            complement(597469..599460)
FT                   /locus_tag="Mboo_0635"
FT   CDS_pept        complement(597469..599460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0635"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2346 hypothetical protein YegI"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55153"
FT                   /db_xref="GOA:A7I5Z2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z2"
FT                   /protein_id="ABS55153.1"
FT                   /translation="MSPSPHNHLFDSRGSPVSLGKKVGSGGEGDVYEIAPHRKDVLAKI
FT                   YHKPLSAERQEKLRVMVSGCNEELKEFAAWPLDLLHNGRNGPVCGFIMPRITDCEPIHR
FT                   VYGPSHRKESFPNADWKFLVRTAKNLAAAFYIIHKYGYVVGDVNEGNILVTKKACVRLI
FT                   DCDSFQVQAHNKTYFCEVGVAQFTPPELQKSKDFKMLRSQNHDNFGLAILIFLLLFMGR
FT                   HPFSGVYKGNDDMPIERAIAEHRFAFGRNAAQKAMAPPPNAVGLSVVPGEIASLFEQAF
FT                   TESGIQSWGRPSANDWWNLLDALEKRLKKCPTESMHTFYSGLAACPWCGLENSSGILLF
FT                   LSADTISRIDIASEWQKVLAIKPPGPIPEINPRNYRCMPAPFPPGVARAVRLGKIRQAS
FT                   QVLLLAASAVIVLALFANGQGFSRPDDLLSLVPAAIAGLLFVIPGRDKAERKQRKKSFE
FT                   DARYSWQLWEKKWKAEAGDAEFTAQLSALTHAKQRYEAIEQEYRNALSALQRTSKERQE
FT                   KKFLENCHLDACSSPRLTENRRAALRSFGIETAADIDPHRIQTIPGFDAALAHELVSWR
FT                   KQQEGRFVFDEEKRASASDIQGLIHTFQPKIRPAEREILGGIEKLYAIQQRILKNRGKF
FT                   QPIIEKSARDLAQAHANLSAVTLAGKLF"
FT   gene            complement(599474..600241)
FT                   /locus_tag="Mboo_0636"
FT   CDS_pept        complement(599474..600241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdy:SDY_2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55154"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z3"
FT                   /protein_id="ABS55154.1"
FT                   /translation="MSWKHLSLSVTGKSHSDRNEPGQDYCRAGAVTFADRDFFIGLAAD
FT                   GAGSTTRGGTGAEIACEILYLQILAAIRKGDPLSRVTDDDIRTWISASREAILARAQEE
FT                   GQRLKDYACTLIGVVISGEHVLFFQIGDGCIVTGDDAGYHTVFWPEQGEYANMTFFVSD
FT                   DDFLDHIRIDRRENLPGEIAIFTDGLQNLVLSFSTRTVHEGFFRPLFAALRKNSEKGGC
FT                   VDLTTHLVKLLSSDDVNARSDDDKTLVLAVNVP"
FT   gene            complement(600238..600912)
FT                   /locus_tag="Mboo_0637"
FT   CDS_pept        complement(600238..600912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0637"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG: ecc:c2599
FT                   hypothetical protein YegL"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55155"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011392"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z4"
FT                   /protein_id="ABS55155.1"
FT                   /translation="MSDDSMYDQQPLGPVTFAENPEPRCPCLLLLDTSGSMAGKPIAEL
FT                   NAGLRAFYEELQGDSLAVKRVEVALVSFGPVRVISEFNTADFFLDPTLEAEGDTPLGEA
FT                   ITKGIDMVRKRKDEYRANGISFYRPWIFLITDGSPTDEWQRAAAAVREGESSKSFAFFA
FT                   VGVQNADMAVLRQLTVRQPLKLQGLKFREFFQWLSNSMKSASRSNPGDRILLSPPSGWS
FT                   EI"
FT   gene            complement(601177..602736)
FT                   /locus_tag="Mboo_0638"
FT   CDS_pept        complement(601177..602736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0638"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; cell surface
FT                   receptor IPT/TIG domain protein; KEGG: mma:MM1588 surface
FT                   layer protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55156"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z5"
FT                   /protein_id="ABS55156.1"
FT                   /translation="MNTRFIFLTGFVVLVCLACVVIPVGADNNTTATTTTTAVTTTATA
FT                   TPTTTATTIVTTTATATPTTTATTAVTTTATATPTTTATTAVTTTATTVATTTTATPLV
FT                   ASFTASPTSGTAPLTVQFEDTSTGSPTTWDWNFGDGDSSTNENPSYAYTTAGTYTVTLS
FT                   IGDGGTLPSATSTQTTTITVSAGTVTTTVPSVTSISPTYGPLSTGTSITITGTGFTGAT
FT                   GITIGGTAVTSFTVVSDTEITATTPAISTAEQVDVLVTTPSGTSSSVAGDKYTFAATAT
FT                   TVPLPLFIASPTSGTAPLEVTFTDESTGSPATWDWNFGDGNTSTLQNPTNTYVTNGTYS
FT                   VTLTEENSIGTNATTLTGYIIVGPTIPVAAFTASSLSGAAPLTVQFTDTSTGSPTSWVW
FT                   NFGDGSTGTAQNPSHEYTTSGTYTATLTATNAEGSSTNTASQTITVGSSAMATAPTTAY
FT                   TTAPTFAVAAAQSTTSSVDAWLAKQQAIATATPTPKSPGFDLIAALIGCGVIAGIDLYR
FT                   KQ"
FT   sig_peptide     complement(602656..602736)
FT                   /locus_tag="Mboo_0638"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.926 at
FT                   residue 27"
FT   gene            603323..604162
FT                   /locus_tag="Mboo_0639"
FT   CDS_pept        603323..604162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0639"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   xcb:XC_2656 formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55157"
FT                   /db_xref="GOA:A7I5Z6"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z6"
FT                   /protein_id="ABS55157.1"
FT                   /translation="MKYPFLISIPHGGTEIPKEVAGRFALTDQELLWYCDPETRILFDF
FT                   GRSVECTIDTPVSRMVVDLNRPPLPLPPKDPDGIIKVRTIDGKQVYLPGQIPDLNLIHQ
FT                   MMLKWYFPYHQRIDELIDRHPVRISFDCHSMLPYGSAEQADAGRDRPLICLGNYGDGQG
FT                   RARPGGITTCPAAWIRSLADEFEREFPGPGNVAINTPFSGGFISNAHYWRKGIPWIQIE
FT                   VNRALYESESIHSSRLSVTKSQIPELQDRIREILARFWEGISDSDLAEKNRRTGDFP"
FT   gene            604379..607039
FT                   /locus_tag="Mboo_0640"
FT   CDS_pept        604379..607039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0640"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mhu:Mhun_0545 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   response regulator receiver; ATP-binding region, ATPase
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55158"
FT                   /db_xref="GOA:A7I5Z7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z7"
FT                   /protein_id="ABS55158.1"
FT                   /translation="MISLLYVDDEPALLDLCRLFLEQEGDISVSTAGSVEEALARIAAG
FT                   TFDAIISDYQMPEIDGITFLRTIRRQYPDMPFILFTGRGREEVVIEAINSGVDSYVQKG
FT                   GDSRAQFKELSHLIRQIVRRRKAESGLRQMKFSVDHASEGIIWLRGSGEIAYFNEAICA
FT                   MLGYTPREFSGLSVVDIRPGLSRQSLSSAWDRILSRKCASIEEMLLKKDGSTLPVELVL
FT                   SYNEQGPDPLIFVFVRDISERRRSEESLKKAVCQLIQMEDDLHRQFEDLKKSDHAMREI
FT                   GQRYQMLSAVSKDWIWEIDTDCRITYSGPQVQALLGFDPAALAGKCFSDLLVPACALWA
FT                   SSELSGLMAKKEVFHSLIVRALHREGREVLLALTGIPLHSAEGTFCGFYGIARDVSEEK
FT                   TPDILLPSRTLLEQAGDAIFVTDVQTGVIIDANRNALNLVNRTLPEVCALQESALYSSP
FT                   RSGQTDEPLRLRDNDEQGTSEEVLVDKEGNPIPVIVSTRVLQVGDRRIRIGIYHDISDL
FT                   RSIESALREKAGELDRFFASGPDMFCILNTDGRIVRLNPAGEALLGCTTGPGAEHSLPE
FT                   LLHPDDRADLHYLLMHMGSGGKASTFVNRVVQPDGSSRWLEWRAFLSEKNQIYAIARDF
FT                   TGQKRAEQALALANRKLSLLTDLTRHDIRNKLAVLTGYLDLFRSCPAEPYFSLYTEKIN
FT                   ETVAAITAQLEFIRIYQKLGSAEPAWFNVNQVFSGACRQREIPAVIVSSSPDSWEIFAD
FT                   PLIDRVFSTLVDNAFRYGATLTKIQRSAHESPEGLVVVIEDNGIGIAQEKKEQIFEKEA
FT                   GKACGQTHSLFLAREILSITGITLRETGRAGKGARFEMQVPKGMYRLREPEPDQKDMPV
FT                   FAPDFITPPRHNHTL"
FT   gene            607036..607929
FT                   /locus_tag="Mboo_0641"
FT   CDS_pept        607036..607929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0641"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: aba:Acid345_0348 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55159"
FT                   /db_xref="GOA:A7I5Z8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z8"
FT                   /protein_id="ABS55159.1"
FT                   /translation="MIRETPQDFLDVLKSYIPDPNRPVGVARQEFSEFLLEFQTDERPA
FT                   VEQVAIRDDLRGVWCSVPEGVPDQTLLFFHGGFFSAGSTADHLGFCAELARASKSRVFS
FT                   VDYRLAPEHPFPAAAKDALDAYRYLASHGCPPHRIIPVGISSGGTLVLNLLLLLREQHL
FT                   QMPPAAACLSPFVDFSLDKDPSAADNAGDWLTIARLAAIRAQYLVGTDPGDPRASPVHA
FT                   NLSGFPRLYIQAGSGELIFDDISAFAKNAKWAGIQVRFEIWEGMFHLWQLFGMQVPEAR
FT                   DAVGRTGNFVKETFGR"
FT   gene            608629..609483
FT                   /locus_tag="Mboo_0642"
FT   CDS_pept        608629..609483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_00661 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55160"
FT                   /db_xref="GOA:A7I5Z9"
FT                   /db_xref="UniProtKB/TrEMBL:A7I5Z9"
FT                   /protein_id="ABS55160.1"
FT                   /translation="MIDRIIRSFELVKASWRILMEDKKLLAFPILSGLVTLLVIATFVI
FT                   PLILSNSAYSLSTNSVAGIVLLFLFYVVSYFVVIFFNVGLISCVQAKLNGKDMSVGEGL
FT                   SAAGRHLGAILAWAIVAATVGLILRMIEDRAGFLGQIAAAVVGGVWSLVTLFVVPVLAF
FT                   EDKGVFAAMKESLELFKKTWGESVVGTISITLVFAAVGFVGVLLFLATLFIGNPTLIIA
FT                   ALVLLLVLIVVLAILASAMQGIFTVALYTYAKTGSAPGVFPPGSVEGAFAPSAQQQFGP
FT                   GNI"
FT   gene            609617..611743
FT                   /locus_tag="Mboo_0643"
FT   CDS_pept        609617..611743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0643"
FT                   /product="Stage II sporulation E family protein"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   Cache domain protein; Stage II sporulation E family
FT                   protein; SMART: protein phosphatase 2C domain protein;
FT                   KEGG: mhu:Mhun_0060 serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55161"
FT                   /db_xref="GOA:A7I600"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A7I600"
FT                   /protein_id="ABS55161.1"
FT                   /translation="MRIPGSWQRISIRTKILIVFLSLSMVALGILGYAAFSTMSDMGSY
FT                   ALTSSGQLGDRAVSDSTTALEANAEASLVRLATDQADISNVVFSQVDGEMDTLAGYAAT
FT                   VRAGPATTRPLYDQSERPQDPGSSSAYVLSPGVTRAGVENELYSLASLDDVMGPMLASD
FT                   PRITQIYVGTGSGILYVHPWLNTIPSSYDPRTRDWYIRAVQSGDLSWSDPYIDASGKGL
FT                   MVTCSRPVPASTGNSTWVVAADVTLSTVNAEIINTQIGDQGYAMLIDDRGNVIARPGIS
FT                   AGEKGWDESFEMENLLTSNNSALAAVAQNMMAGQTGIARVPFSDGEKYVAYAPVKSVNW
FT                   SVALVVPVDEVIAPAENTRGQIVNATSDTGVHLNQTMNSAKGLFIALFVLLFVMVAGLS
FT                   VLFSQVITRPVAALKRGSEAIGAGDLGYRVEIHTGDEFEDLAHSFNTMAADLKEHMDEL
FT                   ERTTAEKERFAKELEIAKGIQQSFLPDTAPDIAGIEIAAKNIPALEVGGDFYDFIPLGK
FT                   DRWGLVIADVSGKGVPAALFMALSRTLIRASTLANADPAVAIGHANQLICEDSKTDMFV
FT                   TLFYAILDSRAMTLDYVNAGHNPPLLLKGTSSDVVLLKARGIALGLTDEMDLQSARMDL
FT                   RPGDVLVLYTDGVTEAINDHEEEFGEQRLLSVIMENRTLPAAELLEKILNAISTFAGNR
FT                   PQHDDITLLILHAV"
FT   sig_peptide     609617..609739
FT                   /locus_tag="Mboo_0643"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.487 at
FT                   residue 41"
FT   gene            complement(611792..612523)
FT                   /locus_tag="Mboo_0644"
FT   CDS_pept        complement(611792..612523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0644"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="KEGG: mbu:Mbur_1468 protein of unknown function
FT                   UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55162"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A7I601"
FT                   /protein_id="ABS55162.1"
FT                   /translation="MVIVSLVPIPYRIAALTAEKNALFSYPPDRLSGIIRDVGFRCTYC
FT                   AKCCTRAFNGHVFLLEQEVATARAIDPDALEPAPDPEFCDQHGTFYVSGYALKVKDDKE
FT                   GSCWFLENGRCTIYDRRFAICRIYPYMLHREPDEDGIIDWRQISGFEKHGKYNAKITDE
FT                   ESRTLARETMEYEHAFLDHQIAFLECVQQWFARHQLRHVQKVYDDRMRQFKKGSPLTVM
FT                   VYTGGQFEKCQVFPKPAPRES"
FT   gene            complement(612783..613184)
FT                   /locus_tag="Mboo_0645"
FT   CDS_pept        complement(612783..613184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55163"
FT                   /db_xref="UniProtKB/TrEMBL:A7I602"
FT                   /protein_id="ABS55163.1"
FT                   /translation="MRLIFQGGPGECFVVYIADNIDLRDNPILIYRSRQNFLNMPRGRP
FT                   KGSRNLSAYERGKVKRIRELLSQKGIGDFDRLRDNQVLNTIYVNTDGEIFVKYGLETAG
FT                   AEEKAPRSRASEKIIAKLEKNIALLRDVL"
FT   gene            complement(613298..613762)
FT                   /locus_tag="Mboo_0646"
FT   CDS_pept        complement(613298..613762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55164"
FT                   /db_xref="UniProtKB/TrEMBL:A7I603"
FT                   /protein_id="ABS55164.1"
FT                   /translation="MQKNPARKYQVVEEAEIDLVLRSRDSREFYEQYLKVFPDTKKGLD
FT                   SISKIWKRRSEFAKKRQLTLPQAETGTAATREIQSLIADQTKIMTDIAALTRENLEISR
FT                   QILQALEHQNRLMTGHPDEKAKDPVHPEHLQKPPVQKKIPEKQTPIMVGS"
FT   gene            613991..614446
FT                   /locus_tag="Mboo_0647"
FT   CDS_pept        613991..614446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0647"
FT                   /product="Holliday junction resolvase-like protein"
FT                   /note="KEGG: aci:ACIAD3286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55165"
FT                   /db_xref="GOA:A7I604"
FT                   /db_xref="InterPro:IPR019287"
FT                   /db_xref="UniProtKB/TrEMBL:A7I604"
FT                   /protein_id="ABS55165.1"
FT                   /translation="MALEDILEYVSVALVIGFFLGLLFMRAQFRTVEARYRADLERWKA
FT                   ESAAEIRKDSVNRSRFTLKGRIAEQMAPLLPSFGYLPADARFIGSPVDYIIFDGLSSVA
FT                   DEKGSDIRIIFMDVKQGSATLSRTQRVIKKAVEEKAVTWQTLHLEDE"
FT   gene            complement(614615..615112)
FT                   /locus_tag="Mboo_0648"
FT   CDS_pept        complement(614615..615112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55166"
FT                   /db_xref="UniProtKB/TrEMBL:A7I605"
FT                   /protein_id="ABS55166.1"
FT                   /translation="MNAKMILGGIVFLMLLLIVAGCTQPTAPQATPAPTAEATTPVPVA
FT                   TTTAVPTTFVPATPGPTQTLQANWAVQVQVNSNGKAIDPEVVYTFNGGMGMNLIPEIDV
FT                   QLTRSDGTVENGNFTQPMSVGQTVSLPGTTGNNDRAEVWVITPQGDRVKIYDQYVPFRS
FT                   YN"
FT   sig_peptide     complement(615020..615112)
FT                   /locus_tag="Mboo_0648"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.889 at
FT                   residue 31"
FT   gene            complement(615196..616794)
FT                   /locus_tag="Mboo_0649"
FT   CDS_pept        complement(615196..616794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0649"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA, RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: dde:Dde_0152
FT                   DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55167"
FT                   /db_xref="GOA:A7I606"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7I606"
FT                   /protein_id="ABS55167.1"
FT                   /translation="MNTRLQFSDLSLSKEIAKAIENMGFEEPTPIQALAIPLIQAGRDV
FT                   TAQAQTGTGKTSAFGIPVIENIDASQRVVQVIVLCPTRELAIQIAEEFSHLLAYLPKIS
FT                   VLPVYGGQPIERQLKALANGVHIVIGTPGRVMDHLKRRTLSLDHVSMVVLDEADQMLDM
FT                   GFRDDIELILKRVPQKRQTLLFSATLPKPIIEISKRFQNRPEFVRVEYQELTVPAIEQS
FT                   YIEVRDRDKLDSLCRVIDVVDPQLAIIFCNTKRGAEDLAGRIRARGYRAEELHGDMKQS
FT                   QRDRVMGGFRKGTIDILIATDVAARGIDVEDVDMVINYDVPQDVDYYIHRIGRTGRAGK
FT                   SGRAITFVTSRDFTKLREIQKYIKVQIPRKPLPTADDVVEQKTKTILEEVRETIQKGGT
FT                   EPYARIVEQESEGDLTTLEIAAALLKIRLEQGSDSHTEHAVPKDFGDTGAESGMVRFFL
FT                   GIGRDHKVAPKDIVGAIAGETGIPGKYIGAIRILDTYSFVEVPREYAGEVYTIMKERTI
FT                   RGLSTAIEPAQGRHP"
FT   gene            617010..617582
FT                   /locus_tag="Mboo_0650"
FT   CDS_pept        617010..617582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0650"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mma:MM1582 iron-sulfur flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55168"
FT                   /db_xref="GOA:A7I607"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A7I607"
FT                   /protein_id="ABS55168.1"
FT                   /translation="MKVVAFNGSARKDGNTAILVREVFKELEKSGIETEIVQLAGKKVH
FT                   GCTACMKCMEKKDRRCVIEDFANECIAKMDEAEGIILASPTYFSDVTAEMKALIDRSGF
FT                   VAMANGSMFRRKVGAAVVAVRRGGAIHTFDTINHFFFISQMVVPGSCYWNVGIGLAPGD
FT                   VEKDNEGLETMKVLGENMAWAMKKLNK"
FT   gene            complement(617621..619066)
FT                   /locus_tag="Mboo_0651"
FT   CDS_pept        complement(617621..619066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0651"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   reu:Reut_A0250 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55169"
FT                   /db_xref="GOA:A7I608"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A7I608"
FT                   /protein_id="ABS55169.1"
FT                   /translation="MDLRALIPKGTQAFRTKTIDKLMECTSGEHALRKVLSPLDLTLMG
FT                   IGAIIGTGIFVITGVVAANYSGPALVISFVIAGIVCAFAALAYAEFAAMVPVAGSAYTY
FT                   SYASLGEIWAWIIGWDLILEYAVSIAAVAVGWSGYVTSLAAGAGITLPAMLVNPPGTSG
FT                   GLVNIPAMVIIGLVTLLLIIGVRESARVTTVIVAIKLGVILLFLYLAFGHIQPANWVPF
FT                   MPFGWNGVITGAAIVFFAYIGFDAVSTAAEEVQNPTRDVPLGILSSLAIATVLYIAVSA
FT                   VLTGIVPYSLFAGTSAPVAFALEQIGISWGSALISVGAICGITSVIIVLLYGQTRIFFA
FT                   MSRDGLLPGIFRQIHPVYRTPVKVTLLVGTVTALLAGFLPLTTIAELVNIGTLAAFIIV
FT                   SLGVIVLRYTKPSFPRPFRCPLVPLVPILCILSCGLLILALPLVTHLRFVLWLTVGLVI
FT                   YVIYSRHHSRINDNTSALECWKG"
FT   gene            complement(619211..619954)
FT                   /locus_tag="Mboo_0652"
FT   CDS_pept        complement(619211..619954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0652"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sat:SYN_01022 seceted metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III"
FT                   /db_xref="EnsemblGenomes-Gn:Mboo_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABS55170"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A7I609"
FT                   /protein_id="ABS55170.1"
FT                   /translation="MQVTFLGTNGWYDSLTGNTVSALITARDYDIILDAGNGIAKADRY
FT                   MTQDKPAFLFLSHFHLDHTEGLHTLVKFRFKKGLSICGGVGTTADLAGLLREPYTVPLD
FT                   RVPFAVTVKELKEGVHELPFKVTCLPLVHPVPCTGYRFEIDNKVVTYCTDTGLCDNAVS
FT                   LARDADLLITECGLKPGEKSPLWPHMNPEDAIEVARRAGAKRLALTHFGAEVYKTLEER
FT                   RALKAQFEKECPGLLVSEDDLTIEV"
FT   gene            620070..620963
FT                   /locus_tag="Mboo_0653"
FT   CDS_pept        620070..620963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mboo_0653"
FT                   /product="hypothetical protein"
FT