(data stored in SCRATCH zone)

EMBL: CP000791

ID   CP000791; SV 1; circular; genomic DNA; STD; PRO; 89008 BP.
XX
AC   CP000791;
XX
PR   Project:PRJNA19857;
XX
DT   29-AUG-2007 (Rel. 93, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 8)
XX
DE   Vibrio campbellii ATCC BAA-1116 plasmid pVIBHAR, complete sequence.
XX
KW   .
XX
OS   Vibrio campbellii ATCC BAA-1116
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
OG   Plasmid pVIBHAR
XX
RN   [1]
RP   1-89008
RG   The Vibrio harveyi Genome Sequencing Project
RA   Bassler B., Clifton S.W., Fulton L., Delehaunty K., Fronick C.,
RA   Harrison M., Markivic C., Fulton R., Tin-Wollam A.-M., Shah N., Pepin K.,
RA   Nash W., Thiruvilangam P., Bhonagiri V., Waters C., Tu K.C., Irgon J.,
RA   Wilson R.K.;
RT   ;
RL   Submitted (01-AUG-2007) to the INSDC.
RL   Genetics, Genome Sequencing Center, 4444 Forest Park Parkway, St. Louis, MO
RL   63108, USA
XX
DR   MD5; 1b032363b280c3647f48e7f418621196.
DR   BioSample; SAMN02603960.
DR   EuropePMC; PMC6089523; 26542048.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   StrainInfo; 493613; 0.
XX
CC   Vibrio harveyi belongs to the group of bioluminescent bacteria that
CC   'glow in the dark,' just as the commonly known firefly. Based on
CC   their 16S  ribosomal RNA (rRNA) classification, they belong to the
CC   group of bacteria known as Proteobacteria, which is further
CC   sub-divided into five groups, including the gamma proteobacteria.
CC   This group includes many families, one of which is the Vibrionaceae
CC   (bioluminescent bacteria). One of the Vibrios is a human pathogen
CC   and causes cholera. Vibrio harveyi can be found globally in marine
CC   environments, either in a free-living state or in symbiosis with
CC   marine life.  The sequenced strain is BB120, ATCC BAA-1116
CC   http://www.atcc.org/common/catalog/numSearch/numResults.cfm
CC   Sequence/Assembly
CC   The genome of Vibrio harveyi was sequenced to 8X coverage using a
CC   combination of plasmid and fosmid end sequences. Additional 454
CC   sequence reads bring the present coverage to 10.8X. Assembly was
CC   performed using the PCAP software (Genome Res. 13(9):2164-70 2003).
CC   The genome has  undergone automated sequence improvement
CC   (pre-finishing) followed by  manual finishing, and automated
CC   annotation. The National Science  Foundation (NSF) is providing
CC   funding for the complete sequence of the  Vibrio harveyi genome.
CC   Annotation
CC   Coding sequences were predicted using GeneMark v3.3 and Glimmer2
CC   v2.13. Intergenic regions not spanned by GeneMark and Glimmer2 were
CC   blasted against NCBI's non-redundant (NR) database and predictions
CC   generated based on protein alignments. RNA genes were determined
CC   using tRNAscan-SE 1.23 or Rfam v8.0. Gene names are generated at
CC   the contig level and may not necessarily reflect any known order or
CC   orientation between contigs.For questions regarding this assembly
CC   or project, please visit the Vibrio harveyi genome page
CC   (http://genome.wustl.edu/genome.cgi?GENOME=Vibrio%20harveyi) and
CC   choose the designated contact person.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..89008
FT                   /organism="Vibrio campbellii ATCC BAA-1116"
FT                   /plasmid="pVIBHAR"
FT                   /strain="ATCC BAA-1116; BB120"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:338187"
FT   gene            complement(721..1074)
FT                   /locus_tag="VIBHAR_p08159"
FT   CDS_pept        complement(721..1074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08159"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3436 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08159"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75006"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A7MSJ3"
FT                   /inference="protein motif:HMMPfam:IPR008878"
FT                   /inference="similar to AA sequence:INSD:EDK30750.1"
FT                   /protein_id="ABU75006.1"
FT                   /translation="MKHMLSAPEIYLYRESVDFRKSINGLAAIIESDTDLPLGSGALFL
FT                   FTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPTKERNEVFTLTQFELDRLLSGFTII
FT                   GHKPVQINDFTMT"
FT   gene            complement(1071..1397)
FT                   /locus_tag="VIBHAR_p08160"
FT   CDS_pept        complement(1071..1397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08160"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG34527 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08160"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75007"
FT                   /db_xref="UniProtKB/TrEMBL:A7MSJ2"
FT                   /inference="similar to AA sequence:INSD:EDK30749.1"
FT                   /protein_id="ABU75007.1"
FT                   /translation="MRRFEMGKRHTNQEWQTLIEQSESSSLSTLAFCKLNELNPSTFYA
FT                   KRQQLKKADVSQGFVRAEVVEKTTKYQAQIATANMTLLINDVELSIPQGTPAAYLAELI
FT                   GALS"
FT   gene            1566..1790
FT                   /locus_tag="VIBHAR_p08161"
FT   CDS_pept        1566..1790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08161"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75008"
FT                   /db_xref="UniProtKB/TrEMBL:A7N920"
FT                   /protein_id="ABU75008.1"
FT                   /translation="MTPFYSIFGTPSVTTSAFEKLATIREHDWVTFGEAMSSSGKITRK
FT                   KIYEIADQMTWVTVGEEQKFWKCVANASL"
FT   gene            1777..2214
FT                   /locus_tag="VIBHAR_p08162"
FT   CDS_pept        1777..2214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08162"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75009"
FT                   /db_xref="UniProtKB/TrEMBL:A7N921"
FT                   /inference="similar to AA sequence:INSD:ABA55950.1"
FT                   /protein_id="ABU75009.1"
FT                   /translation="MHRYSFLLIMGLALSGCASDTTGKAANDWIAQKEQCIEQEEQSQA
FT                   LFPRNEWFDSLTKQQKIDVVLYIYNLKHQACTEKESLELERSLNKAGYKELEKHFTVLG
FT                   AFDWPDESALDGIDIEQVNKLSEQVGLFNLGTVGEQLKFRE"
FT   gene            complement(2217..2462)
FT                   /locus_tag="VIBHAR_p08163"
FT   CDS_pept        complement(2217..2462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08163"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08163"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75010"
FT                   /db_xref="UniProtKB/TrEMBL:A7N922"
FT                   /inference="similar to AA sequence:INSD:BAC97784.1"
FT                   /protein_id="ABU75010.1"
FT                   /translation="MSKTSEKRHYHEVNGIERVEYPCKCGQGFYRYDPDGERSTHNQLP
FT                   HRCTKCNEQVFFSIPYPALRYKGRIFVDWETVRGLG"
FT   gene            complement(2568..2696)
FT                   /locus_tag="VIBHAR_p08164"
FT   CDS_pept        complement(2568..2696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08164"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75011"
FT                   /db_xref="UniProtKB/TrEMBL:A7N923"
FT                   /protein_id="ABU75011.1"
FT                   /translation="MGDCSQELSRTERGMAPSEERTWCKDRFRFEASYRGRNAVTE"
FT   gene            2969..3886
FT                   /locus_tag="VIBHAR_p08165"
FT   CDS_pept        2969..3886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08165"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2003 DNA repair proteins"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08165"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75012"
FT                   /db_xref="GOA:A7N924"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A7N924"
FT                   /inference="protein motif:BlastProDom:IPR001405"
FT                   /inference="protein motif:HMMPfam:IPR001405"
FT                   /inference="protein motif:HMMTigr:IPR001405"
FT                   /inference="protein motif:ScanRegExp:IPR001405"
FT                   /inference="similar to AA sequence:INSD:EDK49143.1"
FT                   /protein_id="ABU75012.1"
FT                   /translation="MTDSNVIRSTITKQPEPTKFSNLESKAASKDEFLKSFTGHKLRKN
FT                   AKKKIAQLLAYADTVTLKTQSMGMDDCYRSNEPVSMPKEEFWAWYEREYSDMVIMLTVQ
FT                   GDVLTSVKFSDCIYHFSNDVIMTFSLEEREDETENIEGGQSSVSVAYSDSGLFTAHEQA
FT                   ILDEAAAILESKLCISEQPALSSPEVVKNFCRYSLAAREHEVFGVIFLDNQHRVRSSED
FT                   LFTGTVNAASVYPREVVKKALAENASAVIFYHNHPSGVAEPSQADRRITRRLIDALALI
FT                   DVKVLDHFVVSFEGTVSFAERGWI"
FT   gene            complement(3924..4055)
FT                   /locus_tag="VIBHAR_p08166"
FT   CDS_pept        complement(3924..4055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08166"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75013"
FT                   /db_xref="UniProtKB/TrEMBL:A7N925"
FT                   /protein_id="ABU75013.1"
FT                   /translation="MLEFNKLSKKLLTKLRALNLKPWDLIRLGWTVKELIQFLFFDE"
FT   gene            complement(4734..4862)
FT                   /locus_tag="VIBHAR_p08167"
FT   CDS_pept        complement(4734..4862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08167"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75014"
FT                   /db_xref="UniProtKB/TrEMBL:A7N910"
FT                   /protein_id="ABU75014.1"
FT                   /translation="MGDCSQELSRTERGMAPSEERTWCKDRFRFEASYRERSETTE"
FT   gene            5135..5419
FT                   /locus_tag="VIBHAR_p08168"
FT   CDS_pept        5135..5419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08168"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75015"
FT                   /db_xref="UniProtKB/TrEMBL:A7N911"
FT                   /protein_id="ABU75015.1"
FT                   /translation="MTDSNVIRSTITKQPEPTKFSNLESKAASKDEVFKVAMGSDVRPS
FT                   ELANAGLVMKSFRFFPADLEEVTKRLSDFVVTDESTACEKVFRFERLPY"
FT   gene            5503..5823
FT                   /locus_tag="VIBHAR_p08169"
FT   CDS_pept        5503..5823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08169"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18008 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08169"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75016"
FT                   /db_xref="UniProtKB/TrEMBL:A7N912"
FT                   /inference="similar to AA sequence:INSD:BAC97761.1"
FT                   /protein_id="ABU75016.1"
FT                   /translation="MTTLNEKPTQIYTCTAVEFELGQIVMTQGVSQLLGDLPHELLLLP
FT                   CLARHTNGDWGDLCIEDKVANDEATRHGLRILSAYRFGNERIWVITEGDRSVTTFLLPS
FT                   EY"
FT   gene            complement(6173..6595)
FT                   /locus_tag="VIBHAR_p08170"
FT   CDS_pept        complement(6173..6595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08170"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08170"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75017"
FT                   /db_xref="GOA:A7N913"
FT                   /db_xref="UniProtKB/TrEMBL:A7N913"
FT                   /protein_id="ABU75017.1"
FT                   /translation="MSEGFPYPTLTKQLTLVELEEMREELLALGEALKLVPSEFDASFQ
FT                   QKINRVLDITSEVEHHSKQLRAGIEQSQQAFSNSLIQEVGKRHEQQLGAIDKCISDKLS
FT                   GYIPVNKGFFFIALFVNAVFVGSLLGAVFYLLAFRL"
FT   gene            complement(6616..7353)
FT                   /locus_tag="VIBHAR_p08171"
FT   CDS_pept        complement(6616..7353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08171"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG29342 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08171"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7N914"
FT                   /inference="similar to AA sequence:INSD:BAB12621.1"
FT                   /protein_id="ABU75018.1"
FT                   /translation="MGHIIDYIKIAVLNHSGNVGKSTICNTLLMPRIEGAELIRVETIN
FT                   EDGSTGEKLAAKDMTNVIEKIDMLDKAVIDIGSSNIENFIKGIKENVGSHEDIDLYLVP
FT                   VTPDIKQQKDTVNSIYELNDLGISSECIGVLLNRVDSSLPLESQFNVLCESGALEQTAT
FT                   DEIRKCVIIPESEVFTLIDLTNTSYHEAVNDDTDYRKAIREAKDKQTRSGLSLKKSCHR
FT                   LAKSLDEKLDIEFKKLTKFLAWQ"
FT   gene            complement(7365..7835)
FT                   /locus_tag="VIBHAR_p08172"
FT   CDS_pept        complement(7365..7835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08172"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08172"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75019"
FT                   /db_xref="UniProtKB/TrEMBL:A7N915"
FT                   /protein_id="ABU75019.1"
FT                   /translation="MDANKLLNDTANNINKELSEMLRSKQSIVSMFLSDIETLSSNGIS
FT                   YRVLLEKGGIPIALKHFQTMIYIAKKKRSPNEQIPTQKPNATSTAKSLPETQEIDLVEW
FT                   KMIMPDIAEKLVQDIVKQGYEIEEVKSWIKEKQLPNSSALRRYFTALKQTTN"
FT   gene            8090..8443
FT                   /locus_tag="VIBHAR_p08173"
FT   CDS_pept        8090..8443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08173"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08173"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75020"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:A7N916"
FT                   /inference="similar to AA sequence:INSD:AAV40899.1"
FT                   /protein_id="ABU75020.1"
FT                   /translation="MEKESATIHIQTRLTPSEYEPFKTVIENFDIKKAELFRKVILSNE
FT                   KNMVEVSRSVEETDAQKRMIFLANKTSNNINQIAKKLNQAYRGEVVSERNYLKIMNELI
FT                   GVRSAFEKGMDKC"
FT   gene            8437..11370
FT                   /locus_tag="VIBHAR_p08174"
FT   CDS_pept        8437..11370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08174"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0507 ATP-dependent exoDNAse (exonuclease V),
FT                   alpha subunit - helicase superfamily I member"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08174"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75021"
FT                   /db_xref="InterPro:IPR040677"
FT                   /db_xref="UniProtKB/TrEMBL:A7N917"
FT                   /inference="similar to AA sequence:REFSEQ:NP_065331.1"
FT                   /protein_id="ABU75021.1"
FT                   /translation="MLVRVRGGKDGIAEYLRDGMKSDREMHRDQLDKRICIDGDLSITD
FT                   TIIKTMAKTDKPENYFHVTLSFAERDISEEKIREVYEEYKRNIMSSYTEEEFNIYAEIH
FT                   VPKIKSYEDKSTGEVVERFPHVHVVIPKKNLLDDKNLNPYGFYKTNLEYFDAIQERINS
FT                   KFNLVSPFDNQRVFKIDQSKLLARYKGDNFKGANAKLKSELFDVIQDKNITTMAAFKEE
FT                   LAKHGEVSIGKVGKPDEYLKIKPHDSTRNVRLTDSCFRPEFIEHRTLKREKPSEKQVNR
FT                   LVNEWVNSKSHEVKYIHQAAPKLREQYKALPTQLKGEFLNEQRERYYRQYNLSTGARLS
FT                   ERSTGTGLSERGAGASQRNISTSRRARDRKLGVERGIPRGFTDIPNGLPSMSELNVATA
FT                   GRKRGSRPTELLHDNASDHLAVKQTSRSPQLRRAGYEPRRRVVRLSVYRKPSPNATLAT
FT                   IKRIKAKAQHSESYVTQLFDSFQENKQEQSELGRFRTIRQNLKAESLLSHLSDSHGLVK
FT                   DQYSHFKAKDGSVRIKAETRAYNVSDFCTKYMGLSWGETKEILKTTYGKQRQQLAQQQR
FT                   VRQEQQAVNSIVFVSNRVTQGWGKKNPLDESIRLLKHLQRKEHIGELPMALHELERHRA
FT                   PETKDNAIVSANESFSAVENAKRIMKARDTAAQITLTMNDLVASKNDTKRYVDFSDKNT
FT                   GDKVFRDDGEKIVMHSKQADINHTAAALTLAAEKFGVVKINGTKEFKDQVIDVAVSKDL
FT                   NIVFADKKMEADFVRRKEELKQSVSLESVSQNLATNNQATTTTPKSTVTDTIAIEMEDG
FT                   RQYELTRTAEPETETRRAKAGAWTFADPQNALPKSIHKNIPSGVGEGDKIETEFGKAKV
FT                   TKADILSQQEPKLQPTKFEVEYQWDKLSGKLQVTINGESPNRFEKSTVEQIMKKDAFLK
FT                   NYTVKEVKFGLIDQKKAEGVQPVPKTYDAQANVIDKISEQKQSHRMK"
FT   gene            11802..12491
FT                   /locus_tag="VIBHAR_p08175"
FT   CDS_pept        11802..12491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08175"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08175"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75022"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X7"
FT                   /protein_id="ABU75022.1"
FT                   /translation="MSKCSEQFDVLSNALRILPEEAARLDYLCNKVNDPEEGISNIEIA
FT                   SVNVLNQFYGMMLNLKEDGVLSSIYEDDAINTILCIRHVLQHQSGRIKNTLRDSFNNAL
FT                   PKNVALINYSVSGEPMTDFPFYLNLGWMIDQIGKSNNAKKLVGIKTKWNLDKIEADLSK
FT                   ESLDADCIYINIMAFITEATRQLCKLYGAHFQPNGYDSRVYYSHFSSIDEVETNNYVIT
FT                   KFDGTRT"
FT   gene            complement(12573..12692)
FT                   /locus_tag="VIBHAR_p08176"
FT   CDS_pept        complement(12573..12692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08176"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75023"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X5"
FT                   /protein_id="ABU75023.1"
FT                   /translation="MVGRDTLHELDQPLKKLAYVSNHWGPLLCLMTEMTKRSR"
FT   gene            complement(12667..12894)
FT                   /locus_tag="VIBHAR_p08177"
FT   CDS_pept        complement(12667..12894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0782 0.00049 integrase, catalytic
FT                   region K00986; COG: COG2801 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08177"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75024"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X6"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:INSD:EAV90184.1"
FT                   /protein_id="ABU75024.1"
FT                   /translation="MRSYLGTSNINNTAPWVHGAHTKYEEVYLKAYTTPREAELEIGHY
FT                   MVFYNEERNHQGLNDLTPDEAYFGRQRYAA"
FT   gene            complement(12863..14431)
FT                   /locus_tag="VIBHAR_p08178"
FT   CDS_pept        complement(12863..14431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08178"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3436 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08178"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75025"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A7MYN3"
FT                   /inference="protein motif:HMMPfam:IPR004291"
FT                   /inference="similar to AA sequence:INSD:EAR54927.1"
FT                   /protein_id="ABU75025.1"
FT                   /translation="MIFSIINAMKKTPNINPESQDVAKLQAMVKALLLSQERKESQWKQ
FT                   ERQSLLEQLKLAFDRQFAKRSEALKPYDESQGDLFNEVECEAAKEEEVEVVTTTTTTKK
FT                   RGKRKPLPKTLPREVIELDLDDHEKQCACCQHSLHKIGEDRSEKLEFSPAVLKVLEYVR
FT                   PKYACRQCEQTEDNSHIVQKPAPQSIIPKSFATESLLANIILGKYQYAMPLYRQESLFT
FT                   QSGIELSRTTMARWVIQVSEKFTPLYAALKAHLLQQVVVQADETPLNVLKEDKKCYMWL
FT                   YCSGADSPDAALPNVKNIALYDYQNSRARVCPVAFLGDYSGYLQTDGYGAYDGLHHVTN
FT                   VGCLAHARRKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGATVETRKAERQQHA
FT                   KPILDELHDWMTSQQVISSSPLGKAIKYTLGQWPKLIRYIDDGHLSIDNNRAERAIKPL
FT                   VIGRKNWLFSNTPNGADASAMLYSIVETAKANGLILYDYMVKCMKELAKAEPDIDALLP
FT                   WNFKH"
FT   gene            complement(14468..14821)
FT                   /locus_tag="VIBHAR_p08179"
FT   CDS_pept        complement(14468..14821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08179"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3436 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08179"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75026"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A7MUY4"
FT                   /inference="protein motif:HMMPfam:IPR008878"
FT                   /inference="similar to AA sequence:INSD:EDK30750.1"
FT                   /protein_id="ABU75026.1"
FT                   /translation="MKHMLSAPEIYLYRESVDFRKSINGLAAIIESDTDLPLGSGALFL
FT                   FTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPAKEQNEVFTLTQFELDRLLSGFTII
FT                   GHKPVQINDFTMT"
FT   gene            complement(14818..15144)
FT                   /locus_tag="VIBHAR_p08180"
FT   CDS_pept        complement(14818..15144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08180"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG34527 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08180"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75027"
FT                   /db_xref="UniProtKB/TrEMBL:A7MSJ2"
FT                   /inference="similar to AA sequence:INSD:EDK30749.1"
FT                   /protein_id="ABU75027.1"
FT                   /translation="MRRFEMGKRHTNQEWQTLIEQSESSSLSTLAFCKLNELNPSTFYA
FT                   KRQQLKKADVSQGFVRAEVVEKTTKYQAQIATANMTLLINDVELSIPQGTPAAYLAELI
FT                   GALS"
FT   gene            complement(15181..15756)
FT                   /locus_tag="VIBHAR_p08181"
FT   CDS_pept        complement(15181..15756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0782 0.00021 integrase, catalytic
FT                   region K00986; COG: COG2801 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08181"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75028"
FT                   /db_xref="GOA:A7N8W7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W7"
FT                   /inference="protein motif:HMMPfam:IPR001584"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:INSD:EAV90180.1"
FT                   /protein_id="ABU75028.1"
FT                   /translation="MIDEIHLRYPFMGSRRIRNEMAKKGHNVNRKRVVRLMRDMGIGAI
FT                   YPKPRTTLANKAHKVYPYLLRDIEVTYPNQAWAIDITYIPMAKGFLYLVAIIDWYSRKV
FT                   LSWRLSNTMDTSFCIEALEDALKHYGPPDIFNSDQGSQFTSTEFTQKLLDHGVRISMDG
FT                   KGRWVDNVFIERLWRSLKYGKRSIKPAF"
FT   gene            complement(15897..16178)
FT                   /locus_tag="VIBHAR_p08182"
FT   CDS_pept        complement(15897..16178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08182"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2963 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08182"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75029"
FT                   /db_xref="GOA:A7MRR8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A7MRR8"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR002514"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:EAV93373.1"
FT                   /protein_id="ABU75029.1"
FT                   /translation="MTRKRRNHSPEFKAKVALDAARGDKTVAELAQKYNLHANQISTWK
FT                   KELLENAAMIFASESQSGKDNSEEVDKLHAKIGQLTMENDFLAKVLGR"
FT   gene            complement(16425..16772)
FT                   /locus_tag="VIBHAR_p08183"
FT   CDS_pept        complement(16425..16772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08183"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75030"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W9"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01539841.1"
FT                   /protein_id="ABU75030.1"
FT                   /translation="MKTKWFLLLWFFSVPAFCADSIHCKGTVTDAWIQSDGSLIINTSW
FT                   ASFVGLCSVSKTKNGITPDTCKSWVSMALTAVTTQKPLMMQYYNLKKCSDIKRYTASEK
FT                   PHYVMIRESLD"
FT   gene            complement(16784..17122)
FT                   /locus_tag="VIBHAR_p08184"
FT   CDS_pept        complement(16784..17122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08184"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75031"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X0"
FT                   /protein_id="ABU75031.1"
FT                   /translation="MKKCLLVAAILGSFSSQAEIKTGPPIEKLYPVSFYHDAGDGLYIE
FT                   FQQGAMPNCSGNKGGRLSKSNPNYKELYSLLLTMMATKNFKGNIRYQETNHKGWWHCSI
FT                   EGIFAFPK"
FT   gene            complement(17322..18023)
FT                   /locus_tag="VIBHAR_p08185"
FT   CDS_pept        complement(17322..18023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0782 2.6e-14 integrase, catalytic
FT                   region K00986; COG: COG2801 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08185"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75032"
FT                   /db_xref="GOA:A7N8X1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X1"
FT                   /inference="protein motif:HMMPfam:IPR001584"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:INSD:EAV90180.1"
FT                   /protein_id="ABU75032.1"
FT                   /translation="MIDEIHLRYPFMGSRRIRNEMAKKGHNVNRKRVVRLMRDMGIGAI
FT                   YPKPRTTLANKAHKVYPYLLRDIEVTYPNQAWAIDITYIPMAKGVLYLVAIIDWYSRKV
FT                   LSWRLSNTMDTSFCIEALEDALKHYGPPDIFNSDQGSQFTSTEFTQKLLDHGVRISMDG
FT                   KGRWVDNVFIERLWRSLKYEEVYLKAYTTPREAELEIGHYMVFYNEERNHQGLNDLTPD
FT                   EAYFGRQRYAA"
FT   gene            complement(18164..18445)
FT                   /locus_tag="VIBHAR_p08186"
FT   CDS_pept        complement(18164..18445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08186"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2963 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08186"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75033"
FT                   /db_xref="GOA:A7N8X2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X2"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR002514"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:EAV93373.1"
FT                   /protein_id="ABU75033.1"
FT                   /translation="MTRKRRNHSPEFKAKVALDAARGDKTVAELAQKYNLHANQISTWK
FT                   KELLENAAMIFASESQSGKDNSEEVDKLHAKISQLTMENDFLAKVLGR"
FT   gene            18675..18806
FT                   /locus_tag="VIBHAR_p08187"
FT   CDS_pept        18675..18806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08187"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08187"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75034"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X3"
FT                   /protein_id="ABU75034.1"
FT                   /translation="MQVKEVRESKCRFVTKRIQVCIWRESELTSNWSPVAKEFEELY"
FT   gene            19389..19820
FT                   /locus_tag="VIBHAR_p08188"
FT   CDS_pept        19389..19820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08188"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75035"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8X4"
FT                   /inference="similar to AA sequence:INSD:ABD79870.1"
FT                   /protein_id="ABU75035.1"
FT                   /translation="MAKQIWEMTPQDIQDHAVWQFPSWKDDSHDETVICQASQDDALDP
FT                   NSNIIVRAKFFDANGNEFIGFIHYGLAEVEYSQPNMFVNGKTVGFWFGITKPNHNDLIR
FT                   LNFPIVITSESVFGLEQITVTVEGYSYVNEASATCVMSC"
FT   gene            complement(19874..20563)
FT                   /locus_tag="VIBHAR_p08189"
FT   CDS_pept        complement(19874..20563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08189"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3547 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08189"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75036"
FT                   /db_xref="GOA:A7N8W0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W0"
FT                   /inference="protein motif:HMMPfam:IPR002525"
FT                   /inference="similar to AA sequence:INSD:EDK30169.1"
FT                   /protein_id="ABU75036.1"
FT                   /translation="MFKQLNLEASMNNDSIIFIGLDTHKSFIQVAVLQGHRGAQPQHLG
FT                   RIKSNKSALVKLALQLQSKYPKATLHFVYEAGPCGYWTYRLLTSIGHCCYVVAPSLIPK
FT                   KPGDRVKTDKRDAAKLAKLFKAEELTPIYVPEAEDEAIRDLSRARETAMKDLKDAKFQL
FT                   KGFLLRNNVQATVNDNWSKKHLRWLTDLILPHYSQQIVLQEMIITINALLRCEARNTEA
FT                   SASHLNH"
FT   gene            20693..20977
FT                   /locus_tag="VIBHAR_p08190"
FT   CDS_pept        20693..20977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08190"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08190"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75037"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W5"
FT                   /protein_id="ABU75037.1"
FT                   /translation="MEWSVLIVFVVLLIFIGHREISAMKYKHKLLERKIDFLLERSGLS
FT                   LDKHFGVPAQVLDAVKSGNKLKALRLYREETGASLVDAQKVIEELWSDT"
FT   gene            complement(21280..21402)
FT                   /locus_tag="VIBHAR_p08191"
FT   CDS_pept        complement(21280..21402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08191"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75038"
FT                   /db_xref="UniProtKB/TrEMBL:A7MRT6"
FT                   /protein_id="ABU75038.1"
FT                   /translation="MLSENTSLTQIYWDLSPKKSVVSGSPSPLALISRFIGAHP"
FT   gene            complement(21436..22479)
FT                   /locus_tag="VIBHAR_p08192"
FT   CDS_pept        complement(21436..22479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08192"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3547 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08192"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75039"
FT                   /db_xref="GOA:A7N8W1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W1"
FT                   /inference="protein motif:HMMPfam:IPR003346"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01540986.1"
FT                   /protein_id="ABU75039.1"
FT                   /translation="MRFYNNQHNYYCGIDLHARLLYVCILDSLGNKVLHKKIDADPDAL
FT                   LELITPCQDNIVIGVECMHCWYWVSDLCLDYAFDFVLGHALYMKAIHGGKTKNDRIDSF
FT                   KIASLLRGGNFPIAYVYPRAMRATRDLLRRRTKIMRHGADLKAHVANTFSQYNQQSHNV
FT                   QLRYPCAREQVRNQFDEPSINRSIDMDLNVIAFYTKELASVEHFIEKTAKQHNAQDYSL
FT                   IQTVPGIGRILALTILYEIGNIERFPSVQNFASYSRLVKCKAESAGKQKGTNGNKIGNA
FT                   YLKWAFSEAAVLYLRGNEPAKKYIQRLQKRMSKAKALSALAHKLGRCVYFMLRNKTVFD
FT                   EKRFLPQ"
FT   gene            complement(22896..23912)
FT                   /locus_tag="VIBHAR_p08193"
FT   CDS_pept        complement(22896..23912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08193"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3547 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08193"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75040"
FT                   /db_xref="GOA:A7N8W2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W2"
FT                   /inference="protein motif:HMMPfam:IPR003346"
FT                   /inference="similar to AA sequence:INSD:EAQ52307.1"
FT                   /protein_id="ABU75040.1"
FT                   /translation="MTQHKIIGIDLAKNIFFLVEINHKGKNLSRKKLQRSRLLNYVANQ
FT                   SPCIIAMEACSGAHYWAREFEKFGHDVLLYPPQHVKNQRRKQKNDYNDAEAIAELALYQ
FT                   RVYPVQHKSIEQQDIQSLIRMRRLCVTERTRLINQVRGLVAEYGIVIPKGKAAFRQAIP
FT                   EILEEVENQLSPILRELLSRQYERYLYIDEQILWFEEKLSQTVKQFDNAKRLMSIPGFG
FT                   PLTSQAVAVWLGSGLQFKTGRDASAAMGLVPKQDTTGGNVILLGITKRGNTYIRSLLVH
FT                   GARAALRRAKFKSDKLSKWMLELQERRGSNRAAVALANKLMRIAWAVIAKNEEYQPA"
FT   gene            complement(24023..25222)
FT                   /locus_tag="VIBHAR_p08194"
FT   CDS_pept        complement(24023..25222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08194"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG04673 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08194"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75041"
FT                   /db_xref="GOA:A7MTI6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A7MTI6"
FT                   /inference="protein motif:HMMPfam:IPR002559"
FT                   /inference="protein motif:ScanRegExp:IPR013838"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:INSD:ABE56601.1"
FT                   /protein_id="ABU75041.1"
FT                   /translation="MRDIQILQQAIENQCPDIHKKRLRSLMLATKAVLDGSALTLTKIG
FT                   RALDTDTTVKHAIKRIDRLLGNRNLHREKESIYRWHASFITRANPFPVVLVDWSDVREQ
FT                   LRYMTLRASVSVKGRAVTLYEQAFEYKNYNSPKSHQLFLDKLQSLLPQGCTPIIVSDAG
FT                   FRNTWFRQVANKGWFWLGRVRGEVSIKCGEGAWLWNKTFYPQATDKPLFLGESQLARRS
FT                   PLRCFAYLYKGQPKGRKAHRHSRTCQKHSAGKVFHKGAKEPWLLVTNIPNHVLNGVKIT
FT                   RLYAKRMQIEESFRDLKSPAYGLALRHNRTRCTKRIDILLLMALMAEIIMWWNGLIAMQ
FT                   AKWHYDFQANTIKHRRVLSIPRLGKEVRSHRRYRIKESQYHWAMVEYQRLTHTCGLGEL
FT                   "
FT   gene            25436..25756
FT                   /locus_tag="VIBHAR_p08195"
FT   CDS_pept        25436..25756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08195"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75042"
FT                   /db_xref="GOA:A7N8W4"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W4"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01259627.1"
FT                   /protein_id="ABU75042.1"
FT                   /translation="MNGKAFDNWQKSRKKGCLNWLFKTTFVTAILYIIFNVIFHYPTSD
FT                   AASITIFLSDNALNYSIYTIGMFFAFWAICYTTNLRMRKKLNVEMSPNKCLRFQDTLSN
FT                   LR"
FT   gene            26003..26827
FT                   /locus_tag="VIBHAR_p08196"
FT   CDS_pept        26003..26827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08196"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG17239 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08196"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75043"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8W6"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00802044.1"
FT                   /protein_id="ABU75043.1"
FT                   /translation="MYHYTDLNGFLSIIQNNSLWLTDARAMNDSLEISWFGKLFAKELE
FT                   RSIEGLHLSLSQKEILDDFINSSLNSNLTPHICCFSKEGDLLSQWRAYADDGFGVSIFF
FT                   DESAFNKVSLSQLPERLVDSTFYSDIIYSQEEQEVASKNLVDRTVNAINKISGNTRNDA
FT                   YKTLPIREFWDIKANIELQSYFSKNPAFSEEKELRFIKLVELDKLKYKEKLRFRVTGGT
FT                   IASYFELEFSKPSIKRVILGPKCKADGNTIRLFLDANGFEHVEVLKSKASYR"
FT   gene            27184..27402
FT                   /locus_tag="VIBHAR_p08197"
FT   CDS_pept        27184..27402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08197"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18697 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08197"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75044"
FT                   /db_xref="UniProtKB/TrEMBL:A7N900"
FT                   /inference="similar to AA sequence:INSD:CAG20226.1"
FT                   /protein_id="ABU75044.1"
FT                   /translation="MLNPPQLSEQPESFEYNNVRLPAIHKDSFKIMQRRFLLKDASPSY
FT                   RMEQQHHFRVIKSADYEEQLAQMDLAI"
FT   gene            complement(27553..27849)
FT                   /locus_tag="VIBHAR_p08198"
FT   CDS_pept        complement(27553..27849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08198"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_2397 7.2e-06 arsC; arsenate reductase,
FT                   putative; COG: COG0640 Predicted transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08198"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75045"
FT                   /db_xref="GOA:A7N901"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7N901"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR001845"
FT                   /inference="protein motif:HMMSmart:IPR001845"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01261173.1"
FT                   /protein_id="ABU75045.1"
FT                   /translation="MLKSKLTNISMVFNALGNETRLLIIHYLINQNEDSIRVGKIKDAL
FT                   GIPSSTLSHHLIVLSQTGALKQHKKGREIYCSVNQKCLRDAIMVFDKECCLNL"
FT   gene            complement(27836..28033)
FT                   /locus_tag="VIBHAR_p08199"
FT   CDS_pept        complement(27836..28033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08199"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75046"
FT                   /db_xref="GOA:A7MV40"
FT                   /db_xref="UniProtKB/TrEMBL:A7MV40"
FT                   /protein_id="ABU75046.1"
FT                   /translation="MIKRPFALVQILAVAFVLTKVTQNSSFAQEHQIVVTISIALISVA
FT                   WAALSGMIWDMLKGSLYVEK"
FT   gene            28171..29208
FT                   /locus_tag="VIBHAR_p08200"
FT   CDS_pept        28171..29208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08200"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0701 Predicted permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08200"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75047"
FT                   /db_xref="GOA:A7N903"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A7N903"
FT                   /inference="protein motif:HMMPfam:IPR005524"
FT                   /inference="similar to AA sequence:INSD:EAS45854.1"
FT                   /protein_id="ABU75047.1"
FT                   /translation="MSPEIITMAKEAGHMFLFLATELVILFLAVSYLVGILQEFLTPEK
FT                   IQSILSSRKGKGYIVAAFLGAITPFCSCSTIPFLKGLLRARAGFGPMMVFLFASPLLNP
FT                   VIIGLFIATFGLNVAVFYFVVAMVVAVSAGFILEKLGFEKYVRPEAYESTDSGSSCGTS
FT                   CGDSKPAPKKESSCGTSCGDSVPEVQISCCSSIGEAAATIVPSAEPSRWVRIWINTWKD
FT                   FKQVLPYLLMGIALGSLIYGFIPTDLIAEYAGAGNWYAIPVAAVIGIPLYIRAEAVIPL
FT                   SAALVQKGMALGSVMALIIGSAGASLTEVILLKSIFKNQMIAAFLFVILSMAVGAGYLY
FT                   TFLFA"
FT   gene            complement(29680..31884)
FT                   /locus_tag="VIBHAR_p08201"
FT   CDS_pept        complement(29680..31884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08201"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:pYptb0031 4.6e-111 topB; DNA topoisomerase
FT                   III family K01862; COG: COG0550 Topoisomerase IA"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08201"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75048"
FT                   /db_xref="GOA:A7N904"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A7N904"
FT                   /inference="protein motif:Gene3D:IPR013824"
FT                   /inference="protein motif:HMMPanther:IPR000380"
FT                   /inference="protein motif:HMMPfam:IPR006171"
FT                   /inference="protein motif:HMMPfam:IPR013497"
FT                   /inference="protein motif:HMMPfam:IPR013498"
FT                   /inference="protein motif:HMMSmart:IPR003601"
FT                   /inference="protein motif:HMMSmart:IPR003602"
FT                   /inference="protein motif:HMMSmart:IPR006154"
FT                   /inference="protein motif:ScanRegExp:IPR000380"
FT                   /inference="similar to AA sequence:REFSEQ:NP_990926.1"
FT                   /protein_id="ABU75048.1"
FT                   /translation="MIVYIAEKPSLAKAIFEGLGGNPQTQRGEGFYQHKEHVVTYCVGH
FT                   LLETYDPDDYDEKYAKWTFDDLPISTVYPPTLKPIPDTKSQLQTVLNFIKKADTIVHAG
FT                   DPDDEGQLLVDEVLNYAGNTKPVQRLLVADLNLAPVQKALANMESNEKYVPLGMSALAR
FT                   SISDKSFGYNLTRGCTLKGREKGFQGVLNVGRVKSAVMGLVNERTLANQNHQKSFYYDV
FT                   YAQFECGENRIKAKYNTKESDQVDDKKRLISASNASFIQDSVTNRPGLVTLVVTKPEKK
FT                   HAPQPLNLSALQQLCAKSYGYSAKKTLDIAQSLYETHKLLTYPRTDNRFISDEHYYQSS
FT                   DILVAIGATCPSLTDSITNTNVDMTRKHKAFNTDKIEAHHAIIPTTKHGSQASLNKEER
FT                   QVYELVSRYFIGLFYPESIRDKTKAMFEVEGYQFSATQSVLVEQGWEVLHSEEKETQSD
FT                   HDGFDLATLKSNTATTCVESEVEQKETKPPKLFTESTLLAAMTRAASFIDDPELRAKLE
FT                   AKDKDSNDQGSIGTEATRASILSQLAANTELISISEEKGYKEKVWRTTKQGQELCAALP
FT                   NEIIKPDISAIWAEKQAFVKAGEMSVEDFIADVDSYITERIDDLDKNGINITSNTVPCP
FT                   SCGKPLYRRKGRNGWFWSCSGYPECDKAYPDLQGKPDFRPRVKPVVSAHKCPTCSKGLI
FT                   RRKSPKGKGKYFWACSGYPDCITTLFDRKGRPNYESAKSS"
FT   gene            complement(31893..32429)
FT                   /locus_tag="VIBHAR_p08202"
FT   CDS_pept        complement(31893..32429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08202"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75049"
FT                   /db_xref="UniProtKB/TrEMBL:A7N905"
FT                   /inference="similar to AA sequence:INSD:AAW88290.1"
FT                   /protein_id="ABU75049.1"
FT                   /translation="MKHKLFMAAITAAFLLPVQPAFAASDDECAIWLCLPTGFPSGCSG
FT                   AKKAFVKRIKKFKPPLPSFTSCLFSGDVPIGTPSNDTDMFARDGRAAYIPPRVECVKWE
FT                   TGKDWSRCSKTEVRPSQIIKNQSCHVNHKEGTSSPKYCSHTISYVETFQDGEQYGETYY
FT                   FDNAGNTYIEGSTEH"
FT   gene            complement(32440..34218)
FT                   /locus_tag="VIBHAR_p08203"
FT   CDS_pept        complement(32440..34218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08203"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3505 Type IV secretory pathway, VirD4
FT                   components; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08203"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75050"
FT                   /db_xref="GOA:A7N906"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7N906"
FT                   /inference="protein motif:HMMPfam:IPR003688"
FT                   /inference="similar to AA sequence:INSD:ABI83648.1"
FT                   /protein_id="ABU75050.1"
FT                   /translation="MALSKKKKGILFAMFLFFTLLCLIGGLYGGGAAYYKLTNISLEHL
FT                   TYHSLFDQWQAYSHNPDIKKFLVIGVAVSIAITLFPTLMAIVIAIASQEREEIHGSAKF
FT                   ATDMDLANSGLFPNPKAKNKKPSILLGKMPKGRFKGRFIELESSQFVEVPAPTRSGKGV
FT                   GIVIPNCVTYPDSLVCVDIKFENLVKSGGFRQQCGQAVFLFAPDGYAIDEQAREREELR
FT                   THQWNPYDYVRRSPVFRVSDVLNIANSLYPISGDKGDIWNELAGKLFKGLSCWMLDTES
FT                   ITGITPSLPYVLKLGGIDGGLRAWMRREIKNDYVSDDARFEFNNCLSMAEETYSSVESN
FT                   LLSPLAIFSDRVTAAAVSGSDFDFRELRKKRMTIYVGCQPANLKNFGKLFNLFFEQLIS
FT                   ENTRTLPEHDDTLKYQCLGLLDEFTALGRVKQIEKAISYTAGYNLRFLTIYQDEGQLEE
FT                   VYGRENAKNIRKNHGVKVVYPPKEVDDNVRRLSDTLGTKTVKKRKVSRSTGKGSSRTTS
FT                   EDELKRPLMMPHEIVELGFEKHPIAKELGIKTLILKENQRPFIAEKIIYFEEPVFAERV
FT                   KYSEANIPEIPRLKLH"
FT   gene            complement(34222..35238)
FT                   /locus_tag="VIBHAR_p08204"
FT   CDS_pept        complement(34222..35238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0711 6.7e-27 cpaF1; flp pilus
FT                   assembly ATPase CpaF K01529; COG: COG0630 Type IV secretory
FT                   pathway, VirB11 components, and related ATPases involved in
FT                   archaeal flagella biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08204"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75051"
FT                   /db_xref="GOA:A7N8V2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V2"
FT                   /inference="protein motif:BlastProDom:IPR001482"
FT                   /inference="protein motif:HMMPfam:IPR001482"
FT                   /inference="similar to AA sequence:INSD:ABI83647.1"
FT                   /protein_id="ABU75051.1"
FT                   /translation="MNTIDKAATVNQLLSMTGLRHYLDLEGLTEIAINRPNEVWFDRGN
FT                   GWERDALPNLSLNMCSNLAKALATFAGLTIPLGEANPVASVIFPDGERGQIAIPPATEN
FT                   GIVSMTIRKPSLTRFALSSYQESGRFSDFREMDVNRVELTPVQEQLLTLKQNGDMSQFF
FT                   SMAVKSKLNILLVGGTGSGKTTVMKAMVDEYPTDKRLFTIEDVHELDLPNHPNHLHLFY
FT                   KQGGLTPKQIIESCMRMKPDHVLLAELRGDEAWTYLEMLNTGHEGSITTIHANDCYSTP
FT                   ARLAGLVKQSEVGQTLDYHHIMRTIRTSIDVIAFFKHTHLVELFYDPVEKNRLLSEG"
FT   gene            complement(35222..35395)
FT                   /locus_tag="VIBHAR_p08205"
FT   CDS_pept        complement(35222..35395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08205"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75052"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V4"
FT                   /protein_id="ABU75052.1"
FT                   /translation="MRNISEFDIELAQRLNIPPTALTHSSPQFVNYWLEVQKEIEQRSI
FT                   LHNTEDNHEHHR"
FT   gene            complement(35589..36782)
FT                   /locus_tag="VIBHAR_p08206"
FT   CDS_pept        complement(35589..36782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08206"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2948 Type IV secretory pathway, VirB10
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08206"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75053"
FT                   /db_xref="GOA:A7N8V8"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V8"
FT                   /inference="protein motif:HMMPfam:IPR005498"
FT                   /inference="similar to AA sequence:REFSEQ:YP_271713.1"
FT                   /protein_id="ABU75053.1"
FT                   /translation="MSDDNTIPSAYESANLDRGELTVSGRKKKNKAVIVIALVILSLVV
FT                   VAVGVLFAINQFREAEVETKPLQPESTAEVIGVEKGTVGNDSAWFEKAKRDHEKDKAQQ
FT                   ERAAQWKRKQELKQAKAQATQQQPVTVPKTDVPEPNVAKQPSATSKRGKKAPPTPQERR
FT                   LMGSLMVNVESGNAASSQSTTEPASYDNSYDAPTFAMGHAAKRKQGGLDFLLKHGSIIP
FT                   CALYSQVISDYQGIVMCRVTQDVYSANGKALLVERGSMLTGSQNVQLEAGKNRVFTTWA
FT                   DIETPNGIAIRIDSLGAGRLGASGNEAWVDNHFKERFGGAILLSFLDDAFGALAEKAAS
FT                   SDGDITFDSSTENASNMAEKALESSINISPTGYTQIGQRINIIVARDIDMSSVYAFE"
FT   gene            complement(36775..37542)
FT                   /locus_tag="VIBHAR_p08207"
FT   CDS_pept        complement(36775..37542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08207"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3504 Type IV secretory pathway, VirB9
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08207"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75054"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V3"
FT                   /inference="protein motif:HMMPfam:IPR010258"
FT                   /inference="similar to AA sequence:REFSEQ:YP_271712.1"
FT                   /protein_id="ABU75054.1"
FT                   /translation="MMKQLIVSLACLMAFSTHALTLPKHQGKDRRIVYAEYDPSDVIAI
FT                   RTKVGVATLIQLDKNETIVGEHSGLGMGDAAAWGFNVRGNNVFFKPQAKQPNTNLTIVS
FT                   DLGRTYSFELFTNKQPFYVVKMRYPKPKKANTTPLKAPCTDGKYNFRYVKWGDEELAPA
FT                   YAWDDGRFTCMKFTKNAELPVIYQINADSKESLVNYHIEQDTIVIHSVANEYRLRLGER
FT                   VLGVLSHFVEFAGHNQKASSIKATRVIKEDEHE"
FT   gene            complement(37539..38294)
FT                   /locus_tag="VIBHAR_p08208"
FT   CDS_pept        complement(37539..38294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08208"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3736 Type IV secretory pathway, component
FT                   VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08208"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75055"
FT                   /db_xref="GOA:A7N8V5"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V5"
FT                   /inference="protein motif:HMMPfam:IPR007430"
FT                   /inference="similar to AA sequence:INSD:BAB12653.1"
FT                   /protein_id="ABU75055.1"
FT                   /translation="MSTTIDSALEHNHTKAEKKPTAKHQKQADAYLEEIKQFEQDRIEI
FT                   AKKNAKTAWKVATGSCVLALVLGITIVVMMPLKTVDYRLLYIDPQTGMTQIIQPLADAR
FT                   EITYGEALDKHWLNRYVITRGSYQWQTVQDAFDYVKLTSRHDVFSAYSTQLRAKNSPVE
FT                   VFKDYKKIRLEDVAISFLPTRQDQMLAQVSFTKVVLNSDDTPDTAYLPTKWSATVTFDY
FT                   LKEIKTESERQLNPLGFRVTSYQENRVIQ"
FT   gene            complement(38291..38404)
FT                   /locus_tag="VIBHAR_p08209"
FT   CDS_pept        complement(38291..38404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08209"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75056"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V6"
FT                   /protein_id="ABU75056.1"
FT                   /translation="MGCSSTPPPPPEPKGDITPVNPSKVNLADLYTQGDMQ"
FT   gene            complement(38518..39468)
FT                   /locus_tag="VIBHAR_p08210"
FT   CDS_pept        complement(38518..39468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH3035 0.0074 comC; leader peptidase
FT                   (prepilin peptidase) / N-methyltransferase K02236; COG:
FT                   COG3704 Type IV secretory pathway, VirB6 components; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08210"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75057"
FT                   /db_xref="GOA:A7N8V7"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V7"
FT                   /inference="protein motif:HMMPfam:IPR007688"
FT                   /inference="similar to AA sequence:INSD:ABI83642.1"
FT                   /protein_id="ABU75057.1"
FT                   /translation="MFDRLFDFVHLITQENIASFVGIFTATITPLIGACVVLYAIYLAF
FT                   QALYDAENMMIMESLKFIASLALCTTVAFNTSWYLNSIVPMVYYSGDDIANAMLGSTGS
FT                   GSLQTMFDTMLKQFADTWGEVSFGMSDSWGQSIYFMLLAFLILIGYLPFIVVATAYLLI
FT                   AKVMVSFLLILGPLFIMFAFFPSTRDMFKTWTGQCLNYVLLVVVYPIAFNLFTRTLEHV
FT                   IFGGSATAIGLSTVIMTIILFGCCILISVQIPVFCSSLSGGVGINGLVSNMGMGMRSLS
FT                   NAAKGGAGAAKRAGQGTYNGAKSLGDKFKNRIRPG"
FT   gene            complement(39478..39711)
FT                   /locus_tag="VIBHAR_p08211"
FT   CDS_pept        complement(39478..39711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08211"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75058"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U5"
FT                   /protein_id="ABU75058.1"
FT                   /translation="MKQIISLIAFSFLLTACSSEETKTIEYYSAHLDEAKTVKIECEKK
FT                   TATLSENCKNAIKAVLDDSYKKSMFGDGITYE"
FT   gene            complement(39724..40389)
FT                   /locus_tag="VIBHAR_p08212"
FT   CDS_pept        complement(39724..40389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08212"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75059"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U7"
FT                   /inference="protein motif:HMMPfam:IPR012991"
FT                   /inference="similar to AA sequence:REFSEQ:NP_940727.1"
FT                   /protein_id="ABU75059.1"
FT                   /translation="MLKRTTLALCITLALNASTQASGIPVVDVAGITQMVVDSAQRAQE
FT                   FTQSISEARNRLNQLKSQAEHYKSMVEGHYGFEEILSDPNLNDVIDLSAYSDLYDAVDD
FT                   ISDLRSEFGLYSDDPVIQRRYDMQLKQLRFQEMLYERSTERNERMSRLLSQFGSATTPA
FT                   AKEDLANSINFETMQMQNEQRMMDSMSDMLERQKQIEHSKQLNDSYQRSMYGDGITYE"
FT   gene            complement(40392..42650)
FT                   /locus_tag="VIBHAR_p08213"
FT   CDS_pept        complement(40392..42650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08213"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3451 Type IV secretory pathway, VirB4
FT                   components; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08213"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75060"
FT                   /db_xref="GOA:A7N8U8"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U8"
FT                   /inference="protein motif:HMMPfam:IPR004346"
FT                   /inference="similar to AA sequence:INSD:ABI83640.1"
FT                   /protein_id="ABU75060.1"
FT                   /translation="MLSLDDAKIMATISLNGIPFESESYNTLKPSFELVKNILSTLARK
FT                   YGSQLAIWTHIVKRKERFEANYRFESDFMQRFSDRYLQDFSGEDFFSVRYYITFVLNYK
FT                   GTLTEGEDELGDILKTVSAALKRFDSKVLEVGDDHRCEHVEFLSYLLNYNDQPKPLTSE
FT                   KVRNYIGHSDWHFGHDLLEVRNANNEATKFATFFELDALPIATEMGMWDFILSQPTEFI
FT                   LTQSMIFMQPLKAQKMIDRQTNFIESSDNAEHELEELQAARDYVASGAVSFGDYHASLA
FT                   VIGDSPDKVIIDSADLNGQFLAKGTVLKRSNLKSQFSFLSALPASKMRIKPSPRTIANL
FT                   ASTWSLHNYSTGKATGNPVGDGSAIIPLKTLSNSLFHMNCHASAIGRDNTGEKSAGHTM
FT                   ILGASGSGKTTLEATLTGFFTRFDQQIFCIDYKRSTELFIRAFGGEYFSIKEGEDTGIN
FT                   PFQLEQSPKLVSFLNRLVCRLAQDSQGHISAHDEQEIKDAIDNVMNFDAPMRGLSVMLQ
FT                   SIQNPDLRMRLSKWCRSENGKLAWCLDSPHNQFNPQAMDRIGFDSTLLLEKDSSGHVHP
FT                   ASEPVLACLFFLKELMQESGKLLQTIVEEFWMPANFPLTQAVMKRALKTGRLMNEFMVL
FT                   SSQSPEDAIHCEIFPAIVQQTATKVYLPNPDAEYEAYQQCNLTQGEFDKLKALDKQSRT
FT                   MLIKQSNTSCFAKLDLGGFDEFLPIISGSTDDIVLCETIRAEVGNDPDLWIPELLKRR"
FT   gene            complement(42685..43056)
FT                   /locus_tag="VIBHAR_p08214"
FT   CDS_pept        complement(42685..43056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08214"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75061"
FT                   /db_xref="GOA:A7N8U6"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U6"
FT                   /protein_id="ABU75061.1"
FT                   /translation="MQDEERDQYASYNSLARKPLMFGMPIIPLITGMLLMLLTGWLGLS
FT                   FFGVKGLVFPAFIALGLLYIRVRSEEDSRAIDEMKWEAKGFLTRLRCQSNTISFTSIDN
FT                   HPFRRKQHVSEWFKNNTPD"
FT   gene            complement(43059..43376)
FT                   /locus_tag="VIBHAR_p08215"
FT   CDS_pept        complement(43059..43376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ape:APE_2503.1 0.0090 3-oxoacyl-[acyl-carrier
FT                   protein] reductase K00059; Psort location:
FT                   CytoplasmicMembrane, score:9.50"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08215"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75062"
FT                   /db_xref="GOA:A7N8U9"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U9"
FT                   /inference="similar to AA sequence:REFSEQ:NP_858093.1"
FT                   /protein_id="ABU75062.1"
FT                   /translation="MKALNSNTQTYSNLKAAFIAMMLVLVCHPAIAAGGLDEATNWVNE
FT                   IADWAYKLLGAAVFVYSIVMVILALLEKKTWGDVGISIAKAAAAGGIVAAVTYAWSIWG
FT                   S"
FT   gene            complement(43391..43993)
FT                   /locus_tag="VIBHAR_p08216"
FT   CDS_pept        complement(43391..43993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08216"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG17192 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08216"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75063"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V0"
FT                   /inference="protein motif:HMMPfam:IPR008258"
FT                   /inference="similar to AA sequence:REFSEQ:NP_858092.1"
FT                   /protein_id="ABU75063.1"
FT                   /translation="MLLELSALIPLLNTCQSQVDASILKRLIDNESSRNPYAIAVVGAK
FT                   PVNQPKTKLEAIQIATNLEKQGFQYSLGLMQIYKENFPAYGMTIESAFDACKSIEVGAD
FT                   IYAKCYHRAKAQAPNKAHQQLLDDAASCYYSNNFTRGYQSEGEKGLSYVEKFNRAKKLP
FT                   SNTISESYDSTSESSQPSKPTPPKQAHSWDVFGDFSY"
FT   gene            complement(43983..44342)
FT                   /locus_tag="VIBHAR_p08217"
FT   CDS_pept        complement(43983..44342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08217"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75064"
FT                   /db_xref="GOA:A7N8V1"
FT                   /db_xref="InterPro:IPR008876"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8V1"
FT                   /protein_id="ABU75064.1"
FT                   /translation="MDDKKIVEGQLTLDKQTYALLNQASQRSFRSLKKEASLRLIDHVQ
FT                   RFHHSPQNKLDEIVYRTSIKIPIRVRKSVIPCLYRGKYKVKTLVDEYSIRLKDHLKRYP
FT                   TISAVGVVQEEEHAP"
FT   gene            complement(44396..44578)
FT                   /locus_tag="VIBHAR_p08218"
FT   CDS_pept        complement(44396..44578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08218"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08218"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75065"
FT                   /db_xref="GOA:A7N8Z3"
FT                   /db_xref="InterPro:IPR008876"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z3"
FT                   /inference="protein motif:superfamily:IPR010985"
FT                   /inference="similar to AA sequence:REFSEQ:NP_932202.1"
FT                   /protein_id="ABU75065.1"
FT                   /translation="MPQNAEKDTTGIWFELDEDTNRLLEESAEANDRSKRKEARFRLKD
FT                   HLSKFNQHMKPRAKS"
FT   gene            complement(44584..44745)
FT                   /locus_tag="VIBHAR_p08219"
FT   CDS_pept        complement(44584..44745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08219"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75066"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z4"
FT                   /protein_id="ABU75066.1"
FT                   /translation="MTNKLKRFRSYRYLRTQSKVDKATKERTPQDIEVERTRNHFRRFH
FT                   AREFLALR"
FT   gene            45337..45927
FT                   /locus_tag="VIBHAR_p08220"
FT   CDS_pept        45337..45927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1589 0.0074 LexA repressor K01356; COG:
FT                   COG2932 Predicted transcriptional regulator; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08220"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75067"
FT                   /db_xref="GOA:A7N8Z5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z5"
FT                   /inference="protein motif:HMMPfam:IPR001387"
FT                   /inference="protein motif:HMMPfam:IPR006198"
FT                   /inference="protein motif:HMMSmart:IPR001387"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /inference="similar to AA sequence:INSD:EAU26084.1"
FT                   /protein_id="ABU75067.1"
FT                   /translation="MKTLGQRLEELRVNNRLTKKDVGHVAGVTGTTVDKWEKDLIIPRD
FT                   AKLKRLAEHYNVSFEWLRVGVDGAKVTPVPESFAVSIQSYKEGDESVFFDARLLPSGHS
FT                   ERLVYVQVEGHSMGDILPDGSKLIVDLEDRHYKDDKLYVFKTQDFMSIRRLSFTSTGVR
FT                   LQSLGSQKDEVLTFQQLSKVDVLGRVISSICPR"
FT   gene            complement(45949..46380)
FT                   /locus_tag="VIBHAR_p08221"
FT   CDS_pept        complement(45949..46380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08221"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75068"
FT                   /db_xref="GOA:A7N8Z6"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z6"
FT                   /protein_id="ABU75068.1"
FT                   /translation="MPMENTYDILCTIGVSAFLGVGLWLALELLPFQSNGNVTIATTLE
FT                   EKESPKAGLLFDASQNAVLRGEDEILRIKQGSTNHRFISYLFEHEGQDIPIEQLYQDLR
FT                   LPEDTYLKKLIANTKLPKEIRSQAFVVSKSTIRFQTTLD"
FT   gene            complement(46387..47034)
FT                   /locus_tag="VIBHAR_p08222"
FT   CDS_pept        complement(46387..47034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pto:PTO1077 0.00019 protease I K05520; COG:
FT                   COG3155 Uncharacterized protein involved in an early stage
FT                   of isoprenoid biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08222"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75069"
FT                   /db_xref="GOA:A7N8Z7"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z7"
FT                   /inference="protein motif:HMMPfam:IPR002818"
FT                   /inference="similar to AA sequence:INSD:AAV82488.1"
FT                   /protein_id="ABU75069.1"
FT                   /translation="MKKIAVVLSGCGVFDGAEINEAVLTLLALEERGIAYQCFAPDKPQ
FT                   LHTINHLKGEDKEQARNVLEESARIVRGSVSALSELDEQDFSALIIPGGFGVAKNLSTF
FT                   ATDGADFSIDVEFQQVMTAFASKKKPVGYMCIAPVLLPKVYNGVRCTIGYDEETASVIN
FT                   SLGGLHVDCTVDNIVVDNDYNVVTTPAYMLAGSIADAKKGIDKLVEQVASLI"
FT   gene            complement(47031..47510)
FT                   /locus_tag="VIBHAR_p08223"
FT   CDS_pept        complement(47031..47510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08223"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08223"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75070"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z8"
FT                   /protein_id="ABU75070.1"
FT                   /translation="MKLKILFLSFLSFGLAGWGVAITKPDKLDHLSSFMTYNYVKSVVW
FT                   YHSRGKLKELESIILNDDLSDEEAIKRKIQNMLKHRTSVYLREFNSLDAPIQNVGNHYE
FT                   EMFEFAPFLNDVYEVVFSDKDVHLKLSLIADIMEAYQTRANNQLLDLMNNKEARL"
FT   gene            48118..49014
FT                   /locus_tag="VIBHAR_p08224"
FT   CDS_pept        48118..49014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08224"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG18010 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08224"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75071"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z9"
FT                   /inference="similar to AA sequence:INSD:AAW88259.1"
FT                   /protein_id="ABU75071.1"
FT                   /translation="MQSFESLNQVTPSPALDAKDKHARKLRKESNAIYRANRKARVREC
FT                   IEIHHDAVAAEKARLKAKGKAFTNLEIGFTKRRVLRDKKNPKVINLPLEFATILKGCEE
FT                   FIDNPSRFPALDIWVSEMRNRQARELVAKVLACLLSNTDMISGRVGKPTEAGMKTLSYY
FT                   QLQEDYALRFGEYIAPKSFGKAIKYLKQAGYFHSEAINIRMEDGEGAVRSAPAYKQFSE
FT                   RFFSDLKVVRYSNVAESIVATRKRQMKEGLRHTWVSFREIANGVRQIFLNANKFESIAE
FT                   STGRVFEAYLPLHPNPH"
FT   gene            49611..49733
FT                   /locus_tag="VIBHAR_p08225"
FT   CDS_pept        49611..49733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08225"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75072"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T6"
FT                   /protein_id="ABU75072.1"
FT                   /translation="MCCEDVSCSLRERILIFFAQLRMCDAVTWFKDKGNDRKQK"
FT   gene            49714..50112
FT                   /locus_tag="VIBHAR_p08226"
FT   CDS_pept        49714..50112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08226"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75073"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T8"
FT                   /protein_id="ABU75073.1"
FT                   /translation="MIESKSDYNSRKKQVIDSIKIELDSMGVIYEPPSYIYTLELEDGK
FT                   YYVGFSDRILARLSMHFMSGGAAWVKKYKPVKILDVRRGSIELESLRTLEVMREFGVSN
FT                   VRGGKWCELRDFTPAELLELNKRIRSLG"
FT   gene            50225..50992
FT                   /locus_tag="VIBHAR_p08227"
FT   CDS_pept        50225..50992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_1803 1.1e-31 ATPase, ParA family
FT                   K03496; COG: COG1192 ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08227"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75074"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U0"
FT                   /inference="protein motif:HMMPfam:IPR002586"
FT                   /inference="similar to AA sequence:INSD:EDK30790.1"
FT                   /protein_id="ABU75074.1"
FT                   /translation="MKTKVISAANQKGGVGKTTTLVNLGAELARKRKVLVVDLDPQGNC
FT                   TKTLTGQRHFQFEETVAAMFDKPKVVSIVDLIRPALLDGESIQNLDVVPADFQLSRIIE
FT                   TSLTKINRERILEKQLAKLGETYDFILLDTPPNLSLTTLNAIQASDLILIPVDSGAFSL
FT                   DGISPLLEAVSEIKDDEANYLILRNEVDVRNTVINEFIEEELEVAKDKVLSVTIRRSEH
FT                   VSQANAVSAPVRFYKSGSLVNNDYRKLASLIAG"
FT   gene            51013..51309
FT                   /locus_tag="VIBHAR_p08228"
FT   CDS_pept        51013..51309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08228"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75075"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U3"
FT                   /inference="similar to AA sequence:INSD:EDK30789.1"
FT                   /protein_id="ABU75075.1"
FT                   /translation="MAKLKARGAITIASSTEQKNEKSQAITTVKKKVTTSYKVPPLTLR
FT                   MSLKDKESIAGWVDDLQKLSERNVSAAKLFRALALYRDNIDDDELIKLIDKMN"
FT   gene            complement(51369..51539)
FT                   /locus_tag="VIBHAR_p08230"
FT   CDS_pept        complement(51369..51539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08230"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75077"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T7"
FT                   /protein_id="ABU75077.1"
FT                   /translation="MNNNFHFIGALLTALLLAGCSTTYNISGDVKLEVHGDLITTERDT
FT                   FEVLNDAKVGL"
FT   gene            51522..51683
FT                   /locus_tag="VIBHAR_p08229"
FT   CDS_pept        51522..51683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08229"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75076"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T9"
FT                   /protein_id="ABU75076.1"
FT                   /translation="MKVIVHYFFIKRNKCIRRLQIFLQNFSEDRILDMKKPLSSGLLFL
FT                   ERYLWIKQ"
FT   gene            complement(51662..52000)
FT                   /locus_tag="VIBHAR_p08231"
FT   CDS_pept        complement(51662..52000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08231"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3668 Plasmid stabilization system protein;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08231"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75078"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U1"
FT                   /inference="protein motif:HMMPfam:IPR007712"
FT                   /inference="similar to AA sequence:INSD:EAQ55634.1"
FT                   /protein_id="ABU75078.1"
FT                   /translation="MSTNIVYTEAFENMTDDQINYLSLWSEEDVVVERIENLVEKFESN
FT                   ITDNPEMYPPCHELTTLGVYNIRQFSFGGFKLLYEYHEHIDTAAALALVRDRQDLQSML
FT                   VDYCLIHK"
FT   gene            complement(52011..52280)
FT                   /locus_tag="VIBHAR_p08232"
FT   CDS_pept        complement(52011..52280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08232"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23217 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08232"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75079"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U2"
FT                   /inference="similar to AA sequence:REFSEQ:NP_798265.1"
FT                   /protein_id="ABU75079.1"
FT                   /translation="MKMKRDITMRTETVSFLKKHAADLPLDDAMTITQNGKPIYVVESY
FT                   EERQRRDQAIALMKLVSFGREDMTAGRTTSSDKFKERLAARKSK"
FT   gene            complement(53129..53581)
FT                   /locus_tag="VIBHAR_p08233"
FT   CDS_pept        complement(53129..53581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08233"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08233"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75080"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8U4"
FT                   /protein_id="ABU75080.1"
FT                   /translation="MKAVRLEEVESIMRWRDRSSAKDGHLQREMFDKYITLMVAWERLK
FT                   RGIATERDQLICYQIHKGLMKGLCQGDKVPLMHLGARVESMVEPDKRITLRKPMKIHQA
FT                   IAWVADMDGRSHEAVRKQWNKWRNATQDEKDDVTRKFMSCKDADFT"
FT   gene            53778..54764
FT                   /locus_tag="VIBHAR_p08234"
FT   CDS_pept        53778..54764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:orf19.2410 9.6e-09 IMH1; involved in
FT                   vesicular transport K01553; COG: COG1196 Chromosome
FT                   segregation ATPases; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08234"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75081"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T0"
FT                   /inference="protein motif:superfamily:IPR010978"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001144381.1"
FT                   /protein_id="ABU75081.1"
FT                   /translation="MARERAFSDQQVIEAANALLVEGKNINGTSLRNKIGTGRPSALMS
FT                   AFKALEDSGEILAPMLPDSTEQTITHQELPPEIAERLSVMLGDVEQLVHQINDHAHYTV
FT                   EQRLNQAIAEANERAANAAKREAESIQEQDKAFEQLEDALESNADLQEQLKQEHKESSR
FT                   LNAALNVAQSETKAALDTVSERDERLAEMQKQIASMQKQLNTAESDKAKAEGQAEQLGK
FT                   QLEEKSEEMAKLNASLKTSEKELGSLQGQVVSLTEQIANQKATNEQLQGKFDEEKAAHI
FT                   RAESRIESLSSELNKKNIALLETQASLGEAEKLSAKLEGQLMQYQEN"
FT   gene            54852..55247
FT                   /locus_tag="VIBHAR_p08235"
FT   CDS_pept        54852..55247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08235"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75082"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T1"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00345529.1"
FT                   /protein_id="ABU75082.1"
FT                   /translation="MFLSHGVNEQGDLVSILEVSAGRVPLSCPFCGQGLIAKKGAQKEH
FT                   HFAHDGQTCADAKAILQMTALPLFDMDMGLSKTEITLLEKLSRWRSFSRTWLSSKQRAV
FT                   FDELVVSGLVDFQEGDDKPRLSNVRRQ"
FT   gene            complement(55450..56994)
FT                   /locus_tag="VIBHAR_p08236"
FT   CDS_pept        complement(55450..56994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08236"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3436 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08236"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75083"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T5"
FT                   /inference="protein motif:HMMPfam:IPR004291"
FT                   /inference="similar to AA sequence:INSD:EAR54927.1"
FT                   /protein_id="ABU75083.1"
FT                   /translation="MKKTPVINPESQDVAKLQAMVKALLLSQERKESQWKQERQSLLEQ
FT                   LKLAFDRQFAKRSEALKPYDESQGDLFNEVECEAAKEEEVEVVTTTTTTKKRGKRKPLP
FT                   KTLPREVIELDLDDHEKQCACCQHSLHKIGEDRSEKLEFSPAVLKVLEYVRPKYACRQC
FT                   EQTEDNSHIVQKPAPQSIIPKSFATESLLANIILGKYQYAMPLYRQESLFTQSGIELSR
FT                   TTMARWVIQVSEKFKPLYAALKAHLLQQVVVQADETPLNVLKEDKKCYMWLYCSGADSP
FT                   DAALPNVKNIALYDYQNSRARVCPVAFLGDYSGYLQTDGYGAYDGLHHVTNVGCLAHAR
FT                   RKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGATVETRKAERQQHAKPILDELH
FT                   DWMTSQQVISSSPLGKAIKYTLGQWPKLIRYIDDGHLSIDNNRAERAIKPLVIGRKNWL
FT                   FSNTPNGADASAMLYSIVETAKANGLILYDYMVKCMKELAKAEPDIDALLPWNFKH"
FT   gene            complement(57054..57407)
FT                   /locus_tag="VIBHAR_p08237"
FT   CDS_pept        complement(57054..57407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08237"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3436 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08237"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75084"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A7MUY4"
FT                   /inference="protein motif:HMMPfam:IPR008878"
FT                   /inference="similar to AA sequence:INSD:EDK30750.1"
FT                   /protein_id="ABU75084.1"
FT                   /translation="MKHMLSAPEIYLYRESVDFRKSINGLAAIIESDTDLPLGSGALFL
FT                   FTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPAKEQNEVFTLTQFELDRLLSGFTII
FT                   GHKPVQINDFTMT"
FT   gene            complement(57404..57730)
FT                   /locus_tag="VIBHAR_p08238"
FT   CDS_pept        complement(57404..57730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08238"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG34527 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08238"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75085"
FT                   /db_xref="UniProtKB/TrEMBL:A7MSJ2"
FT                   /inference="similar to AA sequence:INSD:EDK30749.1"
FT                   /protein_id="ABU75085.1"
FT                   /translation="MRRFEMGKRHTNQEWQTLIEQSESSSLSTLAFCKLNELNPSTFYA
FT                   KRQQLKKADVSQGFVRAEVVEKTTKYQAQIATANMTLLINDVELSIPQGTPAAYLAELI
FT                   GALS"
FT   gene            complement(57956..58441)
FT                   /locus_tag="VIBHAR_p08239"
FT   CDS_pept        complement(57956..58441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abo:ABO_2330 5.8e-17 diamine
FT                   N-acetyltransferase K00657; COG: COG0454 Histone
FT                   acetyltransferase HPA2 and related acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08239"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75086"
FT                   /db_xref="GOA:A7N8T3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T3"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="similar to AA sequence:INSD:EAQ52641.1"
FT                   /protein_id="ABU75086.1"
FT                   /translation="MENKVNVRKAIKQDSGKLLELIGHKAEFDRSMKGFDGEISTTKEK
FT                   IERTLFGDYPFAHALLLEVDGEVQGFALFHYRYSSFRGEPSIWLDDLLVIGKYRSKGYG
FT                   AELMHALKSEAQKSLTTHISWTASPHNTKAHEFYKKLGAEVERMDGQRPYFRWEMYG"
FT   gene            59173..59937
FT                   /locus_tag="VIBHAR_p08240"
FT   CDS_pept        59173..59937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08240"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75087"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8T4"
FT                   /inference="protein motif:ScanRegExp:IPR003006"
FT                   /inference="similar to AA sequence:INSD:EDK29629.1"
FT                   /protein_id="ABU75087.1"
FT                   /translation="MLIFNCTKAAANFLSPHKSKESKPLIQAVPDFDIEDVGSPQAPIS
FT                   QWLVQHTKQLGQDILYVCHVQHRFTMVFTGVEKGNWLQFMQCFWERLVNHFCWLIEELS
FT                   LNINSSPQNWVDNIRTLHSQNGERPIFCLRYSPSVNASAARFRSTFETALYEIGCLPND
FT                   EEAGEFEFHENSRIHFSGCKENMFYPAHELLCNGLEMYMDVSGNDLDAFKSLSFNYFEQ
FT                   TLSDMFNVSTITPEDVAMVLNTLTTEKGTNNR"
FT   gene            60093..60206
FT                   /locus_tag="VIBHAR_p08241"
FT   CDS_pept        60093..60206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08241"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75088"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y7"
FT                   /protein_id="ABU75088.1"
FT                   /translation="MAGFRQVIISKITSIQITLTPFGVYHCFYHKQGSQEW"
FT   gene            complement(60233..60529)
FT                   /locus_tag="VIBHAR_p08242"
FT   CDS_pept        complement(60233..60529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08242"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75089"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y8"
FT                   /protein_id="ABU75089.1"
FT                   /translation="MWLFFDWFFCFYSLFNVLFKVADVRLVLNPPILKKDPVVGSFFKS
FT                   RSLRLRVGDRGDKKTYHKCLTVFGPQPSPEIISSVHAVVQMNLIDKILLVLNI"
FT   gene            complement(60457..60678)
FT                   /locus_tag="VIBHAR_p08243"
FT   CDS_pept        complement(60457..60678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08243"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75090"
FT                   /db_xref="GOA:A7N8Y9"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y9"
FT                   /protein_id="ABU75090.1"
FT                   /translation="MVWLQDSLGVLLVAAVFFYGGLKFLHWGRTGVLDRRDIKDNPRYM
FT                   KLATACGYFSIGFSVFIVCLMFFLKWPM"
FT   gene            complement(60686..61888)
FT                   /locus_tag="VIBHAR_p08244"
FT   CDS_pept        complement(60686..61888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08244"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75091"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z0"
FT                   /protein_id="ABU75091.1"
FT                   /translation="MPFYSSAGATVPPPQRVYVDKVTSPDGRDLEWAQGERLASVDFTD
FT                   LAAKIRVSRFTNTYYFEDEPGTIKSSSRTGLFFEFKNSEDFTLGDEAIFEVKFLTPDRS
FT                   RFVTHRSCHTKVVFGGPSQETCETKFVKHSIKITRDSKGALRLKSDSDDFLSYGYKKSG
FT                   GREYFEVFSTIDLMTHWNLKDKDAVPYIVLTAFNANSNSSKSVEAPAVLAKYTGVQNAA
FT                   KVWDVYKPTVESYIRASNMPDIRPVVQVGVSVQVRQVEVVGTVTSDFKDIDVAFSGGVA
FT                   ISNTDLEINASVMGFATDSLESVTSGTSTTVSGELGSAVNVGGALSYNSNNELIGAGIS
FT                   VGFGSAIDVDLSVTESTVVYTTRTSSNESERGDGNRRDGYNEREGRTSRVDGEGGRSIE
FT                   H"
FT   gene            complement(62203..62742)
FT                   /locus_tag="VIBHAR_p08245"
FT   CDS_pept        complement(62203..62742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08245"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1961 Site-specific recombinases, DNA
FT                   invertase Pin homologs; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08245"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75092"
FT                   /db_xref="GOA:A7N8Z1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z1"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR006119"
FT                   /inference="protein motif:HMMPfam:IPR006120"
FT                   /inference="protein motif:ScanRegExp:IPR006118"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:ABM02113.1"
FT                   /protein_id="ABU75092.1"
FT                   /translation="MNLGYARVSTDDQNLDVQLSQLEKIGCEKIFQDKASGKSSEREAL
FT                   NKLIDFAREGDVVHVTKVDRIARNTIDALQIADQLANKGAGLVFHDLGDLDINSDVGRV
FT                   IYTTISAFAEMERKRILQRCNEGRERARAEGRHLGRFPNKTLHSRIQELAEQGMNKHAI
FT                   SKELGCSRTTVYKVLE"
FT   gene            62951..63211
FT                   /locus_tag="VIBHAR_p08246"
FT   CDS_pept        62951..63211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08246"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG19216 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08246"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75093"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Z2"
FT                   /inference="protein motif:HMMPfam:IPR003756"
FT                   /inference="protein motif:HMMTigr:IPR006442"
FT                   /inference="similar to AA sequence:INSD:CAG18000.1"
FT                   /protein_id="ABU75093.1"
FT                   /translation="MQSLTANTAKTKFGDLLMKVQREPVQISKNGSPVAVVMSCEEYEE
FT                   LEALKMAMVKSRFEQAERDIVNGDLVDGETFMNELDSGKFD"
FT   gene            63211..63513
FT                   /locus_tag="VIBHAR_p08247"
FT   CDS_pept        63211..63513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08247"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3668 Plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08247"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75094"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S2"
FT                   /inference="protein motif:HMMPfam:IPR007712"
FT                   /inference="similar to AA sequence:INSD:CAG18001.1"
FT                   /protein_id="ABU75094.1"
FT                   /translation="MTRYKLSPAAQTDLIDIRRYTLENWGGAQWTNYFGELKQSMALLA
FT                   SNELIGIDMPELGTGYCRFPLKHHVIYYIRKPDHIVIAAVLGRNMSPAKHFQRQL"
FT   gene            complement(63596..63724)
FT                   /locus_tag="VIBHAR_p08248"
FT   CDS_pept        complement(63596..63724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08248"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1961 Site-specific recombinases, DNA
FT                   invertase Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08248"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75095"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S6"
FT                   /inference="similar to AA sequence:INSD:AAX89421.1"
FT                   /protein_id="ABU75095.1"
FT                   /translation="MRTKEALAARKKAGVTLGRPKGEAEKLKLDPKRDQIEKYLGM"
FT   gene            complement(63714..64121)
FT                   /locus_tag="VIBHAR_p08249"
FT   CDS_pept        complement(63714..64121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08249"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1961 Site-specific recombinases, DNA
FT                   invertase Pin homologs; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08249"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75096"
FT                   /db_xref="GOA:A7N8S3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S3"
FT                   /inference="protein motif:HMMPfam:IPR006119"
FT                   /inference="protein motif:ScanRegExp:IPR006118"
FT                   /inference="similar to AA sequence:INSD:AAX89421.1"
FT                   /protein_id="ABU75096.1"
FT                   /translation="MPQYAYLRVSSDSQDVANQKHGIYEYCNRVGIVNLCFIEDVVTGK
FT                   KKWHERKLGELIDGMEVGDKLIFAEVSRIARSTLQVLEVLEVCMAKGIDVYIAKQNMQL
FT                   DGSMQAKITEVDRNGTWSRSRDRTRVYFDEN"
FT   gene            complement(64728..65804)
FT                   /locus_tag="VIBHAR_p08250"
FT   CDS_pept        complement(64728..65804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08250"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5527 Protein involved in initiation of
FT                   plasmid replication; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08250"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75097"
FT                   /db_xref="GOA:A7N8S4"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S4"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000525"
FT                   /inference="similar to AA sequence:INSD:AAW51295.1"
FT                   /protein_id="ABU75097.1"
FT                   /translation="MSDEEYFYPVVSDNLPKHIKKGHQLVFSRQDLSAREADMFALMIA
FT                   HMKANDWERSTPHYEFTSHQLSEWLGVESKHIGSNLSPVANRLASRKIGIKIETGKGDI
FT                   EFDYRPLFKHIAYKNGTLTMVPNDMLKSEYIEYNQGFALINTRNFFDVKKEYSKRLYEL
FT                   LSRFKDKGFEMHQQKLDELKGVFGLLDEACKLKKDKSSFKNNSVFMKRCIRESIKELTE
FT                   HPQIRKELLFLEGENGEKGFEVIKKGRTITGIKFLFRWIKLGTIEELNQHDALKTIREL
FT                   ELKRLQDKIKLTEAELEALAIAYRYIGKEQHALKVEESLSKRHLNREPEVDNDHQSEVD
FT                   SLLDKIDTLSEISDNPDY"
FT   gene            66017..66139
FT                   /locus_tag="VIBHAR_p08251"
FT   CDS_pept        66017..66139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08251"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08251"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75098"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S5"
FT                   /protein_id="ABU75098.1"
FT                   /translation="MPTRSFKAEELTLSVVADEKRQRREISGRESSLLGCKKSK"
FT   gene            66745..67047
FT                   /locus_tag="VIBHAR_p08252"
FT   CDS_pept        66745..67047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08252"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75099"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S7"
FT                   /inference="similar to AA sequence:INSD:AAW51296.1"
FT                   /protein_id="ABU75099.1"
FT                   /translation="MRFLKLRTDHNRVRRDGTRYVTPLIVDSPRRFAPSRDRKETSLRR
FT                   KQCQLITGAHDSGKSRWLTRLKDNRHEIWGKKPQPVLLEGLMPLSSWVEVKGIDK"
FT   gene            67138..67467
FT                   /locus_tag="VIBHAR_p08253"
FT   CDS_pept        67138..67467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08253"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75100"
FT                   /db_xref="GOA:A7N8S8"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S8"
FT                   /inference="similar to AA sequence:INSD:AAW51296.1"
FT                   /protein_id="ABU75100.1"
FT                   /translation="METQSLLFIDDAHKLTGRKAQIARKCLMSAKLWLMTCSEEGRLPP
FT                   SIRPIVERREPQRINLESDVSYDTTKALVWFMVALCVVSGAWEAGAVIGGLQMLGSGRR
FT                   STRAD"
FT   gene            67457..68206
FT                   /locus_tag="VIBHAR_p08254"
FT   CDS_pept        67457..68206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08254"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75101"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R4"
FT                   /inference="similar to AA sequence:INSD:AAW51297.1"
FT                   /protein_id="ABU75101.1"
FT                   /translation="MQIKYGLLMLCPLLYSAAYANDWGIATLWDEPTAQPPEIKPFELP
FT                   TLKGDTPHYNTPTPALKPAPKIDPDAIFQTVLNCYPEKSKFKLDLNLVAGIRTNLDEYN
FT                   SDDWPEISEHYVGIVGKMPLYSTTEQSRERQWEYQRRTATATSVASFTQALADRNYAYR
FT                   LMGLYLSLEARSQQRVTQGVANVNEQVALLEKVASSHRDVLAHEAKIVEHRLALVALCE
FT                   SSYSDRVNLYLQKLAYLPPHAKPKVAQ"
FT   gene            68203..68721
FT                   /locus_tag="VIBHAR_p08255"
FT   CDS_pept        68203..68721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08255"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23067 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08255"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75102"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R5"
FT                   /inference="protein motif:HMMPfam:IPR007404"
FT                   /inference="similar to AA sequence:INSD:AAW51298.1"
FT                   /protein_id="ABU75102.1"
FT                   /translation="MKWLNHGLIAGAICAVVSPPHVPICVAGATAPDWMEFVAKGLGRN
FT                   IKHRGPTHIFTHWLIVALVFTLVWDYQGIGIAFAWGGVSHILTDAMTVSGGPFSPYSDR
FT                   RFHLFGGRFRTGDPVEYAISAGVVIVCIGLSHITGGQGFAPFFYDWAGMYEQGLIDALE
FT                   WKTNRFRLI"
FT   gene            68756..69334
FT                   /locus_tag="VIBHAR_p08256"
FT   CDS_pept        68756..69334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08256"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4970 Tfp pilus assembly protein FimT"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08256"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75103"
FT                   /db_xref="GOA:A7N8R6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016824"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R6"
FT                   /inference="protein motif:HMMPfam:IPR012902"
FT                   /inference="protein motif:HMMTigr:IPR012902"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01480572.1"
FT                   /protein_id="ABU75103.1"
FT                   /translation="MTAVAGKKERILNRVLNRGFTLIELLITICVLSVLLIFAAPSFSN
FT                   LFESSRMKTAQDELMGFVIMAKSEAVFRNTPVYIHFRELANVNPDERCMVLSLSDSISD
FT                   CTTNVIYTLHGRVFDGLTLEQTYSQNVIEVDPVSGWPLLSHSTFDSESNSELLKFFARG
FT                   DQKIAFKMHITGRVSFCGIGGDWYRTEAC"
FT   gene            69415..69612
FT                   /locus_tag="VIBHAR_p08257"
FT   CDS_pept        69415..69612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08257"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75104"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R7"
FT                   /inference="similar to AA sequence:INSD:EAS63282.1"
FT                   /protein_id="ABU75104.1"
FT                   /translation="MSSRRHLLPSVVPLRTQHATFTALGSSLHEGTDWHPATYKAVRAG
FT                   SYQELRHCFFDFLLAKYSWY"
FT   gene            complement(69528..71042)
FT                   /locus_tag="VIBHAR_p08258"
FT   CDS_pept        complement(69528..71042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3486 4.2e-252 RNA-directed DNA
FT                   polymerase K00986; COG: COG3344 Retron-type reverse
FT                   transcriptase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08258"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75105"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R8"
FT                   /inference="protein motif:HMMPfam:IPR000477"
FT                   /inference="protein motif:HMMPfam:IPR013597"
FT                   /inference="similar to AA sequence:INSD:EAS63283.1"
FT                   /protein_id="ABU75105.1"
FT                   /translation="MQENLKNFIQGEMQMMIPKEISASPDSAQWQSINWKAVESHVLKL
FT                   QMRIAKATREGKHGKVKALQWILTHSRSAKLLAVKRVSQNKGSKTPGIDGVIWNTDTRR
FT                   MKAANQLSRKAYQAKPLKRIYIPKKNGKLRPLGIPCMIDRAQQALHLLALEPVSETLAD
FT                   PNSYGFRPNRSTADAIAQCFKCLAMKRSAQWVLEGDIKACFDKIGHQWLMDNIAIDKRM
FT                   LEQWLKSGFMDKGLFYRTDEGTPQGGVISPTLMLMTLTGLEQRIKSTALKKGARANFIG
FT                   YADDFVVTCASKEVLENDIKPLIADFLTERGLTLSEEKTHITHISRGFDFLGFNHRKYK
FT                   GKLLIKPSKSNTLLFLSNLRELIKKHATIPVNDLIKLINPKLRGWSNYYRHCVAKQVFG
FT                   YVGHKLFHALWHWAKRRHPTKSRTWIALKYFINRQGQWQFHGWQKIMNMDCQFNLFQIA
FT                   KVPIERHVKIRSAATPFDPQYQEYLAKRKSKKQCRNSWYEPALTAL"
FT   gene            complement(71715..71831)
FT                   /locus_tag="VIBHAR_p08259"
FT   CDS_pept        complement(71715..71831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08259"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75106"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R9"
FT                   /protein_id="ABU75106.1"
FT                   /translation="MLSCEIDDQDMVMVVYYFKAQKQISPEVVQSFVEYFNL"
FT   gene            71833..72075
FT                   /locus_tag="VIBHAR_p08260"
FT   CDS_pept        71833..72075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08260"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75107"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S0"
FT                   /inference="similar to AA sequence:INSD:EAU25631.1"
FT                   /protein_id="ABU75107.1"
FT                   /translation="MNTKKTSKSVASKAAKALSDPNASKIQKSLAASAMAQADKSKQTG
FT                   KDMEAKASKVLQSDKYSDETKEFAASVLAQSNKKR"
FT   gene            72085..72345
FT                   /locus_tag="VIBHAR_p08261"
FT   CDS_pept        72085..72345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08261"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75108"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8S1"
FT                   /inference="similar to AA sequence:INSD:CAG22429.1"
FT                   /protein_id="ABU75108.1"
FT                   /translation="MSTCQSEHRHYPEFEQLPHDQGGMGRHKCCGCAYERGYALGLERQ
FT                   EELNIDIDSLPVSQAGTVRHKSPHAAFAIGYQDGVRASYNQ"
FT   gene            72355..73389
FT                   /locus_tag="VIBHAR_p08262"
FT   CDS_pept        72355..73389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08262"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75109"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y1"
FT                   /inference="similar to AA sequence:INSD:EAR10744.1"
FT                   /protein_id="ABU75109.1"
FT                   /translation="MKGTLQYYDIDKLGIYKRGSDEQLFDSSEAVLDSLIGWFKQRPNL
FT                   VNTSTRKADKAVGQSNVYCYDIDGANGEYVFVLWNELTNADDEILTLSKDSKPGKAKVK
FT                   SGVDSNTVIPGLPSYYWISLNHDLLATIHYDHAMTSLVALRNYITGYMQNYSEFAVTHK
FT                   DNEDKVIGYRHPDDKDGDLGYFKLDLKRKTDESTIEELTQKHDKITKIVRRTQKQAEDV
FT                   ELVGWFHNLASQAVGRGLPKAKEVHVEVELDFTPATANDFLDIVTAYQKEIIDPDKYNN
FT                   LGFVLKGESGRKIFLDGKYLKTEHAFEIQRIGKNPFGASELLDYIGTKQVRLVPRKPNK
FT                   RKAA"
FT   gene            73386..73949
FT                   /locus_tag="VIBHAR_p08263"
FT   CDS_pept        73386..73949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08263"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08263"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75110"
FT                   /db_xref="GOA:A7N8Y2"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y2"
FT                   /protein_id="ABU75110.1"
FT                   /translation="MTDKKASFGWLKFGLWVAFLVGYVIVANKYLFDFAFTLKVELIKS
FT                   QIGILVNVSAILFGVIGAWLALIYPTALQKVQGKENIGLAFSGVDLSVLKSLVLVLLFS
FT                   TTSLIASLLCDLTLTFSTHASIVQIISAGKIKAVCALIVWLLFAVQISAISSLLFSSFK
FT                   LVYDLFISKAYTDLHHLLGRNKTK"
FT   gene            complement(74068..74178)
FT                   /locus_tag="VIBHAR_p08264"
FT   CDS_pept        complement(74068..74178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08264"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75111"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y3"
FT                   /protein_id="ABU75111.1"
FT                   /translation="MNKARMSISTNKLWGKLVLELVGLTRVWTETHQWFC"
FT   gene            74432..78475
FT                   /locus_tag="VIBHAR_p08265"
FT   CDS_pept        74432..78475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08265"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5635 Predicted NTPase (NACHT family); Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08265"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75112"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y4"
FT                   /inference="similar to AA sequence:INSD:CAD06790.1"
FT                   /protein_id="ABU75112.1"
FT                   /translation="MCSKLYLQRRLSNENKTFSEVELLAASNYVVVLAEPGGGKTELLG
FT                   SLAQQLGTSSVTANMFVQLGARHENTPLVIDAFDELAKIDQSGIHKLLAKITIAKPSHV
FT                   VISSRSSEWDISATNAVKNFLEIEPLVVRLCEFGDSEQRAIFEHHAPGEDFTRFYSEVC
FT                   RFDLEALLPNPQFLKMFADAYLESERNFADKQSIFKLAVERLAREVSQTSSRTSLSLSA
FT                   SQKVDISSEVFVKLLLSGSEGVSVSEIEENRIYPLLTSLAGNEPSVFNILATRLFKPGD
FT                   STDHHRPVHKIVAEYCAAAHLTKRIADPADALTLHQCLPIIAPNSTVRDELRGLLGWMA
FT                   ALGNKAVQHAAIELDPYAVLANGDPSQLAPSSKQLLLTKLKEIEETDPYFRRSDFWRRF
FT                   SVAGFFTEDIILDIKALLNSQDDGHLRNLILELLIESPIAHLLIDELRQILLDSQEDKY
FT                   NRIYAIKCLLGCTTYAYESDLTKLLSEATPASLEVAAKGMELLDLNMFELAFLETYFLA
FT                   CANLYPSNKLRSERVIGARYFIKSIIFRLNQENVEQLLDTLTRDLTCTCGLKSYKCDCR
FT                   NGISKIVGYMLDRYFDTALPPYEPLRVWGWVENLNFHRSMEPKDSRSVQVLYENSELRQ
FT                   GILTHVFSGLTGSDQIFETKRHKFGIQSHSGLRLFKEDYQFIVDLAFDTDNPELWVSFI
FT                   VRHDRHRKPEEKGSDDLRRHMRTQALEKPMFMREWAKCNRAYSLFVKEEYKRWEARSNR
FT                   MSRRYKQRQKNIHAENIQYIQENRELIESGRHWSFLVHFAQTILTEPKDIVLKFGDEEI
FT                   VKNALRNCHKFIEPEVPDLSKLAELRCSSKGLYVETILFASCVEIMRKHGSLNSVKPEL
FT                   LLVLKTHFNVHYDAVDETEYNALKAEVDRLLFTNNESTEQFLRSYVEPQLANSQCSHPR
FT                   VDMLKYDEIFTHLRAKLSIEWLERFDELGFSTLDTLFDLATQFGDRNMLNDIIRTRCSD
FT                   YLSKFPEQTDDENIEQRRKFWFVRAFYFLDLEIAKPYFDWLKSDSNSLLLFEGRSGRMN
FT                   RDSSSYWPNLTSTKIELILIIFFHQWPKVHLPSCWGTGSPKGETAYRFLTEIIWSIGSD
FT                   TPDEAIPVLNRLIQDHTFSDIQRELKSIKAEQLRKKSLRDFEPPTPEKIVDLLDNNAVV
FT                   TVEGLRQLVLQKLEDYQKDIDGGEFNAATRYYTKDDNGKVIHRNEVSCVEIIAERLNLV
FT                   LSPKSIAISSEYQTKNQNRIDITAAKMIEGKRRLLVIEAKGQWHKDLYTAASAQLYQRY
FT                   SIHPDAEQQGIYLVIWFGANEAIAGRKNIGITCAQDLKLSIEERLPPEIKGLIDVFVLD
FT                   VSLS"
FT   gene            complement(78677..79747)
FT                   /locus_tag="VIBHAR_p08266"
FT   CDS_pept        complement(78677..79747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08266"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1475 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08266"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75113"
FT                   /db_xref="GOA:A7N8Y5"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y5"
FT                   /inference="protein motif:HMMTigr:IPR004437"
FT                   /inference="similar to AA sequence:INSD:AAW51292.1"
FT                   /protein_id="ABU75113.1"
FT                   /translation="MAKKRGGSPLGNAPGSQEAQQSAAKANLTTLTQQLTAELDKAGTN
FT                   AAEYLREQFGLESVGQSMVWQLASGNTATFNEVTLSYEQVRDETFVTFDVNGRDQSLLT
FT                   AESLSDLNSLEFQQFYPAVGREIEGKIDVLDGSRRRAWFLLQEGHVKTFRILVTQDEIS
FT                   VSDAQALAKQLQTAKEHNLREIGQQCIAIKSANAEITQAEIAKQVGLSQAGVSKAMKAA
FT                   SIDKKLVKLFPVVNALSHPDYALLDKVMKTCEDKKQIAGFVKKIEKSLVNIQAEYSLED
FT                   QKDEIVTTIKAELKVAEAKKESDKAEVTPLAQFDSKGMFARKRVKGRNFSYEFGRLSKE
FT                   MQDKLDSAIAKVLEEK"
FT   gene            complement(79747..80946)
FT                   /locus_tag="VIBHAR_p08267"
FT   CDS_pept        complement(79747..80946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0816 2.3e-11 partitioning protein A
FT                   K00903; COG: COG1192 ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08267"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75114"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Y6"
FT                   /inference="protein motif:HMMPfam:IPR002586"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAW51293.1"
FT                   /protein_id="ABU75114.1"
FT                   /translation="MDTQQTTSHLQSLKQGADAYIKRRNQRLLANHRKELRNFTRAEAS
FT                   AYLGIDAKTLDKYVTAAEIDPRRHEDSQWSIDIAEMYRVRDLLPEALRKEPKFSRSEQQ
FT                   SAQVIVIQNQKGGVGKTVSAATVASGLATEFHQEYRVGLIDMDGQATLSMYYAPEADQE
FT                   GNLSVGDLIMRNFDLDEDETFEQAVSEAFLETTIPNLRILPAAQSDRAIEGWFHEQVFS
FT                   HKLPSPYSILAEIIDAVKDEFDIIIIDTPPSLGYATYNAYFAATSVVFPLSITENDIDA
FT                   TCSYFSYIPQVWALLANANHDGYDFMKILLTNHRDSSTTTELMNSLYDHFAPYLYSKEF
FT                   KHSEAIRQASSLLSTVFDMSKSEYPKSKSTFQTAQQNGYEVTSQIQRDILNVWREQEQA
FT                   "
FT   gene            complement(81135..81665)
FT                   /locus_tag="VIBHAR_p08268"
FT   CDS_pept        complement(81135..81665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08268"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75115"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Q8"
FT                   /inference="similar to AA sequence:INSD:BAC97783.1"
FT                   /protein_id="ABU75115.1"
FT                   /translation="MLCFYTVKGKLMKRLILATAFSFLMLGCTSQPEEPTMNYVDIGSK
FT                   ESANSVIELTYHNSDAAPEYQNFTVSLYVSQLPSEASFEMCNFADDVCNSGYSVWQNPL
FT                   RPEQKGVWFSYDLAFPIAVRKELEIELPITKHLTNQTLLEWDKPTTLNTKKVYSDGEAN
FT                   VHVSMTAVVRQLL"
FT   gene            complement(81733..82989)
FT                   /locus_tag="VIBHAR_p08269"
FT   CDS_pept        complement(81733..82989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3210 5.3e-149 DNA-directed DNA
FT                   polymerase K00961; COG: COG0389 Nucleotidyltransferase/DNA
FT                   polymerase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08269"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75116"
FT                   /db_xref="GOA:A7N8R2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R2"
FT                   /inference="protein motif:HMMPfam:IPR001126"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01484000.1"
FT                   /protein_id="ABU75116.1"
FT                   /translation="MFALVDANAFYCSAEQVFRPEWRGKPIVVLSNNDGCVVAANRQAK
FT                   ECGIEKFKPYFQMKALCEQRGVIALSSNYELYADLSSKMMAVIGRFAPEQHIYSIDESF
FT                   LSFERTTAAIPCLREHGQMLRKSVWRECRLPVCVGMGPTLTLAKIANHAAKKIAGFNGV
FT                   CVLDGVTERESVLAQLAVSDVWGVGKRLTTHLKQLGITTALQLAKYPAPLARKVFNVEL
FT                   ERTVRELNGQVCKQWDEARADKKQIFSTRSFGERIEDETSLRQALCHHAGIASRKARKQ
FT                   QSLCKVLMCFASSSPFDDVSYSRRVVHRFPYPTADVTQLTKVVSELTDQLFSEGVRFYK
FT                   VGVGLLDLVDGRQEQADLFNPTPNNSSLMSVFDGLNQRYGQNTVFLGAQGIEQKWQMRR
FT                   QLLTPQYTTCWTDLPQVKC"
FT   gene            complement(82989..83396)
FT                   /locus_tag="VIBHAR_p08270"
FT   CDS_pept        complement(82989..83396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF1269 8.5e-48 DNA polymerase V subunit
FT                   K03503; COG: COG1974 SOS-response transcriptional
FT                   repressors (RecA-mediated autopeptidases); Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08270"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75117"
FT                   /db_xref="GOA:A7N8Q6"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Q6"
FT                   /inference="protein motif:HMMPfam:IPR006198"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /inference="similar to AA sequence:INSD:AAW85764.1"
FT                   /protein_id="ABU75117.1"
FT                   /translation="MNVIPISARAGITGFESPAAEYRQLSLDLDELLIEHPSATFLGRA
FT                   SGDSMQGVGIFDGDILIVDRHVTLNNMDVIVANLNGEFVCKLIDIKHRQLLSAHPNHVP
FT                   VLVQDCDIFTVEGVVIRSIRCHRASHLLGQA"
FT   gene            83694..83912
FT                   /locus_tag="VIBHAR_p08271"
FT   CDS_pept        83694..83912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spn:SP_0240 0.0092 phosphoglycerate mutase
FT                   family protein K01834; COG: COG0702 Predicted
FT                   nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08271"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75118"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Q7"
FT                   /inference="similar to AA sequence:INSD:EAS65779.1"
FT                   /protein_id="ABU75118.1"
FT                   /translation="MPDKTFNISTIGRFRSDTPVDYIGHRYLTNAFEQSTSQHLLLITS
FT                   LGCDDSWQYLSDRAKEGFETQYVKNTR"
FT   gene            complement(84255..84644)
FT                   /locus_tag="VIBHAR_p08272"
FT   CDS_pept        complement(84255..84644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08272"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3755 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08272"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75119"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8Q9"
FT                   /inference="protein motif:HMMPfam:IPR009739"
FT                   /inference="similar to AA sequence:INSD:EAS65778.1"
FT                   /protein_id="ABU75119.1"
FT                   /translation="MMKKWFYYPMVAAFILLTSFNIAFADYSKEFDQCIDTSGAYSPAV
FT                   VKCMNEELSKRDKLLNTAYKQYMARIQDFRKEDLRKTQRLWIQYRDAKCDMFYHSESGS
FT                   GGLEDLHDCLITETIQRTKELNEGW"
FT   gene            85163..85330
FT                   /locus_tag="VIBHAR_p08273"
FT   CDS_pept        85163..85330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08273"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08273"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75120"
FT                   /db_xref="UniProtKB/TrEMBL:A7N1P0"
FT                   /protein_id="ABU75120.1"
FT                   /translation="MQVEEVGKSEGCIVTIQIQILIWHESGLTSDWSSVAREFEELYSR
FT                   RNANDDFKRD"
FT   gene            85311..86780
FT                   /locus_tag="VIBHAR_p08274"
FT   CDS_pept        85311..86780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3486 2.6e-250 RNA-directed DNA
FT                   polymerase K00986; COG: COG3344 Retron-type reverse
FT                   transcriptase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08274"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75121"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R1"
FT                   /inference="protein motif:HMMPfam:IPR000477"
FT                   /inference="protein motif:HMMPfam:IPR013597"
FT                   /inference="similar to AA sequence:INSD:EAS63283.1"
FT                   /protein_id="ABU75121.1"
FT                   /translation="MISKEISASPDSAQWQSINWKAVESHVLKLQMRIAKATREGKHGK
FT                   AKALQWILTHSRSAKLLAVKRVSQNKGSKTPGIDGVIWNTDTRRMKAVNQLSRKAYLAK
FT                   PLKRIYIPKKNGKLRPLGIPCMVDRAQQALHLLALEPVSETLADPNSYGFRPNRSTADA
FT                   IAQCFKCLALKKSAQWVLEGDIKACFDKIGHQWLMNNIAVDKRMLEQWLKSGFMDKGLF
FT                   YRTDEGTPQGGVISPTLMLMTLAGIEQRIKSTALKKGARANFIGYADDFVVTCASKEVL
FT                   ENDIKPLIADFLAERGLTLSEEKTHITHISRGFDFLGFNHRKYKGKLLIKPSKSNTLLF
FT                   LGNLRELIKKHATIPVNDLIKLINPKLRGWSNYYRHCVAKQVFGYVGHKLFHTLWYWAK
FT                   RRHPTKSRTWIALKYFINRQGQWQFHDWQKIMNMDCQFNLFQIAKVPIERHVKIRSAAT
FT                   PFDPQYQEYLAKRKSKRQCRNSWHEPALAAL"
FT   gene            complement(86696..86893)
FT                   /locus_tag="VIBHAR_p08275"
FT   CDS_pept        complement(86696..86893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08275"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75122"
FT                   /db_xref="UniProtKB/TrEMBL:A7N8R3"
FT                   /inference="similar to AA sequence:INSD:EAS63282.1"
FT                   /protein_id="ABU75122.1"
FT                   /translation="MSSRRHLLPSAVPLRTQRATFTALGSSLHEGTYWHPATYKAARAG
FT                   SCQELRHCLFDFLFAKYSWY"
FT   gene            complement(87025..87159)
FT                   /locus_tag="VIBHAR_p08276"
FT   CDS_pept        complement(87025..87159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08276"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3436 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08276"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75123"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A7MW65"
FT                   /inference="similar to AA sequence:INSD:EAR53317.1"
FT                   /protein_id="ABU75123.1"
FT                   /translation="MLYSIVETAKANGLILYDYMVKCMKELAKAEPDIDALLPWNFKH"
FT   gene            87399..88430
FT                   /locus_tag="VIBHAR_p08277"
FT   CDS_pept        87399..88430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fth:FTH_1650 1.0e-12 isftu1; ISFtu1
FT                   transposase K01152; COG: COG3335 Transposase and
FT                   inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08277"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75124"
FT                   /db_xref="GOA:A7N220"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A7N220"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="protein motif:superfamily:IPR012337"
FT                   /inference="similar to AA sequence:INSD:CAG20119.1"
FT                   /protein_id="ABU75124.1"
FT                   /translation="MKITLTPQQKLQLEQMHDIERDSRVCDRIKAVLLASEDWSQAMIS
FT                   QALRIHESTVARHLSDYVLSEKLKPENGGSQSKLSATQTMQLIEHLTEKTYSHTHQIVA
FT                   YVKETFGLDYTVSGMNKWLHHNGFSYKQPKGVPHKFDEAKQQAFIEAYEALKASCGEDE
FT                   SIVFIDAVHPTLSTKISHGWIRTGQDKVIETTGNRSRLNIIGALNLSDIGATIVHDYEN
FT                   INSETIVRFFCKLRESYPLTHKLHIILDGAGYHRSDLVKDAAFVLNIELHYLPPYSPNL
FT                   NPIERLWKVMNEKSRNNVYFKSKRDFKAAIDQFFTVTLPEIAGSLASRINDNFQVLKPA
FT                   SSS"
FT   gene            complement(88400..88918)
FT                   /locus_tag="VIBHAR_p08278"
FT   CDS_pept        complement(88400..88918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VIBHAR_p08278"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3436 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:VIBHAR_p08278"
FT                   /db_xref="EnsemblGenomes-Tr:ABU75125"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:A7N909"
FT                   /inference="protein motif:HMMPfam:IPR004291"
FT                   /inference="similar to AA sequence:INSD:EAR56288.1"
FT                   /protein_id="ABU75125.1"
FT                   /translation="MVVQADETPLNVLKEDKQCYMWLYCSGADSPDAALPNVKNIALYD
FT                   YQNSRARACPVAFLGNYSGYLQTDGYGAYDGLHHVTNVGCLAHARRKFMDAKKLQGKGK
FT                   SGKADKALAKIQKLYGIESRLKGATVETRKAERQQHAKPILDELHDWMTSQQVISSIPN
FT                   QLEDAGLRT"
XX
SQ   Sequence 89008 BP; 24156 A; 19160 C; 19816 G; 25876 T; 0 other;
     tagctcaata cccgactgag taaacagcga ctcttggcgg taaaggggca ttgcgtattg        60
     atatttacca aggatgatat tggccagcaa gctttctgtc gcgaagcttt tagggatgat       120
     gctctgaggc gctggctttt gaacgatgtg gctgttgtct tcagtttgct cacactgacg       180
     acaagcatac ttaggacgaa catattccag cactttgagc acagctggtg agaactcaag       240
     tttctcactg cggtcttcac cgattttatg cagactatgt tggcagcatg cacactgttt       300
     ttcatggtcg tctaaatcga gttcgataac ctcacgaggc aaagtctttg gaaggggctt       360
     gcgtttacca cgcttcttcg ttgtagtggt cgtcgtgacc acttcaacct cttcttcctt       420
     agcggcttca cattccactt cgttgaagag gtcaccttga gattcatcgt aaggctttag       480
     cgcctcggag cgtttcgcga actgacggtc gaaggccagc ttgagctgtt cgagtaagga       540
     ttgacgctct tgtttccatt gagactcctt ccgctcctga gagagcagaa gggctttcac       600
     catcgcttgt agcttggcaa catcttggct ttctgggtta atatttggcg tctttttcat       660
     ggcatttatt atactaaaaa tcatgccgtt aacgcttggt agataaggct ttattatcga       720
     ttaagtcatt gtaaaatcgt ttatttgaac gggtttatgg ccgataatcg tgaagccaga       780
     aagcagtcta tcaagctcga attgagtcag ggtaaacact tcatttcgct cttttgtagg       840
     ccatttatac ttggcttttt caaggcgttt ataccaaagc gcaaagccag ttttatccca       900
     gtacagcact ttgattttgt cgcgctgttt attggtgaac aggaacagtg cgccgcttcc       960
     tagaggtaaa tcggtgtcac tttcgataat cgccgcgagg ccattgatgg actttctaaa      1020
     atcgacactc tcacgataca gataaatctc tggtgcgctg agcatatgtt tcatgacaag      1080
     gctccaatga gttctgccag gtaggcagcg ggcgtgcctt gaggaatgct caactccaca      1140
     tcattgatga gaagtgtcat gttagcggtg gctatttgag cttgatattt cgttgtcttt      1200
     tcgacgacct ctgctcgtac aaagccttga gagacatctg cttttttgag ttgctggcgc      1260
     ttagcataaa acgtcgaggg attgagttca ttaagcttac aaaatgcaag cgttgacaat      1320
     gaactcgatt cagactgctc gatgagcgtt tgccattctt gattagtgtg tcgttttccc      1380
     atttcaaatc tcctcatggt tggagacttg atcttattct tcgcgctagg cgattagaat      1440
     gcgggtttta tggagcgctt acactcaaac tatattggcc tctgacatca aagagtgcta      1500
     aacagttgct cactctcaat tctagcgcgg ggcgatactt ctctcttctt tctggtgcgt      1560
     tagcgatgac ccctttctat agtatttttg gtacgcccag tgtcactacc agcgcgttcg      1620
     agaagcttgc aactatcagg gagcatgatt gggttacgtt tggtgaagcg atgtcgtcgt      1680
     cgggtaagat tacgcgaaag aaaatatatg aaatcgctga ccaaatgaca tgggttacgg      1740
     ttggtgaaga acagaaattt tggaagtgtg tagcaaatgc atcgttatag ttttctattg      1800
     attatggggt tggccttatc cggctgcgcg tccgatacga ccggaaaagc ggctaatgat      1860
     tggattgccc aaaaagagca gtgcatagag caggaggaac aaagccaagc tttatttcct      1920
     cgcaatgagt ggttcgattc gctcactaaa cagcagaaga ttgatgttgt gctgtatatc      1980
     tataacttga agcatcaggc atgtactgaa aaagaatcat tagagcttga acgctcacta      2040
     aacaaagctg gatataaaga gttagaaaag cattttactg tactaggagc cttcgattgg      2100
     cctgatgaaa gtgcgttgga tggcatcgat atcgaacaag taaacaagct ttctgagcag      2160
     gtagggctct ttaacttagg tactgttggc gagcagttga agtttcgtga gtaggtttag      2220
     ccaagccctc tcactgtttc ccaatctaca aatatgcgtc ccttatagcg aagtgcaggg      2280
     taggggatgc taaagaatac ttgctcatta catttggtgc atcgatgtgg caattggtta      2340
     tgagttgagc gttctccgtc tggatcatat cgatagaaac cttgaccaca tttacagggg      2400
     tattctactc gttctatgcc gtttacttca tggtagtggc gtttttctga agtcttactc      2460
     atcacttttt catttctagt tttctctatt ttgtattctt acagacaaag tctatttaca      2520
     caaaacattg ggcgttctcg ctgggcggca caccgctgtc gctcggttca ttccgtcact      2580
     gcgttcctcc cacgataact agcctcaaaa cgaaatcggt ctttgcacca ggttcgttcc      2640
     tcacttggtg ccatccctct ttctgttcgg cttagttcct gtgaacaatc acccaacgca      2700
     aaagcattcc tatggcagtg ccatagttac aaagcaattt cgattatgtt tgctaagtgg      2760
     ctggtaaatc gcgtcctccc ttctcgccag tcattggttg cctagtgatt ttccctatcg      2820
     ccttgcaact tcctgtaacc atcctcaacc agaacttatc tgcaagggta tataaacgct      2880
     gcgcgcccct gcagagaaga accatgtttg agggttggac agtcaggcaa cgacgaagat      2940
     gaaaatcact ccataaggaa acctagccat gactgactca aacgtaatcc gctcaaccat      3000
     cactaagcaa ccagaaccga ccaagttctc gaatttggag tcgaaggctg cctctaaaga      3060
     tgagttttta aagtctttta caggtcataa gctgcgcaag aatgccaaaa agaaaatcgc      3120
     tcaattactt gcgtacgcgg acaccgtcac gctaaaaacg caatctatgg ggatggatga      3180
     ttgttatcgt agtaatgagc cggtatctat gcctaaagag gagttttggg catggtacga      3240
     gcgtgaatat tcagacatgg tgattatgct gactgttcaa ggtgacgtgc tgacaagcgt      3300
     taaatttagc gactgcattt atcacttttc gaatgatgtg atcatgacat tttctttgga      3360
     agagcgagag gacgagacag aaaatatcga aggtggccaa agctcggttt ctgtcgctta      3420
     ttctgattct ggtttgttca cagcacatga gcaggctatt ttagatgaag cagctgcaat      3480
     ccttgagtca aagttgtgta ttagtgagca accagctctt agctctcctg aggtggtgaa      3540
     gaatttctgt cgctattctt tagctgcgcg tgagcatgaa gtgtttggag ttatttttct      3600
     agataaccag catcgcgtgc gttcttctga agatcttttt actggcaccg ttaacgccgc      3660
     ttcagtgtac cctcgcgaag ttgtcaaaaa ggcactagcc gaaaacgcaa gcgcagttat      3720
     tttttatcac aatcacccat caggtgttgc tgagccgagc caagcagacc gtcgtattac      3780
     gcgccgttta atcgatgcac tagcgcttat cgatgttaaa gtacttgacc acttcgtagt      3840
     ctcttttgaa ggtacagttt cattcgcaga gcgtggttgg atttaataga aaaggcggca      3900
     ttcgccgcct ttttttggtt cttctactcg tcgaagaaca agaattgaat tagctcttta      3960
     actgtccacc caaggcgaat caagtcccaa ggttttagat ttagtgctct cagttttgtg      4020
     agtagttttt tacttagctt gttaaattca agcattggga atccttaact tcgcccagcg      4080
     gcgaagaaat tgacatattt tatgtcaact tttcgggttc tttgttattc tttgggtgct      4140
     tagatcaaag agtttactta gaacctgttc tagttgactc gtgggttaac cctaaacaga      4200
     gatgtttggg gttttctttt atttgcgctt cataaactta cctctcttct tgttttgcct      4260
     atcatacttc aattgttatt ccgaatgcta accagttact cccatgcttg ttaaagtgaa      4320
     cttgttgcta aggttatgtg ttggtgtcat taaactcaat catttgacgt cgatatgatg      4380
     ctaatcgatc tggtgtcatt aatttttgta gactaccaca gtgcattttt actcgtcact      4440
     cgacagtcgt atttaagctg atgaatattg agtaatcagt ttctcaattg ctatcacgcc      4500
     tgtatgttta gcaaccttaa cagggcatgt tggttgcaac aaacatcaag aaagccatgt      4560
     taacacagcc acatttattc ctagagcgat ctcgataggt taaataacaa agggttaggg      4620
     aatgaacaac tttcgtgcac taatcgtcca atgctttatg tgtaatacat atgtattaca      4680
     tttgttttgg tggtgattaa tgttccattt gggcgttctc gcattcgctc ggttcattcc      4740
     gtcgtttcac tcctctcacg ataactagcc tcaaaacgaa atcggtcttt gcaccaggtt      4800
     cgttcctcac ttggtgccat ccctctttct gttcggctta gttcctgtga acaatcaccc      4860
     aacgcaaaag cattcctatg gcagtgccat agtcacaaag cagtttcgat tatgtttgct      4920
     aagtggctgg taaattgcgt cctcccttct cgccagtcat tggtttccta gtgattttcc      4980
     ctatcgcctt gcaacttcct gtaaccatcc tcaaccagaa cttatctgca agggtatata      5040
     aacgctgcgc gcccctgcag agaagaacca tgtttgaggg ttggacagtc aggcaacgac      5100
     gaagatgaaa ttcactccat aaggaaacct agccatgact gactcaaacg taatccgctc      5160
     aaccatcact aagcaaccag aaccgaccaa gttctcgaac ttggagtcga aggctgcctc      5220
     taaagatgag gtttttaagg tggcaatggg aagtgatgtg cgccctagcg agcttgctaa      5280
     tgcggggcta gttatgaaga gttttcgatt ctttccggct gatcttgaag aggtgacgaa      5340
     acgtctaagc gactttgttg tgactgacga atcgaccgct tgtgaaaagg tctttcggtt      5400
     tgagcgtctg ccgtactaac ggcagataga aaaacgcctt agctccactt gcgacagaaa      5460
     agctaaggca ttccgttaac taccgttcac gaggaaatta acatgactac attaaatgaa      5520
     aaaccaactc aaatctatac ttgtacagct gtagagtttg aactcggtca gattgtgatg      5580
     actcaaggcg tgagtcagct gcttggtgac ttgccgcatg aattattgtt gctgccttgt      5640
     ttagctcgcc atacaaacgg tgattggggc gatctgtgta tagaagataa ggttgcgaac      5700
     gacgaagcta cacgtcacgg tttgcgtatt ctgtcggcgt atagatttgg aaatgagcgt      5760
     atttgggtca tcactgaagg tgatcgcagc gtgacaacat tcttgttgcc aagcgaatat      5820
     taatgacggg gcagggcatc ggtaacgatg ccctgataaa gcacagctaa aatttttcag      5880
     cgaggctcat tcttcacctc gctgaaaccg tgcaactatc gacaattatg caatctgatt      5940
     cactatcgtt ggcggtgagt atgtatcgta gttttgtcgg ctgaatggtg tgggactgtt      6000
     gttgcctact acactccctt tcaccacgac acataagcca atgactattt cgccacctct      6060
     ctacaggcgg cttttttttg aggttttttc acatatccac atgaggggac aggagaccgc      6120
     gaggaaatat ctcctgccga ttgtgggtat gtaaaaaagc cggtaggtac actcacagtc      6180
     tgaatgccaa tagatagaac acggcgccta aaagactgcc aacaaacacc gcattgacga      6240
     ataaggcgat gaagaagaag cctttattca ccggaatgta gccgctcagt ttgtccgaaa      6300
     tgcacttatc gatagcgcct aattgctgtt catgcctctt tcccacttct tgtatgagtg      6360
     agttgctaaa cgcttgttga gactgttcga taccagctct tagctgcttg ctatggtgct      6420
     ccacttcact ggtgatatcg aggacgcgat taattttttg ctgaaaggag gcatcaaact      6480
     cgctcggaac gagcttcagt gcctcgccta gtgcaagtaa ttcctctcgc atttcttcca      6540
     gctcaacaag cgtcagttgt ttggttaatg ttgggtatgg aaatccttca ctcatgatca      6600
     cacctcattt ccagtttatt gccacgctaa aaacttggtt aattttttaa attcaatatc      6660
     aagtttttcg tccagtgatt tagccaaacg gtgacaagat ttctttaaag ataaaccgga      6720
     acgagtctgt ttatctttag cttctcgaat ggccttgcgg taatcggtat cgtcattaac      6780
     cgcttcatgg tatgaggtgt ttgttaggtc gatgagcgtg aaaacttctg attcagggat      6840
     aatcacacac ttgcggattt catctgtagc tgtctgctca agagcgccag actcacacaa      6900
     aacgttaaac tggctttcta atggtaaaga agaatcaacg cgattgagta gtacgccaat      6960
     acattcagaa ctaattccca aatcatttag ttcataaata ctattcaccg tgtccttttg      7020
     ttgtttaatg tctggagtta caggcactaa ataaagatct atatcttcgt gtgagccaac      7080
     attttcttta atgcctttga taaagttttc gatattggag gaaccaatat caatgaccgc      7140
     cttatcgagc atatcgatct tttcaataac attggtcatg tctttagcgg ccagtttttc      7200
     tcccgtcgaa ccatcttcat taatcgtttc tacacgaata agttcagcac cttctattct      7260
     tggcatcagt agcgtattgc agatggtact tttgccaaca ttgccggagt gatttaacac      7320
     agcgattttg atgtaatcta tgatgtgacc cataatccta ttccttaatt agttgtttgt      7380
     tttaaagcag taaagtaacg ccttaaagcg ctagagttgg ggagttgttt ttccttaatc      7440
     catgatttaa cttcttcaat ctcatagcct tgtttgacaa tgtcttgaac aagcttctct      7500
     gcaatgtcag gcataatcat tttccattcg acgagatcta tttcttgtgt ttctggaagc      7560
     gatttagccg tagaggtagc gtttggtttt tgcgttggga tttgttcgtt tggcgagcgt      7620
     tttttcttgg ctatatagat cattgtttga aagtgtttca acgctatcgg tatgccgcct      7680
     ttctctaaca gaactctata actaatgccg ttagacgaaa gggtttcaat atcactcagg      7740
     aacatactaa ctatgctctg tttgcttctg agcatttcag aaagctcttt gttaatgtta      7800
     tttgctgtgt catttaacag cttatttgcg tccataagtc cacctttaca agacaagcac      7860
     aagacaattg caaggtaatt agaatacatt cacaagacac ttttcatatc ttgctgaata      7920
     aacacaatac agtctaaaga caaaagcaag acaaacacaa ggcaattaga agaaataaaa      7980
     aacccgtttt gggtttttta tttttccata ggcacgctgt cgaatgtata cattcgcgtg      8040
     ccaaggggat aacatcccct tgaacccctg aaactctacg agtttaatta tggaaaaaga      8100
     aagtgccact attcatattc aaacaagact aacaccctct gaatatgaac cgtttaaaac      8160
     cgttatagaa aactttgata taaaaaaggc tgagcttttt cgcaaagtta ttttatcaaa      8220
     cgagaaaaac atggtggaag tgagccgttc agttgaggaa actgatgctc aaaaacgcat      8280
     gatttttcta gccaataaaa cctcgaataa cattaaccag atcgccaaga agctaaacca      8340
     agcttaccgt ggcgaagtgg tgagtgagcg aaactacctc aagatcatga atgagttgat      8400
     tggtgttcgc tccgcttttg aaaaaggcat ggataaatgt tagttcgagt tcgtggtggt      8460
     aaggatggca ttgcagagta tttgcgcgat gggatgaagt ccgatcgcga aatgcaccgt      8520
     gaccaattag ataaacgtat ttgtattgat ggcgatttat ctattaccga taccattatt      8580
     aaaacaatgg cgaaaacaga taaacctgaa aattattttc atgtcacttt gagctttgct      8640
     gaaagggata tttcagaaga aaagattcgt gaagtatatg aggaatataa gcgaaatatt      8700
     atgtcttctt acacagagga agaatttaat atttacgctg aaattcatgt tccaaaaatt      8760
     aagtcctacg aagataagag tacaggggaa gtagtagagc gctttcctca tgttcatgtt      8820
     gtaataccta agaaaaatct actcgatgat aaaaacctga atccttatgg tttctacaaa      8880
     acaaacttgg aatattttga cgctatccaa gagcgtatta attcaaagtt taacttggta      8940
     tcaccatttg ataatcagcg tgtatttaaa atcgatcagt cgaaactatt agcgcgttac      9000
     aaaggtgaca acttcaaagg tgcgaacgcc aaactcaagt ctgagctgtt tgacgttatc      9060
     caagacaaaa acatcaccac tatggccgct ttcaaagaag agctcgcgaa gcatggtgaa      9120
     gtctcgatag gcaaggtcgg aaagccggat gaatacctca aaattaaacc tcatgactca      9180
     acgcgtaatg ttcgtttaac ggacagttgt tttcgccctg agtttatcga gcatcgaaca      9240
     cttaaacgag aaaagccgag cgaaaagcaa gtgaaccgct tggttaatga gtgggtcaac      9300
     agcaagtcac atgaggttaa gtacattcac caagcagctc ccaaattgcg cgagcaatac      9360
     aaagcgctgc caacccaact aaaaggggag tttttaaatg agcaacgaga gcgatattac      9420
     cgacaataca accttagcac cggagcccga ctttctgaac gaagcaccgg aaccggactt      9480
     tcagaacgag gcgccggagc aagccagcgg aatatttcaa cgagcagacg ggcgcgtgat      9540
     cgaaagcttg gtgttgaacg aggcatccca agaggattta ccgacatccc caacggcttg      9600
     ccaagtatgt ccgaactcaa tgtggctaca gcaggacgaa aacggggaag tcgtcctaca      9660
     gaactattgc atgataatgc atcggatcat ttggcagtca aacaaaccag tcgaagtcct      9720
     caattgcgac gggctggtta tgaacctcga cgaagagtag ttcgactttc ggtttaccga      9780
     aagccttccc cgaacgcgac actggcaact atcaagcgca tcaaagccaa ggcgcaacat      9840
     agcgagagct acgtgacgca attgttcgac tcctttcaag aaaataagca agagcaaagc      9900
     gaactcggtc gctttcgcac tatcaggcaa aatctaaagg ccgagagcct gctttctcac      9960
     ctttccgact ctcatggctt agtcaaagac cagtacagcc actttaaggc caaagatggc     10020
     tctgtgcgga taaaagctga aacgcgagct tataacgtca gtgacttttg cacgaaatac     10080
     atggggctga gttggggtga aaccaaagaa attttaaaga cgacttacgg caagcagagg     10140
     cagcaactcg cgcaacagca acgagttcgc caagagcagc aagccgtcaa ttccatcgtg     10200
     tttgtcagca atagagttac tcagggttgg ggtaaaaaga acccgctcga tgagtccatc     10260
     cgattgctca aacacttgca acgcaaagag cacattggag agctacctat ggcactacat     10320
     gaactagagc gccaccgcgc accagaaaca aaagacaatg ctatcgtttc agctaacgaa     10380
     agctttagcg ccgtcgagaa cgctaagcgc atcatgaaag cgagagatac tgctgcgcag     10440
     atcacgttga ccatgaacga cctagtcgcg agcaagaacg acacaaaacg ttatgtggac     10500
     ttctctgaca agaacacagg agacaaagta tttcgtgatg acggtgaaaa gatcgttatg     10560
     cacagcaaac aagcggacat taaccatacc gcagcggcgc tgacgctggc cgccgaaaag     10620
     tttggggtgg tgaaaatcaa tggtacgaag gagtttaaag atcaagtcat cgatgtggct     10680
     gtgagcaagg acttaaacat tgtgtttgca gacaagaaga tggaagcgga ctttgttcgt     10740
     cggaaggaag agcttaagca atctgtctca ctagaaagtg ttagccagaa tctggcaaca     10800
     aataatcaag cgacaaccac cacgccaaaa tcgacggtta ctgacaccat tgcgatagaa     10860
     atggaagatg gacgccaata tgagttgact cgcactgctg agccagagac agaaaccaga     10920
     agagcaaagg caggggcatg gacgtttgct gatcctcaaa atgcattacc taagtcaatt     10980
     cataaaaata tcccttcggg tgttggtgaa ggcgataaaa tcgaaactga atttgggaaa     11040
     gctaaagtaa caaaagctga tatattgtcg cagcaagaac caaagcttca gcctaccaag     11100
     tttgaagttg aatatcagtg ggataagctc agtggtaagc tgcaagtgac gattaacgga     11160
     gagtcgccaa accgttttga aaaatccacg gtcgagcaaa ttatgaagaa agatgctttt     11220
     ttgaaaaact acaccgttaa ggaggtgaag tttggtttaa tagaccaaaa gaaagcggaa     11280
     ggcgttcaac ctgtgcctaa gacgtatgat gctcaagcta acgttatcga taaaatcagc     11340
     gagcaaaaac aaagtcatcg catgaaatag tggcttggtt taatctggat gcaatctgtc     11400
     actgttcgat tcgaggtcta gtcagatctg acagattgct ctaactcatt tatgccccat     11460
     tatcatttag agtcaaagcc cattcacatc ctgctaatgg ggttttaccc tactagaagt     11520
     tatccattct tctaatgctg tgcgtcgtta acccccgtgt tgtattacgg gggtaaattc     11580
     caccatacct caacggttcg atgaaatcgt gattagactc gaataagcaa tcaaacatct     11640
     atgcaattaa tttatattat tgaaactatg aagtttattt attgagatga gtgccataaa     11700
     acggcacaat gtacggacaa aataaggcta aaagccgtat aacaagcgtt aggtactaaa     11760
     agtacgtaaa tagttacatt gttaaattta gtagtattaa catgagtaaa tgttcagaac     11820
     aattcgatgt cttgtctaat gctttacgca tcctccctga ggaagctgca aggttagact     11880
     acttatgcaa taaggttaac gacccagaag agggtatttc aaacattgaa atagcttctg     11940
     taaacgtgtt gaatcagttt tatggcatga tgcttaatct aaaggaagat ggagttttat     12000
     cctcaattta tgaggatgat gcgatcaata caattttatg tattcgacac gtgcttcaac     12060
     accagtctgg gcgtataaaa aatacgctaa gagatagttt caataatgca ttacccaaaa     12120
     atgtagcttt aattaactat tcggtttctg gtgaaccaat gaccgatttt ccattttact     12180
     taaatttggg ctggatgatc gaccaaattg gaaaatcaaa taatgctaaa aaactagttg     12240
     gcattaaaac caagtggaac cttgataaaa ttgaagctga cttaagcaaa gaaagcctcg     12300
     atgcagattg tatctatatc aatattatgg cgtttattac tgaagcaacg agacaactat     12360
     gtaagttgta cggcgcacat tttcaaccaa acggctatga cagtcgagta tattattctc     12420
     actttagttc aattgacgaa gttgagacta ataactacgt aatcacaaag tttgacggaa     12480
     cacgtaccta acacatatga gccttctgcc tgtcaatagg caataacatc ctgttggctg     12540
     cgtgagcagc caatgctcct cgaacaacaa agttatctac ttcgctttgt catttcggtc     12600
     atcaagcata gaagtggacc ccaatggttg gacacataag ctaacttctt aagtggttga     12660
     tccagctcat gcagcgtatc tctgcctacc aaagtaggct tcatcaggag tgaggtcatt     12720
     gagtccctga tggttacgct cctcattata aaacaccatg tagtggccga tttcaagctc     12780
     tgcttctcgg ggcgtggtgt aagcttttaa gtaaacctcc tcatatttcg tatgcgcccc     12840
     atgaacccac ggggcggtgt tgttaatgtt tgaagttcca aggtaggagc gcatcgatat     12900
     caggctcagc tttcgcgagc tctttcatgc acttgaccat gtagtcgtag aggataaggc     12960
     cgttggcttt cgctgtctcg acgatgctgt aaagcatcgc gctcgcatca gcaccatttg     13020
     gtgtgtttga gaacagccaa ttttttctgc caatgaccag cggtttaatg gcgcgttcag     13080
     cacgattatt atcgatagat aaatgaccgt catcgatata gcggatgagc ttgggccatt     13140
     ggccgagcgt atacttaatc gcttttccta atggactaga gcttattact tgttgagacg     13200
     tcatccagtc gtgcagctca tccagtatcg gcttggcatg ctgttgacgt tctgcttttc     13260
     gcgtttcgac agtcgcacct tttaagcgcg attctatccc atagagcttc tggattttgg     13320
     ccagcgcttt atctgctttg cctgacttac ctttaccttg aagcttctta gcatccatga     13380
     acttacgccg tgcatgcgcc aagcaaccca cattggttac gtgatgaaga ccatcatagg     13440
     caccatagcc atcggtttgc agataaccac tgtaatcccc caagaaggca acagggcata     13500
     ccctcgcgcg actgttttga tagtcgtaca aggcgatatt ctttacattc ggcagtgcag     13560
     cgtcgggcga gtctgcgccc gagcagtaga gccacatata acacttttta tcttctttaa     13620
     ggacattgag cggcgtttca tccgcctgaa ccaccacttg ttgaagtaga tgcgctttta     13680
     aggccgcata cagcggtgtg aacttctcac tgacttggat aacccacctt gccatggtag     13740
     ttcgcgatag ctcaataccc gactgagtaa acagcgactc ttggcggtaa aggggcattg     13800
     cgtattgata tttaccaagg atgatattgg ccagcaagct ttctgtcgcg aagcttttag     13860
     ggatgatgct ctgaggcgct ggcttttgaa cgatgtggct gttgtcttca gtttgctcac     13920
     actgacgaca agcatattta ggacgaacat attccagcac tttgagcact gctggtgaga     13980
     actcaagttt ctcactgcgg tcttcaccga ttttatgcag actatgttgg cagcaggcac     14040
     actgtttttc atggtcgtct aaatcgagtt cgataacctc acgaggcaaa gtctttggaa     14100
     gtggcttgcg tttaccacgc ttcttcgttg tagtggtcgt cgtgaccact tcaacctctt     14160
     cttccttagc ggcttcacat tccacttcgt tgaagaggtc accttgagat tcatcgtaag     14220
     gctttagcgc ctcggagcgt ttcgcgaact gacggtcgaa ggccagcttg agctgttcga     14280
     gtaaggattg acgctcttgt ttccattgag actccttccg ctcctgagag agcagaaggg     14340
     ctttcaccat cgcttgtagc ttggcaacat cttggctttc tgggttaata tttggcgtct     14400
     ttttcatggc atttattata ctaaaaatca tgccgttaac gcttggtaga taaggcttta     14460
     ttatcgatta agtcattgta aaatcgttta tttgaacggg tttatggccg ataatcgtga     14520
     agccagaaag cagtctatca agctcgaatt gagtcagggt aaacacttca ttttgctctt     14580
     ttgcaggcca tttatacttg gctttttcaa ggcgtttata ccaaagcgca aagccagttt     14640
     tatcccagta cagcactttg attttgtcgc gctgtttatt ggtgaacaag aacagtgcgc     14700
     cgcttcctag aggtaaatcg gtgtcacttt cgataatcgc cgcgaggcca ttgatggact     14760
     ttctaaaatc gacactctca cgatacagat aaatctctgg tgcgctgagc atatgtttca     14820
     tgacaaggct ccaatgagtt ctgccaggta ggcagcgggc gtgccttgag gaatgctcaa     14880
     ctccacatca ttgatgagaa gtgtcatgtt agcggtggct atttgagctt gatatttcgt     14940
     tgtcttttcg acgacctctg ctcgtacaaa gccttgagag acatctgctt ttttgagttg     15000
     ctggcgctta gcataaaacg tcgagggatt gagttcatta agcttacaaa atgcaagcgt     15060
     tgacaatgaa ctcgattcag actgctcgat gagcgtttgc cattcttgat tagtgtgtcg     15120
     ttttcccatt tcaaatctcc tcatggttgg agacttgatc ttattcttcg cgctaggcga     15180
     ttagaatgcg ggttttatgg agcgcttacc atatttcagg cttctccata atcgctctat     15240
     gaaaacattg tcgacccagc gtcctttccc atccatactt atcctgactc catggtcgag     15300
     tagcttctgt gtgaattcgg tgctggtaaa ctgactgcct tgatctgagt tgaagatatc     15360
     tggcgggcca taatgtttaa gcgcgtcttc aagggcttcg atacaaaagc tcgtgtccat     15420
     ggtgttggat agccgccaag acagcacctt tcggctatac cagtcgataa tggcgactaa     15480
     atacaggaac cccttagcca tcgggatata cgtgatgtca atcgcccaag cttggttcgg     15540
     gtaagtgact tcgatatcac gcaaaaggta gggataaacc ttgtgtgctt tgttcgctag     15600
     ggtcgttcta ggcttggggt aaatagcccc aatgcccatg tctcgcatga gccgaacgac     15660
     acgtttacga ttaacgttat ggcctttttt agccatctca tttcgaatgc gtctgctccc     15720
     catgaacgga taccgaaggt gaatttcgtc aatcatgcgc cgtagtacaa tctcttcagc     15780
     agagagtcct atgggttgat agtaagcagt agagcgagca atactgagaa gctcacactg     15840
     gcgttttatt ggcaattggg tagatttaac cagcgatctc tttcgctggg ctcggtctaa     15900
     cgaccgagca ctttggccaa aaaatcattt tccatggtca attgaccaat cttggcgtgc     15960
     agtttgtcca cttcttcaga gttgtccttg cctgactggc tttcagaggc aaaaatcatg     16020
     gctgcatttt cgagcagctc ttttttccat gtagaaattt ggttagcgtg aagattgtat     16080
     ttctgagcta actcagcgac agttttatca cctctagcag catcaagcgc caccttagct     16140
     ttaaattcgg gtgagtggtt tctacgtttt ctagtcataa tctgttccag tatttttagg     16200
     tactatacaa acagatcaat cacttaaagt catgtccgaa aattgggggc catttctttt     16260
     tttgttcaca gctcaacgcc aaggcgacaa tcgcggccta ttttgaaaaa acaggcgtta     16320
     gctcgatcaa aaaaggccca aaaaagggcc tttgctttta ttacattaca ttacattact     16380
     cgatagtaat cgctctaaca gccgcatact tatttgccga atttttaatc aagtgattct     16440
     cttatcatga catagtgtgg cttctcagaa gccgtatagc gctttatgtc actgcatttt     16500
     ttaagattgt aatattgcat catcagtggc ttttgagttg tcacagcagt caaagccatt     16560
     gaaacccacg atttgcacgt atcaggcgtg ataccatttt tagttttact gacgctacac     16620
     aaaccgacaa acgatgccca cgaggtatta ataattagtg agccatcact ttgtatccaa     16680
     gcatcagtga cagtgccttt acagtgtatg gaatccgcac aaaaagcagg tactgaaaaa     16740
     aaccacagca gtaaaaacca ttttgttttc atattgaacc tttctattta gggaaggcaa     16800
     aaataccttc gatggagcaa tgccaccaac ctttatgatt ggtttcttga taacgaatat     16860
     tccctttaaa atttttggta gccatcattg tcagtaggag tgaataaagc tccttgtaat     16920
     tagggttaga tttactgagt cgtccgccct tattaccgct acagttaggc atagcgccct     16980
     gttgaaactc aatataaagg ccatcaccag cgtcatgata aaatgaaact gggtataatt     17040
     tttcaatcgg tggccctgtt ttaatttcag cttgagaaga aaaagagcca agtattgcgg     17100
     ccacaagtaa acattttttc attattaatc ccctattaac ctattggatc aacttggttg     17160
     attacgcaaa atgaagagcc attttgcatg tccgatgtat aaacggttac ccgtcgtttg     17220
     tctgcaatcc aaagggccag tgtggttgac gtcattgcac tgtaagaagt ggaccccaat     17280
     ggttggacac ataagctaac ttcttaagtg gttgatccag ctcatgcagc gtatctctgc     17340
     ctaccaaagt aggcttcatc aggagtgagg tcattgagtc cctgatggtt acgctcctca     17400
     ttataaaaca ccatgtagtg gccgatttca agctctgctt ctcggggcgt ggtgtaagct     17460
     tttaagtaaa cctcctcata tttcaggctt ctccataatc gctctatgaa aacattgtcg     17520
     acccagcgtc ctttcccatc catacttatc ctgactccat ggtcgagtag cttctgtgtg     17580
     aattcggtgc tggtaaactg actgccttga tctgagttga agatatctgg cgggccataa     17640
     tgtttaagcg cgtcttcaag ggcttcgata caaaagctcg tgtccatggt gttggatagc     17700
     cgccaagaca gcacctttcg gctataccag tcgataatgg cgactaaata caggaccccc     17760
     ttagccatcg ggatataagt gatgtcaatc gcccaagctt ggttcgggta agtgacttcg     17820
     atatcacgca aaaggtaggg ataaaccttg tgtgctttgt tcgctagggt cgttctaggc     17880
     ttggggtaaa tagccccaat gcccatgtct cgcatgagcc gaacgacacg tttacgatta     17940
     acgttatggc cttttttagc catctcattt cgaatgcgtc tgctccccat gaacggatac     18000
     cgaaggtgaa tttcgtcaat catgcgccgt agtacaatct cttcagcaga gagtcctatg     18060
     ggttgatagt aagcagtaga gcgagcaata ctgagaagct cacactggcg ttttattggc     18120
     aattgggtag atttaaccag cgatctcttt cgctgggctc ggtctaacga ccgagcactt     18180
     tggccaaaaa atcattttcc atggtcaatt gactaatctt ggcgtgcagt ttgtccactt     18240
     cttcagagtt gtccttgcct gactggcttt cagaggcaaa aatcatggct gcattttcga     18300
     gcagctcttt tttccatgta gaaatttggt tagcgtgaag attgtatttc tgagctaact     18360
     cagcgacagt tttatcacct ctagcagcat caagcgccac cttagcttta aattcgggtg     18420
     agtggtttct acgttttcta gtcataatct gttccagtat ttttaggtac tatacaaaca     18480
     gatcaatcac ttaaagtcat gtccgaaaat tgggggccat ttcttcggaa agagattgga     18540
     caatgctctt tcgtggtcat tgtactctcc gcaccattgt gggcatctaa gttgacattt     18600
     tacgtgatat acggaacagg gtaagcctgt atatctcccc atgggaaagc agtctgtgaa     18660
     gattgccgat aggtatgcag gtaaaggagg ttagagaaag caaatgccgc tttgtaacga     18720
     agcggataca ggtttgtatc tggcgcgaaa gcgagctgac ttctaactgg tctcccgttg     18780
     cgaaagagtt tgaagaactt tattaaagaa gaaaagcaaa tgatgatttc aaatgaaatt     18840
     agtgcatctt cttacaacga accgtggtct atcaactact gagtgaccat tggtgaagta     18900
     ttaaagcttc aagtgcgtat cgcaaaggta attaaaacga agggttagtt ccgtgaccaa     18960
     ttggtggtat cgctcgaatc ctataacgat ttaatcactg ggtacttaac ggtgcttttg     19020
     tggaggcttg agccgtatgc agtgaaagtt gcacgtacgg ttctgaggag ggaggcacct     19080
     ggcaacaggt gccgcctatc cgacaaagac gtgctgacgc cgatctcggc aaacacgtat     19140
     ttgccccatt ccttctcagc gcgaaaattc actcacaatc tgtgatagta cgtttgcctt     19200
     acctgtagtt atccgaaaga gtctcgaatt aagcttttta aaaattatgc gccattttgc     19260
     aatctaatac ttaacacttc tcattaacct attgattata aattgaactg cgactggaaa     19320
     ggctgcacaa taggaatatg aaaggcggct aaaagccata taaaaagcgt tagcagtaca     19380
     ggagtaacat ggctaagcaa atatgggaaa tgactcccca agatatacaa gatcatgctg     19440
     tatggcagtt tccctcatgg aaagatgata gtcatgatga gactgtcatt tgtcaagcta     19500
     gccaagatga tgcactagat cccaactcta atatcattgt cagggcgaaa ttcttcgatg     19560
     cgaatggtaa tgagtttatt ggttttattc attacggatt agctgaagtc gaatattctc     19620
     aacccaatat gttcgtaaat ggcaaaaccg taggcttttg gtttggcatt acgaagccca     19680
     atcataacga cttgataaga ctaaacttcc ctatagtgat aacgtcagag tcagtttttg     19740
     gtttagagca gattacagtc actgtcgaag gttatagtta tgtcaatgaa gcatcggcta     19800
     cttgcgtaat gtcctgctaa caaattgttt aagagtgatt cggcacgcgt ggcattttta     19860
     ccatgcttca ggtttagtgg ttaaggtggg atgcggaagc ttcggtattg cgtgcctcac     19920
     accttaacaa ggcgttgata gtgatgatca tctcttgcag aacgatctgt tggctatagt     19980
     gagggagaat gaggtctgtc agccaccgta gatgcttttt agaccagttg tcattcactg     20040
     ttgcttgaac attattgcga agtagaaagc ctttgagttg gaacttagcg tccttgagat     20100
     ctttcatagc agtttctcgg gctcttgaga gatctcgtat ggcttcatct tcggcttctg     20160
     gaacatagat aggggtgagc tcttcagcct tgaagagttt ggcaagctta gcggcatctc     20220
     gtttgtcggt cttcacacgg tcaccaggct ttttagggat aagtgaagga gcgacgacat     20280
     agcagcagtg cccaatgctt gtgagcaggc ggtaagtcca gtatccacat ggtccagcct     20340
     catagacaaa atgaagggta gctttaggat atttggactg aagttgcaga gccaatttaa     20400
     ccaaagctga cttgtttgac ttaatgcggc caagatgttg cggttgagca ccacgatgac     20460
     cttgcagaac tgcgacttgg ataaaggact tatgcgtatc taagccaatg aaaattatgc     20520
     tatcgttgtt catgctagcc tccaaattta gttgtttgaa cacactaatt atggctctgg     20580
     ctttacgcta acccacgaaa ttggaggcta gcacctcgtg ggggtcatta tgtctatgtg     20640
     tcaacgtgga aaaatcaccg attaggatga ttaatatcta aggagagata ttgtggagtg     20700
     gtcagtctta atagtatttg ttgtgttgtt gatattcatc ggtcacagag aaatatctgc     20760
     gatgaaatac aagcataaac tgttggagcg taagatagac ttcttacttg aacgttcggg     20820
     tttgtcttta gataaacact tcggtgtacc agcccaggtg ttagatgctg tcaaatcagg     20880
     taacaagcta aaagcgctgc gactttatcg agaggaaact ggcgcttctt tagttgatgc     20940
     tcaaaaagtc atcgaagaac tctggtcaga cacataacac atatgagcct tctgcctgtc     21000
     aataggcaat aacatcctgt tggctgcgtg agcagccaat gctcctcgaa caacaaagtt     21060
     atctacttcg ctttgtcatt tcggtcatca agcattgctt acgacaaaca catattgagg     21120
     atctcttatt gcggtctcgc cgctgcctat gacttgtcat agggtcacta gacacttatc     21180
     ggttaacccc agcaggcact attcaaaaaa atggttaaac tgttgttttc cagttatctt     21240
     caggctcagc caaggtgtaa gcaactttgc tgttcgttgt tatgggtgcg caccaatgaa     21300
     gcggctaatc aaagcaagcg ggcttggact acctgacaca accgactttt tcgggcttaa     21360
     atcccagtaa atttgagtca gtgacgtgtt ctcactcagc accagttaga cgttcagctc     21420
     acttcattgt gcgacttatt ggggtaaaaa tcgtttctca tcaaatactg ttttgttcct     21480
     taacatgaag tagacacatc gccccagttt atgagccaac gctgatagcg ctttggcttt     21540
     gctcatgcgt ttttgcaggc gttggatgta tttcttggcg ggttcattgc cgcgtaaata     21600
     gagaactgcc gcttccgaga atgcccattt taagtaggcg ttcccaatct tgttgccgtt     21660
     ggttcctttt tgtttgcccg ctgattcagc tttgcatttg actaaccgtg agtaagaggc     21720
     aaagttttgc accgacggga agcgttcaat attgccgatt tcatacaaga tagtgagggc     21780
     gagaatgcga ccaataccag gtacagtctg gatgagagaa taatcttgag cgttgtgctg     21840
     cttggctgtt ttttcaataa agtgttctac gctcgctaat tccttggtgt aaaaggcgat     21900
     gacatttaaa tccatatcga tacttcgatt gattgagggc tcatcgaact gattgcgtac     21960
     ttgttcacgg gcacatgggt agcgcagttg aacgttgtgg ctttgctgat tgtattggct     22020
     aaaggtgttg gctacgtggg ctttgaggtc agccccatga cgcatgattt tggttcttcg     22080
     tcgtagcaaa tctcgtgttg ctcgcatggc tctagggtaa acataggcga tagggaaatt     22140
     accgccacga agcagtgacg caattttgaa agaatcgata cgatcgtttt tcgttttacc     22200
     accgtgaatc gctttcatat acagcgcatg accgagtaca aagtcaaacg cataatcaag     22260
     gcataagtcg ctaacccagt accagcaatg catacattcg acaccgatga cgatgttatc     22320
     ttgacaaggt gtaattaact caagtagcgc atcgggatcg gcatcaatct tcttgtgcag     22380
     gactttattg ccaagtgaat cgagaataca gacgtaaagt aagcgcgcat gcagatcaat     22440
     gccacagtaa tagttatgct ggttgttata gaatctcata gagtcttctc cgttttggtt     22500
     tcgtcgcctt ccagcttagt cgagaggcta agttggagga gaaggctcaa tgagtatcaa     22560
     tctgttcaag agggattctc aacgcgtggc attttcacta tgcgttgatt ttagtgatta     22620
     aggtggtgtg cggtggcttc ggtattgcgt tgctcaccta tatggtctcc ccctgttttg     22680
     caagtcagta gcatgattaa aagcgcaggt taactaccat atatacggcc tgttttagcg     22740
     gctattgcct tggccaagat gaggcagtcg aacacgaagt cctaatcacc ttatcgactt     22800
     taaaagccag cgtgagcaca aggttttcaa cgtgtaggat ttatcctgtt attcatctca     22860
     ctacgtactt tgcaaagggt tggtgattct attgtttatg ctggttggta ctcttcgttt     22920
     ttggcgataa cagcccaagc gatccgcatt aatttattcg cgagcgctac tgctgcacgg     22980
     ttggaacctc gtcgttcttg aagttctagc atccacttac ttagcttatc ggacttgaac     23040
     ttggctcgtc ttaatgctgc tctcgcacca tgaaccagta aagaccgaat ataagtattg     23100
     ccccgcttgg taataccgag aagaatgaca ttgccccccg ttgtgtcttg ctttggaacg     23160
     agccccatcg cagcagaagc gtcgcgccca gttttaaatt gcagcccaga gccgagccat     23220
     acggcgacag cttggctagt gagtggtcca aagccgggaa tagacatcag tcttttggca     23280
     ttatcaaatt gtttaacggt ttggctgagt ttctcttcaa accataggat ttgttcatcg     23340
     atatataaat agcgttcata ttgacgtgat agaagttcac gcaatattgg cgagagttgg     23400
     ttttccacct cttccaatat ttcgggaatg gcttgtctaa aggctgcttt cccttttggg     23460
     ataacaatac cgtattcagc aacgagccct cgaacctggt taatcaaacg ggttctttcg     23520
     gtaacacata gtctgcgcat tcgaatcaac gattgaatgt cttgttgctc gatggatttg     23580
     tgttggacag ggtaaacccg ttgatagagt gcgagttcag caatcgcttc agcatcgtta     23640
     tagtcgttct tttgtttacg gcgctgattt ttgacatgct gaggagggta tagcagaaca     23700
     tcatgcccaa atttttcgaa ttcacgagcc cagtaatgag caccggaaca ggcctccatc     23760
     gcaattatgc atggactttg atttgcgacg tagttaagta atctgcttcg ttggagtttt     23820
     ttacggctga ggttcttccc tttgtgattg atttcaacaa ggaagaaaat attttttgct     23880
     aaatcgatgc cgatgatttt atgctgagtc atggtcttct ccttttactt ttggacctga     23940
     acactccaag catggctgat agtcatgtga agtggtaggg ggagaccatc tcatcacctt     24000
     aacagggcgc tggcggatcc cctcataatt cacctaaccc gcaagtatgg gtgaggcgtt     24060
     gatattccac catcgcccaa tgatattgcg attcttttat tcggtatcgc cgatggctgc     24120
     gtacttcctt tcccagtcta gggatcgaga gcacacgccg atgcttgatg gtgttagctt     24180
     ggaagtcata atgccatttg gcttgcatgg cgattaagcc attccaccac atgatgattt     24240
     cggccatcaa tgccatgagt agcaagatat caatgcgctt agtgcaacgt gtccgattgt     24300
     ggcgtagcgc taatccgtaa gcggggcttt tcaaatctcg gaacgactct tcaatttgca     24360
     ttcttttggc gtacaaacga gtgattttga cgccgttaag tacatgattg gggatgttgg     24420
     tgaccagaag ccaaggctct tttgctcctt tatggaacac tttcccagcc gagtgtttct     24480
     ggcaggttcg actatgtcga tgcgcttttc tgcctttggg ctggccttta tacaaatacg     24540
     caaaacacct gagcggcgaa cgcctagcaa gttggctttc tcctaaaaac agtggtttat     24600
     ctgttgcttg aggataaaac gttttgttcc atagccacgc gccctcgccg cacttaatcg     24660
     agacttcgcc acgtacacgc ccaagccaga accaaccttt gttggccact tgccggaacc     24720
     acgtatttct aaagcccgca tcagagacaa tgatgggcgt gcagccttgg gggagcaggg     24780
     attgaagctt atcgagaaag agttgatgac ttttgggtga gttgtagttt ttgtactcga     24840
     atgcctgctc ataaagcgtg acggcgcgac ctttaacaga taccgaagca cgtaatgtca     24900
     tgtagcgtaa ttgctctcga acatccgacc aatcgaccag caccaccgga aatggattgg     24960
     cgcgggtaat aaaagacgca tgccatctat atatggattc tttttcacga tgtagattgc     25020
     gattaccaag tagtcggtcg atacgtttga tggcatgttt cactgtggta tcagtgtcga     25080
     gagctcttcc aattttagtg agtgttagag cagagccatc aagaaccgct ttggttgcaa     25140
     gcatcagaga tctaagtcgt tttttgtgaa tgtcagggca ttgattctca atagcttgct     25200
     gtagaatttg aatatcgcgc atcgttaggg ttccctatta aatccattta atcaggtgtg     25260
     tttttggcga aattcattag atcagaatga gcgatgcgcg tctactcatt gttttatatg     25320
     gaaattatga ggggattcgt aagaacaggg cgttaggcga catgagcgaa acgatagagt     25380
     agtgatagta tcttggcgtg aatctagctt cagttaacag aaaaggagtg ggttaatgaa     25440
     tggcaaagca tttgataact ggcaaaaatc gcgaaagaaa ggatgtttaa attggttgtt     25500
     caaaacaact ttcgtcacag ccattttgta cataattttt aatgttattt tccattatcc     25560
     aacttctgat gcggcaagca ttacgatttt cttatcggat aatgctctta attactcaat     25620
     ttacacgatc gggatgtttt tcgcattttg ggctatctgc tatacaacga atcttcgtat     25680
     gagaaagaag ttaaacgtag aaatgtcgcc taacaagtgt ttaaggtttc aagatacttt     25740
     atctaatctc agataagcac gttagagtca ttaatctaac gcgtttatgt ccaaaacctt     25800
     cacaggttga gtttttaccc gtggcatttt ctagctcgaa aatgcctcat aatgagctag     25860
     caatagttga gcacaaaacc ctatacattg ccttttgagt tactttttgt catggtattg     25920
     gtgattcttt cctcttaagc atttatagct ttttaccaat ccaaatcatg cacttaacct     25980
     cacccttaca ggagtcaatg caatgtatca ttataccgac ttaaatggtt ttctatctat     26040
     aatacaaaat aattcgcttt ggcttacgga cgcgagagct atgaatgatt cactagaaat     26100
     aagttggttt ggaaagttgt tcgctaaaga gttagaacgc tctattgaag gtttacatct     26160
     atctctatct caaaaagaga ttttagacga tttcatcaac tcttctttaa attcaaacct     26220
     aaccccccac atatgttgtt tctccaaaga gggagactta cttagtcaat ggcgtgccta     26280
     tgctgatgac ggctttggag tctcgatatt cttcgatgag tcagcattca ataaagtctc     26340
     cctgagtcag ttgccagaga ggttggtcga ttctactttc tattcagata taatttatag     26400
     ccaagaagaa caggaagttg cgtccaaaaa tttggtagat agaactgtaa atgcaattaa     26460
     caaaatatca ggcaatacca ggaatgatgc atataaaact ctacccataa gagagttttg     26520
     ggatatcaag gctaacattg agcttcagtc ctactttagt aaaaaccccg cattttcaga     26580
     agaaaaagag ctaaggttca taaaactagt agaattggat aaattaaaat acaaagaaaa     26640
     attaagattc cgtgtaacag ggggcactat tgcatcatac tttgagcttg aattttcaaa     26700
     accttcgatt aagagggtca ttctaggccc aaaatgcaaa gcagatggca atactatacg     26760
     attgtttttg gatgctaatg gctttgaaca tgtcgaagtt ttgaagtcaa aagctagtta     26820
     ccgatagctt tcatatgaag tatggcaagg cttaaaagag gtagacacct ttcaagccat     26880
     taaaattctg acctgcggtg tatgcgttgt cgatacgaaa tataatccgt aattccctaa     26940
     tttagaaaaa ccaataacac gtttatgtcc aaactcgtgt caagccaacc agttctagca     27000
     cgagcttgcc cctttcctgc ttagagtgat aactcattca taacctacta gtgctgcttt     27060
     tgccttatct cagctaatgc aagaacagta caccaacatt tagtaaaaaa tcccgctcat     27120
     ccactcaatg ccgaaccatt catttacata actaactgat tcaaagcgga ttggtcaact     27180
     gacttgttaa atcctcccca gcttagtgaa caacctgagt cttttgagta caacaatgtc     27240
     cggcttcctg ccattcacaa ggattcattt aaaattatgc agcgaagatt tttattgaaa     27300
     gatgcaagtc cgagttatcg catggagcag caacaccact ttagagtcat taagtcagct     27360
     gactatgaag agcaactggc tcaaatggac ttagctatat aaattagaaa atgcaaaaag     27420
     cataggtgtc caaatctgtg tttgactttc ttttacatct atcaatgcat aaagcaaatc     27480
     tgactcaagt tagataggct gagagatatc tagtcatgcc ctttcccaac gcgacaaaaa     27540
     taagggaacc tcttatagat tcaagcaaca ttctttatca aaaaccatga tcgcatctcg     27600
     taagcacttc tgattcactg agcagtaaat ttctcgaccc tttttgtgct gcttcagtgc     27660
     ccctgtctga cttagtacaa tcaaatgatg cgatagtgtt gatgatggga tacccagagc     27720
     atctttaatt ttccctactc ttatgctgtc ttcattctga ttgatgaggt aatggatgat     27780
     gagaagtctt gtttcattac ctagtgcgtt aaagaccatt gaaatgttgg ttagtttact     27840
     tttcaacata gaggcttcct ttaagcatat cccaaatcat gccactcaaa gcagcccacg     27900
     caacactgat tagcgcaata gaaatagtga caacaatttg atgttcttga gcgaaggatg     27960
     agttttgagt gacctttgtt aacacaaaag ccactgctaa tatctgtact aaagcgaatg     28020
     gacgtttaat cattttggca ttctcatttc gagtttgatg gaactattat agcgaagaag     28080
     aaagatattt cgagtttttt cgaaatattt attgacgatg aaagacctat gcgtataatt     28140
     cgaagaatat cgaaatgaga ggtgagtcac atgagcccag aaattattac aatggccaaa     28200
     gaagcaggac atatgtttct gttcttggct actgaactag tcatcctatt tttagctgta     28260
     agttacctag taggtattct tcaagagttt ttaaccccag agaaaatcca atcaatcctg     28320
     agctctagaa aaggtaaagg ctacattgtg gcagcgttcc ttggtgctat cacaccattt     28380
     tgctcttgct caactattcc tttcttgaaa ggcctattga gagctagagc aggtttcggt     28440
     ccaatgatgg tgttcttgtt tgcatcacca ctgcttaatc cagtcatcat tggtttgttt     28500
     attgcaacat tcggcttgaa cgtcgctgtg ttctactttg tagtagcaat ggtagttgcc     28560
     gtttcagctg gttttatctt agagaagtta ggttttgaaa aatatgtacg tccagaagcg     28620
     tatgagtcaa cagattcagg ctcaagttgt ggtacttctt gtggtgactc taaaccagca     28680
     cctaaaaaag aatctagctg tggtacttct tgtggtgact ctgtaccaga agtgcaaatt     28740
     tcttgctgct catcaatcgg tgaagctgcg gctacaattg ttccatccgc agagccaagc     28800
     cgttgggttc gtatttggat aaatacatgg aaagacttca aacaagttct tccatacttg     28860
     ctaatgggta ttgctctcgg ttcattgatc tatggcttta tcccaacaga tttaatcgct     28920
     gagtatgcag gtgctggtaa ctggtatgca atccctgtag cggctgttat cggtatccca     28980
     ctatacattc gtgcagaggc cgttatccca ctaagtgctg ctctagttca gaaggggatg     29040
     gcacttggtt ctgtaatggc attgatcatc ggcagtgcgg gcgcaagtct aaccgaggta     29100
     atcttgttga aatcaatctt caagaaccaa atgattgcag cgttcctgtt cgtcatccta     29160
     agtatggcag tgggtgcagg ttacttgtac acattcttgt ttgcttaata tcacgaataa     29220
     ccagaataca tgagagccgc aatcgcggct ctcatgctaa tacagcattg ttaacgctaa     29280
     gactcatttg gtggttacac tgatgcaaag agtttcagta tagatacttc agatattaaa     29340
     ttagttaagt aaggtataaa ttattaaatt cagaacatta gccgtagtta tccgagacct     29400
     cgtgataacc aaaagttcgt aacaagcttt tgtccataaa acgagtttta taaccagcaa     29460
     tttgtctttg ctgtctcggt atggcttaca agttaatgtg taagaatcga atatcagtca     29520
     gcactaatga cttatgctgc ggctgtaatc gcggggttca caaaatggac gttctgcagc     29580
     tgaactggta attattttct gctgcaccgt ctggttaatt gaactgaaaa tcagaacaaa     29640
     ataaaaagcc ccgtcaccaa taggtaacgg ggctttcttt tagctgcttt tagcgctttc     29700
     atagttagga cgacctttgc gatcaaagag cgtggtgatg cagtctggat agccagagca     29760
     cgcccaaaag tatttgcctt ttccttttgg tgatttgcgg cgtattagac ctttgctgca     29820
     agttgggcat ttatgagcgc tgacaacagg cttaactctt ggcctaaagt caggtttgcc     29880
     ttgtaggtca gggtaagcct tatcgcattc tggataacca gaacacgacc aaaaccaacc     29940
     atttcgccct ttgcgtctgt acaagggttt gccgcaacta gggcaaggga cggtgtttga     30000
     agtgatgtta ataccgttct tgtctaagtc atcgatgcgc tctgtaatgt agctgtccac     30060
     atcggcaatg aagtcctcaa ccgacatttc acccgcctta acgaaggctt gcttctctgc     30120
     ccagatcgca gagatatcgg gtttgatgat ttcgttagga agggcggcac aaagctcttg     30180
     gccttgcttg gtggttctcc aaaccttctc cttgtaacct ttttcttcgc taatcgagat     30240
     gagttcagtg tttgcagcaa gctggctcaa gatgctggcg cgggttgcct ccgttccgat     30300
     actgccttgg tcattgctgt ctttgtcctt agcttctagc ttggcgcgaa gctctggatc     30360
     atcaatgaaa ctggcggcgc gggtcattgc ggccaacagt gttgattccg taaacaattt     30420
     cggtggcttg gtttcctttt gttcaacctc actttcgaca caggtggtcg ctgtgtttga     30480
     tttcagcgtg gctaagtcaa acccatcatg gtcgctttgg gtttccttct cttcgctgtg     30540
     cagcacttcc catccctgct caacgagtac gctttgcgtt gcgctgaact ggtagccttc     30600
     gacttcaaac atggctttgg ttttatctcg aatggactct ggataaaaca aaccgatgaa     30660
     gtaacgagaa accaactcat aaacctgtcg ctcttctttg tttaggctgg cttggcttcc     30720
     atgtttggtt gttggaatga tggcgtggtg cgcctcgatt ttatcggtgt tgaatgcctt     30780
     gtgcttgcgc gtcatatcaa cattggtatt ggtaatcgag tcggtcaggc tagggcaggt     30840
     tgcgccgata gcgacgagga tatcactgct ttgatagtag tgttcgtcgg aaataaagcg     30900
     attgtccgtt cgagggtagg ttaagagctt gtgcgtctca tacaagcttt gggcaatgtc     30960
     cagtgttttt ttagcactgt aaccgtaact ttttgcgcaa agttgttgca gcgcagaaag     31020
     gtttaatggc tgtggtgcgt gcttcttttc gggcttagtg acgaccaatg tcaccagtcc     31080
     tggtctattg gtcacagagt cttgaatgaa gctcgcgtta gatgctgaaa ttaaacgctt     31140
     tttatcatca acctgatcgc tctctttggt gttgtacttc gcttttatgc gattttcgcc     31200
     acactcaaac tgcgcataaa catcgtaata gaagctcttt tgatggtttt ggtttgccag     31260
     cgttcgctcg ttcaccaaac ccatgaccgc gcttttaacg cggcctacat tgagcacgcc     31320
     ctgaaagcct ttctcacgac cttttaaggt acaaccccgc gttaggttat acccaaagct     31380
     cttatcgcta atagaacgcg ctagagcgct cataccaagg ggaacgtact tctcgtttga     31440
     ctccatgttt gccagtgctt tttgaaccgg agcaaggttc aagtcagcga ccaataggcg     31500
     ctgaacgggc ttggtgtttc ctgcgtagtt aagcacctca tcaaccaaca attgcccttc     31560
     gtcgtcaggg tcgccagcgt gaacaatggt gtcggctttc ttgatgaagt taagcacggt     31620
     ttgaagttgg cttttggtgt ctggaatggg tttgagggtc ggcgggtaga ctgtcgagat     31680
     aggtaggtca tcaaacgtcc acttcgcata cttctcatcg tagtcgtcag gatcataagt     31740
     ttctaaaagg tgtccaacac agtacgtcac gacatgctct ttgtgttgat aaaacccctc     31800
     tcctcgctgc gtttgcgggt taccacctaa cccttcgaag atggctttgg caagggaggg     31860
     tttctccgcg atataaacga tcatagtgcc tcctagtgtt cggttgagcc ttcgatgtac     31920
     gtgttccctg cattatcgaa gtaataggtt tccccgtact gctcgccatc ttggaacgtt     31980
     tcaacgtagc tgatggtatg tgagcaatat tttggacttg aagtcccttc tttgtggttc     32040
     acatggcagc tctggttttt aatgatttgg ctcggtcgaa cctctgtttt actgcatcgg     32100
     ctccagtctt tgcctgtttc ccacttcacg cattcaacgc gtggtgggat gtaggcggca     32160
     cggccatcgc gagcaaacat gtcggtatca ttcgacggtg tgccaatagg gacgtcgccg     32220
     gaaaacaaac aggacgtaaa gcttggaagg ggcggtttga acttcttaat acgctttacg     32280
     aacgctttct tagcgccact gcaaccactt ggaaagcctg tcggaagaca aagccaaata     32340
     gcacattcat cgtcgcttgc cgcgaaagcg ggttgaacag gcaataaaaa agccgctgtg     32400
     atagcggcca taaacagttt gtgtttcatg ggatgttcct caatggagtt taaggcgtgg     32460
     gatttcaggg atattcgcct cggagtattt cactcgctca gcgaacacgg gctcttcaaa     32520
     gtagatgatt ttctctgcaa tgaacgggcg ttggttctct ttcaatatca aggttttgat     32580
     accgagctct ttggctatcg ggtgtttctc aaagccaagc tcaacgattt catgcggcat     32640
     catcagcggg cgtttcagct catcttcact ggttgttcgg cttgaacctt tgcccgtact     32700
     gcgactgact ttgcgttttt tcaccgtttt ggtacccaag gtgtcagaaa ggcggcgaac     32760
     gttgtcgtcc acttctttcg gtgggtacac caccttaacg ccgtggttct tgcgaatgtt     32820
     ttttgcgttc tctcggccat acacttcttc gagttggcct tcgtcttggt agatggttaa     32880
     aaatcgcagg ttgtaaccag cggtgtagct gattgctttt tcgatttgct ttactcggcc     32940
     aagggcggtg aactcatcga gcaaacccaa acactgatat ttcagggtgt cgtcatgttc     33000
     gggtagggtg cgggtgtttt ctgaaataag ctgctcgaaa aacaagttga acagcttgcc     33060
     aaagtttttg aggttagctg gctgacaacc gacgtagatg gtcatgcgct ttttgcgcag     33120
     ctcacgaaaa tcaaaatccg aaccactgac ggcggctgcg gtgacgcggt cactgaatat     33180
     cgccaatggg ctgagtaagt tactttcgac gctcgaatac gtctcttcgg ccatcgacaa     33240
     gcagttattg aactcaaaac gcgcatcgtc agagacgtag tcgtttttga tttctcggcg     33300
     catccatgct cttaggccgc catcgatgcc acccagtttc agcacgtagg gcaaagaggg     33360
     cgtgatacct gtaatggact cggtatcgag catccaacaa ctgagccctt taaataactt     33420
     acccgctaac tcattccaaa tatcgccctt atccccagaa atggggtata agctgttagc     33480
     aatattgagc acatcgctca ctcgaaacac gggacttctg cgaacgtagt cgtaaggatt     33540
     ccattgatgt gtgcgaagct cttcgcgctc tcgcgcttgc tcatcgatgg catacccatc     33600
     cggcgcaaac aagaaaacgg cttgaccgca ttgctgacga aatccgccgc ttttaaccaa     33660
     gttctcgaat ttaatatcga cacaaaccaa cgaatcggga taggtcacgc agttagggat     33720
     aactatgccg acccctttac cgcttcgggt tggggcaggg acttcaacaa actgcgagct     33780
     ctctagctcg ataaaacggc ctttaaagcg gcctttgggc atcttgccta acaagatgct     33840
     tggcttcttg ttcttggctt tcgggttagg gaaaagacca gagttcgcca agtccatgtc     33900
     ggtcgcgaac ttcgcactgc cgtggatttc ttctctttct tggctggcaa tggctatcac     33960
     gatggccatc agcgtcggaa acaaagtgat ggcgatactc acggccaccc caatcaccaa     34020
     gaacttcttg atgtcggggt tgtggctgta ggcttgccac tggtcaaaga ggctgtgata     34080
     cgtcaggtgc tctaacgaga tgttggtgag cttgtaatag gcagcgccgc caccgtacaa     34140
     gccaccaatt aaacacagca gggtaaaaaa aaggaacatg gcgaacaata ttcctttttt     34200
     ctttttcgat agcgccatga tttagccctc gcttaacagt cgattcttct cgacggggtc     34260
     gtaaaagagt tcgacgaggt gagtgtgttt gaaaaaggca atcacatcga tgctggttcg     34320
     aatggttcgc atgatgtggt gataatcgag tgtttggccg acttcggatt gtttcactaa     34380
     tcccgccagt cgtgcgggtg tggaataaca gtcgttggcg tgaatggtgg tgattgagcc     34440
     ttcgtgtccg gtgttgagca tttcaaggta cgtccatgcc tcatccccac gcagctcggc     34500
     caacaacacg tggtcgggtt tcattcgcat acacgactcg atgatttgtt tcggggttaa     34560
     gccgccttgc ttgtaaaaca gatgaaggtg attgggatga ttgggtaagt cgagctcatg     34620
     cacatcttca atggtgaaga ggcgcttatc ggtggggtat tcgtccacca tcgctttcat     34680
     gacggtggtt ttacctgaac cagtaccacc aacgagcaag atgttgagct tgctctttac     34740
     tgccatgcta aagaattgcg acatatcgcc attttgtttg agcgtgagaa gctgctcttg     34800
     aaccggtgtt aattcaacac ggttcacatc catttctcta aaatcagaga agcgaccgct     34860
     ttcttggtag ctcgacagcg caaatcgagt gagggaaggc tttcggatgg tcatgctgac     34920
     aatgccgttt tctgtggcgg gggggatagc aatttgaccg cgctcgccat caggaaaaat     34980
     gactgaggcg accgggttgg cttcaccgag aggaatggtc agtcccgcga aagtggctaa     35040
     cgctttcgcg agattgctgc acatgtttaa tgataagttt ggcagcgcgt cgcgctccca     35100
     accgttacca cggtcaaacc acacctcgtt aggtcgattg atggctatct cggtgagccc     35160
     ttctaagtct aagtagtgcc gcagtccggt catgctgagt aattgattga ccgttgcggc     35220
     tttatcgatg gtgttcatga ttatcctctg tgttatggag tatgcttctt tgctcgattt     35280
     ccttttgtac ctctagccaa tagttgacga actgcggtga agaatgagta agagcggtgg     35340
     gggggatgtt gaggcgttgt gcgagttcaa tatcaaactc agaaatgttt ctcatggtaa     35400
     ttctccaaag tctttatcca cgcgtggcgt gttactcctt ttgtctcaac aagcgcgacg     35460
     cccgttattg cagccaaaag cgagccttgc attgaagtga cgtgaaagtg agaaggtggt     35520
     tggcctgtcg ggtctaaaat tttacataga tcgttcatgt aatcccgcag accaaccaga     35580
     tttagcggtt actcgaaggc gtacacactc gacatatcaa tgtcgcgagc aacaatgatg     35640
     ttgatgcgtt gaccgatttg ggtgtaaccc gttggtgaga tattgatgct gctctctaga     35700
     gccttctctg ccatgttgct ggcgttctcg gttgagctat caaaggtaat atccccatcc     35760
     gatgaagcgg ctttttctgc gagtgcgcca aaagcatcgt cgaggaagga cagtaaaatt     35820
     gcgccaccaa agcgctcttt aaagtgatta tcgacccaag cctcgttacc gcttgcgccg     35880
     aggcgacctg cacccagtga atcgatacga atggctatcc cgttcggcgt ctcgatatca     35940
     gcccatgttg tgaatacgcg gtttttccct gcttctaact gaacattctg cgaacccgtg     36000
     agcattgaac ctcgctctac caataaggct ttaccattgg cgctgtacac atcttgagtg     36060
     acgcgacaca tcacaatgcc ctgatagtca gagatgacct gactgtagag tgcacaagga     36120
     atgattgagc catgtttcag cagaaaatct aatcctcctt gcttgcgctt ggcggcgtga     36180
     cccatcgcga aggtcggtgc gtcatagctg ttgtcgtaag aggcaggttc agtagtactt     36240
     tggctactgg cggcattgcc gctttcaacg ttaaccatga ggctacccat taagcgacgc     36300
     tcttgtggag tcggtggtgc tttcttgcct cgctttgatg tggcggaagg ttgctttgcg     36360
     acattgggct caggaacgtc cgttttaggc acagtgacag gttgctgctg cgttgcttgc     36420
     gctttggctt gcttgagctc ttgttttcgt ttccactgtg cggcgcgctc ttgctgcgcc     36480
     ttgtcttttt catggtcacg cttggctttc tcaaaccaag cactgtcgtt gccgactgtg     36540
     cctttttcaa cgccaatcac ctcggcagta gactctggct gtaggggctt tgtttccact     36600
     tccgcttcac gaaattgatt aattgcgaac agaactccca cagcgacgac gaccaaagag     36660
     aggatcacca aagcgatcac aatgaccgct ttgtttttct ttttacgacc gctcaccgtg     36720
     agctcgccac ggtcgaggtt ggcgctttca taagcgcttg ggatggtgtt gtcatcactc     36780
     atgttcgtcc tccttaatga cgcgagtggc tttaatcgag ctcgcttttt ggttgtggcc     36840
     agcgaactcg acaaagtgag aaagcacccc tagaacacgt tcaccaaggc gcaaacggta     36900
     ttcgttggcg accgaatgga tcacgatggt gtcttgctca atgtggtagt tcactaacga     36960
     ctctttgctg tcggcgttga tttggtaaat cacgggcagc tcggcgtttt tagtaaactt     37020
     catgcaagtg aaacggccat cgtcccacgc gtaggcgggg gctaattcct catcgcccca     37080
     cttcacgtaa cggaagttgt attttccatc agtacaaggg gctttgagag gggtagtgtt     37140
     ggctttcttc ggtttggggt aacgcatttt caccacatag aacggctgtt tattggtgaa     37200
     cagttcaaat gagtaggtgc gccccaaatc gctcacgatg gttaagttgg tattgggttg     37260
     cttggcttga ggtttaaaga acacgttatt accacgcacg ttaaaccccc atgcggcggc     37320
     atcccccatc cctaagccag aatgctcgcc aacaatggtt tcattcttgt cgagctgaat     37380
     gagggtggcg acgcccactt tggtgcgtat cgcaatcaca tcactggggt cgtactctgc     37440
     atacacgatg cggcggtctt tgccttgatg ctttggcagg gttaaggcgt gagtggaaaa     37500
     cgccatcaag cacgccaaag agacaatcag ttgtttcatc attggatcac cctgttttct     37560
     tgataactgg tgactcggaa accaagtggg ttaagttggc gctctgattc cgttttgatt     37620
     tccttgaggt aatcaaaggt aacggtggcg ctccatttgg tcggtaggta agcggtgtct     37680
     ggcgtgtcat cgctattgag caccacttta gtgaaggaca cttgcgcgag catttggtct     37740
     tgtcgggttg gcaagaacga aatggcaacg tcttctaagc ggattttctt atagtctttg     37800
     aacacttcga caggggagtt cttggctcgt agctgcgtgc tgtaagcgct gaatacgtcg     37860
     tgacgactgg tgagtttgac gtagtcaaaa gcgtcttgaa cggtttgcca ttgataagag     37920
     ccgcgagtaa tgacgtaacg attcaaccaa tgcttatcta acgcttcgcc gtaggtgatt     37980
     tctcttgcgt cagcgagtgg ttgaataatt tgagtcatgc ctgtttgtgg atcgatgtag     38040
     agcaatcgat agtccacggt ttttagtggc atcatcacaa caatcgtaat gccgagcacc     38100
     aaagcgagaa cgcaggaacc cgttgcgact ttccatgcgg tcttcgcatt tttcttggcg     38160
     atttcgatgc ggtcttgctc gaactgctta atctcttcga ggtacgcatc agcttgcttt     38220
     tgatgtttgg cggttggttt tttctcggcc ttggtatgat tgtgttccaa ggcagaatcg     38280
     atggttgtgc tcattgcatg tctccttggg tgtacaaatc agcaaggtta actttggagg     38340
     ggttaaccgg agtgatatcg ccttttggct ccggtggcgg cggtggagtg ctagagcaac     38400
     ccacagtcag acacgccacc aataataggg tgaacgtctt cataaaatgt ccttttttag     38460
     atataaaaaa accgcgtaaa gcggcgcggt gtctagggtg agagtgtgag gaaggtgtta     38520
     gcctggtcta attcggtttt tgaacttatc gcccaatgac ttagcaccat tgtacgtgcc     38580
     ttgtcctgcg cgtttggctg ctcctgcgcc acctttagcg gcgttactga ggcttcgcat     38640
     acccattccc atattgctga ctaagccgtt aataccaacg ccacccgata gggatgaaca     38700
     gaacacaggt atttggacgg agattaagat gcaacaacca aataagatga tggtcattat     38760
     cactgttgag agtccaattg cagtagcgct accaccaaaa ataacgtgtt cgagagttct     38820
     tgtgaaaaga ttgaaagcaa tcgggtaaac cacaaccaat agtacatagt ttaaacattg     38880
     cccagtccat gttttgaaca tgtctcgcgt tgagggaaag aaagcgaaca tgataaacaa     38940
     tggaccgagg ataagaagga agctgaccat tactttagca ataagcagat aggcggtcgc     39000
     tacaacaata aaagggagat agccaatcaa tatcagaaag gctaacagca taaagtatat     39060
     cgattgcccc cacgaatccg acataccaaa actaacctcc ccccatgtat cagcaaattg     39120
     tttcaacata gtgtcgaaca ttgtttggag agaaccactg ccagttgagc caagcatcgc     39180
     gttagcaata tcatcacctg agtaataaac cataggaaca atgctattca agtaccacga     39240
     cgtgttaaac gctacggtgg tacacaatgc taatgaagct atgaatttta acgactccat     39300
     tatcatcatg ttttcagcat catagagcgc ttgaaacgca aggtagatag catataaaac     39360
     aacacacgcc ccaattagag gcgtgattgt ggctgtaaag atcccaacaa aactggctat     39420
     attttcctgt gttatcagat gaacaaagtc gaatagtcga tcaaacattt catcctccta     39480
     ttcataggtt atcccatcac cgaacattga ttttttgtag ctatcatcaa gtaccgcttt     39540
     aattgcgttt ttgcagttct cagacaatgt ggctgttttc ttttcgcact caattttaac     39600
     ggtctttgct tcatccaagt gcgctgaata gtattcgata gttttagttt cttcgcttga     39660
     acaggcggtt agtagaaaac tgaaagcgat taaagatatg atttgtttca tagtgaatgt     39720
     cctttactcg taggtgatgc catcgccgta cattgatctt tgatagctat cattaagttg     39780
     cttcgaatgt tcaatttgtt tttgacgttc cagcatgtct gacattgaat ccatcatgcg     39840
     ttgctcgttt tgcatctgca tggtttcaaa gttgatgctg ttcgctaagt cttctttggc     39900
     cgctggcgtt gttgcgctgc caaactgact aagtagacga ctcattcgtt cgttgcgttc     39960
     agtgctgcgc tcataaagca tttcctgaaa acgaagttgt ttcagttgca tatcgtagcg     40020
     cctctgtatc acggggtcgt cggaataaag gccaaattca gaacgtaagt cggatatatc     40080
     atcaacagcg tcatacaaat cactgtatgc actgaggtcg atcacatcat ttaagttcgg     40140
     gtcactgaga atttcttcga atccatagtg gccttcaacc atcgacttat aatgctccgc     40200
     ttggcttttg agttgattga gtcggttgcg agcttcgctt atcgactgcg taaactcttg     40260
     agctcgctgc gcactatcaa ccaccatttg agtgatacct gcaacgtcaa caacggggat     40320
     acccgatgct tgtgttgagg cgttcaatgc caatgtaatg catagggcaa gcgtggttcg     40380
     tttaagcatg gttatctcct tttcagtagt tcaggtatcc acaaatcagg atcattgccc     40440
     acctcagcgc gaatggtttc acacaacaca atgtcatcgg tagagcctga gatgatcggt     40500
     aggaactcat caaagccacc taaatccagc tttgcaaaac aactggtgtt tgactgctta     40560
     atgagcatgg ttcggctttg tttatcgagc gccttgagtt tgtcgaactc gccttgggtc     40620
     aggttgcatt gctggtaagc ctcatactct gcatcagggt tcggcaagta cactttggtt     40680
     gctgtttgtt ggacgatggc agggaagatt tcacaatgaa tcgcatcttc tggtgactgt     40740
     gatgacagca ccataaactc attcattaaa cgtccggttt ttaacgctcg tttcatcacc     40800
     gcttgggtga gagggaagtt cgctggcatc cagaactctt ccacaatggt ttgcagtagc     40860
     ttaccggact cttgcatgag ctcttttaag aagaacaaac aggcaagaac gggctcgcta     40920
     gcaggatgaa catgaccgct tgaatctttc tctagtagca gggttgaatc aaagccaatg     40980
     cgatccattg cttgcgggtt gaactggttg tgaggtgaat ccaaacacca agcaagctta     41040
     ccgttttcac tgcgacacca tttactgagc ctcatgcgca aatccggatt ttgaatggat     41100
     tgcagcatca cactgaggcc gcgcatcggt gcgtcaaagt tcatcacgtt atctatcgca     41160
     tctttgattt cctgctcatc atgagcgctg atgtggcctt gtgagtcttg cgccaagcgg     41220
     caaacaagac ggttcaagaa gctcacaagt tttggtgact gctccaattg gaaagggttg     41280
     atacctgtat cttctccttc cttaattgaa aagtattcgc caccaaacgc tcgaataaac     41340
     agctcggtag agcgtttata gtcgatacaa aagatttgct gatcaaagcg agtaaaaaag     41400
     ccggtaagtg tggcctctag cgtcgtttta ccagagccag atgcaccgag tatcatggtg     41460
     tgtcccgcgc tcttttctcc cgtattgtct ctgcctattg ccgaggcgtg acagttcatg     41520
     tggaacaggg agttagacag cgtttttaaa ggaatgatag cgctgccatc accgactgga     41580
     ttgccagttg ctttgcctgt cgagtagttg tgcagtgacc atgtcgaggc aaggttagcg     41640
     atggttcgtg gtgagggctt gatgcgcatc tttgacgcgg gaagggcgct taaaaatgag     41700
     aactgagact tgaggttcga acgctttaaa accgtgcctt tggctaggaa ctgaccattt     41760
     aaatcagcgc tatctatgat cactttgtct ggtgagtcac caatgacggc cagtgatgca     41820
     tgatagtctc caaagctgac cgcgccggag gcaacatagt ctctcgccgc ttgcagctct     41880
     tctaactcat gttccgcgtt gtcactggac tcaatgaagt tggtttgcct atcaatcatc     41940
     ttttgagctt taaggggctg catgaagatc atggactgag tcagaataaa ctcagttggt     42000
     tgactcaaaa tgaaatccca catccccatt tctgttgcga ttggtagcgc atcaagctcg     42060
     aagaaggtgg cgaacttggt ggcctcgttg ttcgcgttgc gaacttcgag caagtcatgc     42120
     ccgaaatgcc aatcactatg gccgatataa ttgcgcactt tttctgacgt aagtggctta     42180
     ggttggtcgt tgtagttgag taggtaagaa agaaactcaa cgtgttcaca gcggtgatcg     42240
     tcaccgactt caagcacttt gctatcaaaa cgctttaacg cggctgatac cgtcttgaga     42300
     atatcaccaa gctcatcttc tccttcggtg agtgtgcctt tgtagttgag tacaaaggtg     42360
     atgtagtacc ggacactgaa aaagtcctca ccggaaaagt cttgcaagta acgatcagaa     42420
     aagcgctgca tgaagtcgct ctcgaagcga taattggctt caaagcgttc tttgcgtttg     42480
     acgatgtgtg tccaaatggc aagctgactg ccgtactttc tggcgagggt gctaaggatg     42540
     ttttttacga gctcaaagga aggtttgagc gtgttgtaag attctgactc gaagggtatt     42600
     ccgttaaggc ttatggttgc catgattttg gcgtcatcca aagagagcat ggttcgattg     42660
     actgggtagc cataagcagg aaggtcagtc aggggtattg tttttaaacc attcgctgac     42720
     atgttgcttt ctcctgaatg ggtgattatc gatagaagtg aatgaaatgg tgttggactg     42780
     gcagcgaagg cgagttaaga agccttttgc ctcccatttc atttcatcga tggctcggct     42840
     gtcttcctcg ctacgaacgc ggatatacag tagccctaaa gcaataaagg ctggaaaaac     42900
     cagccctttt actccgaaga aactcagccc aagccaacca gtcagtagca tcaacaacat     42960
     ccctgtaatg agagggatga taggcatgcc aaacatgagt ggtttgcgag ccagtgagtt     43020
     ataactggcg tattgatctc gttcttcgtc ttgcatgatt agcttcccca aatagaccaa     43080
     gcgtaagtga ccgctgcaac gataccgcca gcggccgccg ctttagcgat gctgatgccc     43140
     acatcccccc atgttttttt ctctaacaag gccaagatga ccatgacgat actgtaaaca     43200
     aagacagctg cacctaagag tttgtatgcc caatccgcga tttcatttac ccagttcgtt     43260
     gcctcatcta agccacctgc ggcgatagct ggatgacaaa caagaaccag catcatggcg     43320
     atgaatgccg cttttaggtt gctgtatgtt tgagtgtttg agttaagtgc tttcattgaa     43380
     tatttcctta ttaataagag aagtcaccaa agacatccca tgaatgggct tgctttggtg     43440
     gtgttggttt tgaaggttga gaagactcag aggttgagtc gtaagattcc gaaatggtgt     43500
     tggaggggag tttctttgct cggttgaatt tctcaacgta gctcagtcct ttctctcctt     43560
     cactttgata acctcgtgtg aagttattgg agtaataaca agaggcggca tcatcaagta     43620
     gttgttggtg tgccttgttt ggtgcttgcg cttttgcgcg gtggtaacac ttagcgtaaa     43680
     tatccgctcc gacctcaatg cttttacaag cgtcaaatgc gctttcgata gtcatgccat     43740
     aggcgggaaa gttctctttg tagatttgca tcaatcccaa gctgtactga aagccttgct     43800
     tctccaaatt ggtagcaatt tggatggctt caagtttggt cttgggttga ttaacaggtt     43860
     tggctccgac tacagcgata gcgtagggat tacgagagct ttcattatcg atgagacgtt     43920
     tgaggatgct tgcgtcaact tggctttggc aggtattgag tagagggatt aacgcactca     43980
     actcaaggag catgttcttc ctcctgtacg acaccaaccg ctgatattgt tgggtatcgt     44040
     tttaaatggt cttttaaacg tattgagtat tcatcaacca aggtttttac tttgtacttg     44100
     cctcgataca ggcaaggtat aacgcttttt cttaccctaa tagggatctt aatggacgtt     44160
     ctatacacta tctcatcaag cttattttgt gggctgtgat gaaatcgttg tacgtggtca     44220
     attaagcgaa gggaagcttc cttttttaag gagcgaaaag agcgttgaga ggcttggttg     44280
     agaagagcat atgtttgctt atcgagggtt aattgcccct caacaatttt tttatcatcc     44340
     atgtgagact cctttttccg tcccaaggtt ggatcttttt ggataaaaaa aagcgctagg     44400
     atttagcgcg aggtttcatg tgttggttga actttgataa gtgatctttc agacgaaatc     44460
     gagcttcttt gcgcttagat ctgtcgttcg cttctgctga ttcttctaaa agccggtttg     44520
     tgtcttcatc tagttcgaac caaattccag ttgtgtcttt ttctgcgttt tgtggcattt     44580
     catttacctc aacgctagga actcacgagc atgaaatcgt cggaagtgat tacgtgttcg     44640
     ttctacttca atatcttgtg gcgttcgctc ttttgttgct ttatcgacct ttgattgagt     44700
     tcttaggtag cgatatgaac gaaaccgttt gagtttgttg gtcataactg tttctccttg     44760
     cgagattgct ctttcacttt catcggctca gagcaaaacc gaacccagcc cgtttgcgag     44820
     acgtcgggtg tgtttgggga atatttctct ccactaagtt tttagtgggg cttccccgtc     44880
     gataaaactg atgcagtgga gcacgtttcc aacgttctgt tgcggtgttt tatctgccta     44940
     ggcacaaatt gataaagagc ggatagttaa agggaagtta ccagcttcca atttcgtagt     45000
     tcaaacttta acttcatatt taaactacgg ataaagtgct tttaatacct aaaaagactg     45060
     tgatacatat cacgctctct ttttctgaga agtgattttg ttttctcgga ctagtgagaa     45120
     aattatgaga aaccttaatt ttcaatgaat tagattctct tttggctctc tagttcgcaa     45180
     gtcacttagg tatttgtatg tgtgtttata aattagctta aatttaattg gtgatcaact     45240
     ttaagttcac tttgtgatgt ttagggggtt ttagtgaggt ttttgtgaat ggtcataact     45300
     ttacaatttg aggagactat tttgagttga gtaactatga aaacactggg tcaacgctta     45360
     gaagaattaa gagttaataa cagacttact aaaaaagatg ttggacatgt tgcaggggta     45420
     actggcacaa ctgtcgacaa atgggaaaaa gatttaataa tacctagaga tgctaagctc     45480
     aaacgtttag ctgaacatta caatgttagt ttcgaatggt tgcgagttgg tgttgacgga     45540
     gcaaaagtga caccagttcc tgagagtttt gcggtatcga ttcaatctta taaagaaggc     45600
     gatgaatctg tattttttga tgctcgactg ctcccttcag gtcacagcga gcgactagtg     45660
     tatgttcagg ttgaagggca cagcatgggg gatatacttc cagacggaag taagttgatt     45720
     gtcgatcttg aagaccgaca ttataaagac gacaaactct acgttttcaa aactcaagat     45780
     ttcatgtcta tccgcaggtt atcattcaca tcaaccggtg ttaggttgca atctttaggt     45840
     agtcagaaag acgaagttct tacttttcaa cagctttcta aggtagatgt tttagggcgt     45900
     gttatatctt cgatttgtcc gcgataatgc agcctcacgg ctgcattctt aatcgagagt     45960
     tgtctgaaag cggattgtgc ttttactcac aacgaacgct tggctcctta tttcctttgg     46020
     tagcttagta ttcgcgataa gcttttttaa gtaagtatct tctggcagcc tgagatcctg     46080
     atataactgc tcaataggga tgtcttgacc ttcatgctca aacaaatagc taataaaacg     46140
     gtggttggta ctaccctgtt ttatcctcaa tatctcatct tctccgcgta gaaccgcgtt     46200
     ctgagatgca tcaaacaaaa gtcccgcctt tggagattcc ttttcttcca aagttgtcgc     46260
     tattgttaca tttccatttg attgaaaagg taaaagctct agagcaagcc aaagcccaac     46320
     accaagaaaa gcacttactc caatggtaca gagaatatcg taggtgtttt ccataggcat     46380
     agcactttaa atcaaggaag ccacctgctc tactaactta tcgatacctt ttttagcatc     46440
     agcaatacta ccagctagca tgtatgcagg cgtcgttaca acattgtaat cgttatctac     46500
     gacaatattg tctacagtgc agtcaacatg tagtcctcct agactgttga ttacacttgc     46560
     tgtttcttca tcgtaaccaa ttgtgcagcg aacaccgtta tacactttag gtagaagcac     46620
     tggtgcgata cacatataac caacaggctt cttcttgctc gcaaaggcgg tcattacttg     46680
     ttgaaattca acgtcaatgg aaaaatctgc gccatcggta gcgaatgttg ataggttttt     46740
     tgctactcca aaaccaccag gaattatgag cgctgagaaa tcttgttcgt ccagctctga     46800
     tagtgcactt acgctgccac gaacaatacg tgcagactct tcaagtacat ttcgagcttg     46860
     ctctttatct tcacctttta ggtggttgat tgtgtggagt tgtggcttat ctggagcgaa     46920
     gcattgataa gcgatgccgc gctcttcaag agccagcagc gtaagcactg cttcattgat     46980
     ttcagcgcca tcaaagacac cgcaacctga caatacaaca gcaatttttt tcataaccta     47040
     gcttccttat tattcattag atcaagtagt tgattgttcg cccttgtttg gtacgcctcc     47100
     ataatgtcgg caatcaaact tagtttcagg tgaacatctt tgtccgaaaa aacgacctca     47160
     taaacgtcat ttaagaatgg cgcgaactcg aacatttctt cgtagtggtt cccgacgttt     47220
     tgaattggag cgtcgagtga attaaattct cgtaagtaaa cagatgtgcg gtgtttgagc     47280
     atgttctgga ttttgcgttt tatagcttct tcatcactta aatcatcgtt aaggatgata     47340
     ctctctagtt cttttagttt gcctctagag tgataccaaa cgactgactt cacgtagttg     47400
     taagtcataa aagatgaaag gtgatccagt ttgtctggtt tggtgatagc cacgccccaa     47460
     ccagccaacc caaatgatag aaatgatagg aagagtattt ttaacttcat aagcctgtac     47520
     tcattcaact gacattttta agggtttatc cctttttcat atgaggaatt gataaagtag     47580
     agctaactac attgcaattt agtggctata aaattgagaa gtagtggctc ataaataagt     47640
     tgttaatatg aaataaattg cctttctggt tttaataatg agaagttgac tttttgaggt     47700
     tgtacggttg tttttaaaaa cacgttctac tataatccta agtgtccaga gtgcattgca     47760
     tagcacgcta cctgcgtaga gttttacgca gtgtattaag gacaattgag tggctgaggg     47820
     tggtaccttg gtatataaca ttcagcaacg aagccagatc ttccgtaggg tctggctttt     47880
     ttgtatctga agatcttgaa gttgatcgtt gatctttctc ggttttcgct atacatttat     47940
     gacaactact cggacttacc acccgattag acttcaacta cggaaatcaa aatatgacac     48000
     agtttaattt aatgcgccct cggtgcgatc tatcacagca tactctcagt tcaagcgttc     48060
     atatcgtcaa tggtgtaact ccattacgtt cgtgcttggg ttctgttggg gtgtgctatg     48120
     cagtcctttg aatcactcaa ccaagtcact cccagtccag cgctagatgc gaaggataaa     48180
     catgcgcgta agctcagaaa agaatccaac gctatctacc gtgctaatcg caaagcaaga     48240
     gttcgtgagt gcatagagat ccatcatgac gcggtggcag cagagaaagc gcgacttaaa     48300
     gcaaagggta aagcattcac taacttggaa attggcttta caaagcgtcg tgtattgcgt     48360
     gataagaaaa atccgaaagt cataaacctc ccccttgagt ttgcaacaat tcttaaaggt     48420
     tgcgaagagt ttatcgataa cccaagccgc ttccctgctt tagatatctg ggtatctgaa     48480
     atgcgcaatc gccaagctcg cgagctagtt gctaaagttt tagcgtgtct gttaagtaac     48540
     actgacatga taagtggtcg cgtcggtaag ccaactgaag ctggcatgaa aacactgagc     48600
     tattatcaac tccaagaaga ttatgccttg cgctttggcg agtacattgc accaaagtca     48660
     tttgggaaag cgattaagta cctaaaacaa gcgggttact ttcactctga agcgatcaat     48720
     atccgaatgg aagacggtga aggtgctgtt cgcagtgctc ctgcctacaa gcagttctct     48780
     gagcgtttct ttagtgatct taaagttgtt cgctacagta acgttgctga atccatagtt     48840
     gctacacgta agcgtcagat gaaagaaggt ctacgtcata cgtgggtaag ctttcgtgaa     48900
     atcgctaatg gtgtcagaca gatattcttg aacgccaaca aatttgagag tattgctgag     48960
     tctacaggtc gagtgttcga agcgtatctt cctcttcatc ccaatccaca ctaattactt     49020
     tgatttaatc cgcgcaagcg gaggactccg cacatctgtt aataattgac cgtgatttct     49080
     atcacactct cccacctcac gcaccggctt tttctttcgt tcttactcca gttcccctct     49140
     tcttctcgtt aggaaccctc cttcaaccac taaaattact atccacacaa aagatacctt     49200
     tacattcaac ccttaaaaat tcgccttaga atatacctaa catagagggc gtgctttata     49260
     gaactccgta ttaagacttt gtattaacaa taaatatata aataaatatt taagcaaaaa     49320
     atcgcttcgc tcagtgaaac ctcccatcaa aagcattaca aaacagtgat acatctaact     49380
     cataggaatg cttttgacgg gccccacagc cagctttaac tactcatatt aaaattggat     49440
     tacgtgataa tagctggctg cgctggaatt ttcttttgtc atgcgacagg aaaccacagc     49500
     atatatacgc attattcagt gaatagtctt actcgctacg ctcgcgcatt cttgcaaggc     49560
     gaagggcaat ttttgtgccg gaagccaatc gacatacaaa aaggttctga gtgtgttgtg     49620
     aggatgtttc ttgctcacta cgtgagcgca ttctaatatt cttcgcgcag ctcagaatgt     49680
     gtgacgctgt cacatggttt aaggacaagg gaaatgatag aaagcaaaag tgattacaat     49740
     tcacgcaaga aacaagttat cgatagcata aaaatcgaat tggatagcat gggtgtcatt     49800
     tacgaaccac cctcctacat ttacacgcta gagctcgaag atggtaaata ttacgtcggc     49860
     ttctctgatc gaattttagc aagattatca atgcatttta tgagcggtgg agctgcttgg     49920
     gttaagaaat ataagcctgt aaaaatctta gatgtccgaa gaggaagtat tgagctggag     49980
     tcattacgaa cgctagaggt aatgagggag ttcggtgttt ctaacgttcg aggtggaaag     50040
     tggtgtgagt tgagagattt tacccctgcg gaattattgg agttaaataa gcgcattcgc     50100
     tctttaggtt aatagtgggc aagatttgtt gatgattatg tgtattacat atgtaataca     50160
     ttgacgactg gcgtgttgtc ctatattatc tgtattacac atgtaataca gataagggat     50220
     cgtcatgaaa actaaagtta tcagtgctgc aaaccaaaaa ggcggcgtcg gaaaaacaac     50280
     tacacttgta aatttaggtg ctgagctggc gcgaaaaaga aaagtccttg ttgtcgatct     50340
     tgatccgcaa ggcaactgca ctaaaacgct cactggacaa cgacactttc aattcgaaga     50400
     aacagtggct gctatgttcg ataagccaaa agtggtctcg atcgttgatt tgattcgacc     50460
     cgctttgctt gatggggagt ctattcagaa tctcgacgta gttcctgctg actttcagtt     50520
     atctcgcatc attgaaacat ccctaacaaa gattaatcgc gagcgtattc ttgagaagca     50580
     attagccaag cttggtgaaa cgtatgactt tattcttctt gatactccac ctaacctttc     50640
     attaaccact ctcaatgcta ttcaagcctc agatctgatt ttgattcctg tcgactctgg     50700
     cgcattttcg ttggacggca ttagcccact tcttgaggct gtgtcagaaa tcaaagacga     50760
     tgaagcaaac tatctgattt tgagaaatga agtcgatgtg agaaatacag tcatcaatga     50820
     gttcatcgaa gaagaactag aagtagcaaa agataaagtg ttgtctgtga caatccgtcg     50880
     ttcagaacat gttagtcagg ctaatgctgt tagtgctccg gttcgttttt acaagtctgg     50940
     ctctttggtt aataacgact atcgtaaact tgcatctctt atcgcagggt aggtaataca     51000
     taggtaatac acatggctaa gttgaaagct cgcggtgcta tcactattgc atctagcacc     51060
     gaacagaaaa atgaaaaatc tcaagcgatc accactgtta agaagaaagt caccacttca     51120
     tacaaagtgc cgcctttaac gttaagaatg tctcttaaag acaaagaatc gatagcaggg     51180
     tgggtagatg atttgcaaaa attgtctgag cgaaacgtgt ctgctgcaaa gctgtttaga     51240
     gcgttagcgt tgtatagaga caacatcgat gatgatgaac taataaagct gattgataaa     51300
     atgaattaag ctgtattaca tgtgtaatac atagagctcc ttagagagct ctatgtatct     51360
     gcactggctt ataatcctac cttggcatca ttcaaaactt caaatgtgtc gcgttcagtt     51420
     gttataagat ccccatgaac ttcgagtttt acgtctccgc tgatgttgta cgttgttgag     51480
     caacctgcta gcagtagtgc tgtcaggaga gctccaatga aatgaaagtt attgttcatt     51540
     atttttttat taaacgtaat aagtgcattc gacgtttgca aatttttcta caaaattttt     51600
     ctgaagatag aattttggac atgaaaaagc cgctatcgag cggcctttta tttcttgaac     51660
     gttatttgtg gattaagcag taatcgacca acatcgattg taggtcttgc ctatctcgta     51720
     ccaacgcgag agctgcggcg gtgtcaatgt gctcatgata ttcatagagc aacttgaaac     51780
     caccaaagct gaattggcga atattgtata cgccaagagt cgttaactca tggcaaggag     51840
     ggtacatttc tgggttatca gtaatgttac tctcaaactt ctctacaagg ttttcaattc     51900
     tctcgaccac aacatcctct tcactccaga gtgataggta gttgatttgg tcgtctgtca     51960
     tattttcaaa tgcttcggtg tatacaatat tggtgctcat taagtccctc ttatttggat     52020
     tttcgagccg ccaatctctc cttaaatttg tctgagctgg ttgttcgtcc agcagtcata     52080
     tcttcacgtc caaaactgac cagcttcatc aaagcaatag cctgatcgcg tctttggcgc     52140
     tcttcgtatg actccacaac ataaatcggc ttgccgtttt gtgtgatggt cattgcatca     52200
     tctaaaggaa gatcagcagc gtgttttttc aaaaagctta ctgtctctgt acgcatggtt     52260
     atatctctct tcattttcat ttttgtatta gctacgattt ctacggcctg tttatttccc     52320
     gttcgagcat caacaccttt tcagaaggaa gagtgccttc tgttcttagt aatataactc     52380
     taatatcatt aagggtcaaa tatagactaa atttagtctt ttgcttgagg tgctaacttt     52440
     ttgtggttat gtcggtgtgt cagtctatag tggcggcatt ttctggtggt gattatgccg     52500
     attacgttaa atagcaaaat tgaggtgtac ttttagctct gatcttcttg tctgttcacc     52560
     aaaagggcaa aatcgataat tttcttctct tagaaccttc aaatttattc tgtaagttaa     52620
     ttacagtttt ttgccgattg ttaagtgttt gtaagtcgtt tttatttcat cgcgatctcg     52680
     acctgtaacc cataaaatga tcacttttct attttgagaa tgttgatgtg aatcacatct     52740
     atagaaagtg aatttcttcc taacgtactt ttcaattgtg caatttagtt agggggagtg     52800
     ggaagggcaa ttcaacaaca tcagtggatt agagctgtat atcgtttttc aattgtgcaa     52860
     tttagttaag ttgtattgca attaatgtaa tgcaattcag ttagttacgc tgttttcgcc     52920
     gttgttttta tcgaatgctc ttactagaat gaagcaacca acatagggtt ggacgatact     52980
     aaaaaggaga acacatgctc cagttgttaa gcgctttatc tgcgtggctt attgccactg     53040
     gtgtcctatt gaaagccata ttgaatactc tattttaata tgcactaagg taaggaagag     53100
     acattcgtct ctttccttct aaagacattc aggtaaagtc tgcgtccttg cagctcatga     53160
     atttccgagt tacatcgtct ttctcatcct gcgttgcatt cctccacttg ttccactgct     53220
     ttcttaccgc ttcatgactt ctgccgtcca tgtcagcgac ccaagctatc gcctggtgta     53280
     ttttcatcgg tttgcgcaag gttatccgtt tgtctggttc taccatgctt tccactcttg     53340
     ctcctaagtg catcaaaggc actttgtcgc cctgacataa ccctttcatc aaacctttat     53400
     ggatttgata gcagattaac tggtcgcgtt cggtagcgat gccgcgcttc aatcgctccc     53460
     atgcgaccat taacgtaatg tacttatcaa acatttctcg ctgtaagtgc ccgtctttgg     53520
     cgctagagcg atcacgccaa cgcataatgc tttctacttc ctctagtctc actgctttca     53580
     tttctttctt ctcctgtgtt gttgtagtca gtttgcgacg gttgtgtgct cgcgtacagg     53640
     gaatttcaga cccaaaaatc ccttgctagg aaaaagcggg ttgttttttg gtctatttgt     53700
     ttgtatgtat gtatgttagt ttgtttgtat aataacaaac gtacaaacaa actttgaacg     53760
     tgacaggaga acggaacatg gccagagaaa gagctttttc agatcagcaa gtcatagaag     53820
     ccgcaaatgc gcttttagtt gaaggtaaaa acatcaacgg aacgtcactg cgtaacaaga     53880
     ttggtacggg ccgtccgtct gccttaatgt ctgcatttaa ggctcttgag gattctggtg     53940
     aaatcctagc gccaatgctt ccagactcta ctgagcaaac cattactcat caggagttgc     54000
     cgccagaaat cgctgagcga ttgtcggtca tgcttggtga tgttgaacag cttgttcacc     54060
     agatcaacga ccacgctcat tacactgttg agcagcgtct taaccaagct attgcagaag     54120
     cgaacgaacg tgctgcaaat gcagcaaagc gcgaagcgga atcgatccaa gagcaagata     54180
     aagcgttcga gcagttagaa gatgcgcttg aatcaaatgc tgacttacaa gagcagttaa     54240
     agcaggagca caaagagagc agccgtctta atgctgcgtt gaatgttgct cagagcgaaa     54300
     cgaaagcggc gcttgatacc gtttctgaac gtgatgaacg tttggccgag atgcaaaaac     54360
     agatcgcatc gatgcaaaag cagcttaata ctgccgaatc agataaagcg aaagctgaag     54420
     ggcaagcgga gcagcttggt aagcagttag aagagaagtc agaggaaatg gcgaagctga     54480
     atgcaagcct gaaaacgtct gaaaaagagc tgggttcgct gcaaggacag gttgtttcgt     54540
     taaccgaaca gatcgccaat caaaaggcta ctaatgagca attacaaggt aagttcgatg     54600
     aagagaaggc cgcacatatt cgcgctgaaa gtcgaattga aagcttaagt tcggagctaa     54660
     acaagaagaa catcgctctg ttagagacgc aagcttctct tggtgaagct gaaaagctga     54720
     gtgcgaaact agaaggtcag ttaatgcagt atcaagagaa ttaagatgtg gtgtatcaag     54780
     aaagtatgtt gtcctcttgg tactctgaca ttctttgtta ttcacacata ctttcgtgat     54840
     acgggtgaat tatgttttta agtcacggtg taaatgaaca aggcgatcta gtgagtattc     54900
     tcgaagtgag tgctggccgt gtcccgttaa gttgtccgtt ttgtgggcaa ggcttgattg     54960
     ccaagaaagg ggcacaaaag gaacatcatt ttgctcatga cggccaaact tgcgctgatg     55020
     ctaaagcaat attgcagatg acagccttac ctttgtttga tatggatatg gggctttcca     55080
     agaccgagat tactttgctt gaaaagctat ctcgatggcg ttcttttagt cgaacttggt     55140
     tatcgtcgaa gcaaagggct gtgttcgatg aactggtcgt ttcaggactc gttgactttc     55200
     aagaaggaga tgacaaacca agactctcaa atgtcaggag acaataatgt ttgatcggtt     55260
     ttgcacttaa aactggtaga actggctgtt tttgaagcta aagtttgatc gtttttcaga     55320
     gatttaccat tctcaaagag ccaaaaaagt acaataaaga ttgatcgctt ttaagctcat     55380
     ttttggacaa aagcttctta gaccgttcgt tctattgtat gcgccccatg aacccacggg     55440
     gcggtgttgt taatgtttga agttccaagg taggagcgca tcgatatcag gctcagcttt     55500
     cgcgagctct ttcatgcact tgaccatgta gtcgtagagg ataaggccgt tggctttcgc     55560
     tgtctcgacg atgctgtaaa gcatcgcgct cgcatcagca ccatttggtg tgtttgagaa     55620
     cagccaattt tttctgccaa tgaccagcgg tttaatggcg cgttcagcac gattattatc     55680
     gatagataaa tgaccgtcat cgatatagcg gatgagcttg ggccattggc cgagcgtata     55740
     cttaatcgct tttcctaatg gactagagct tattacttgt tgagacgtca tccagtcgtg     55800
     cagctcatcc agtatcggct tggcatgctg ttgacgttct gcttttcgtg tttcgacagt     55860
     cgcacctttt aagcgcgatt ctatcccata gagcttctgg attttggcca gcgctttatc     55920
     tgctttgcct gacttacctt taccttgaag cttcttagca tccatgaact tacgccgtgc     55980
     atgcgccaag caacccacat tggttacgtg atgaagacca tcataggcac catagccatc     56040
     ggtttgcaga taaccactgt aatcccccaa gaaggcaaca gggcataccc tcgcgcgact     56100
     gttttgatag tcgtacaagg cgatattctt tacattcggc agtgcagcgt cgggcgagtc     56160
     tgcgcccgag cagtagagcc acatataaca ctttttatct tctttaagga cattgagcgg     56220
     cgtttcatcc gcctgaacca ccacttgttg aagtagatgc gcttttaagg cggcatagag     56280
     gggtttgaac ttctcactga cttggataac ccaccttgcc atggtagttc gcgatagctc     56340
     aatacccgac tgagtaaaca gcgactcttg gcggtaaagg ggcattgcgt attgatattt     56400
     accaaggatg atattggcca gcaagctttc tgtcgcgaag cttttaggga tgatgctctg     56460
     gggcgctggt ttttgaacga tgtggctgtt gtcttcagtt tgctcgcact gacgacaagc     56520
     atacttagga cgaacatatt ccagcacttt gagcacagct ggtgagaact caagtttctc     56580
     actgcggtct tcaccgattt tatgcagact atgttggcag caggcacact gtttttcatg     56640
     gtcgtctaaa tcgagttcga taacctcacg aggcaaagtc tttggaaggg gcttgcgttt     56700
     accacgcttc ttcgttgtag tggtcgtcgt gaccacttca acctcttctt ccttagcggc     56760
     ttcacattcc acttcgttga agaggtcacc ttgagattca tcgtaaggct ttagcgcctc     56820
     ggagcgtttc gcgaactgac ggtcgaaggc cagcttgagc tgttcgagta aggattgacg     56880
     ctcttgtttc cattgagact ccttccgctc ctgagagagc agaagggctt tcaccatcgc     56940
     ttgtagcttg gcaacatctt ggctttctgg gttgataact ggcgtttttt tcatggcatt     57000
     tattatacta aaatcatgcc attcacgctt ggtagataag gctttattat caattaagtc     57060
     attgtaaaat cgtttatttg aacgggttta tggccgataa tcgtgaagcc agaaagcagt     57120
     ctatcaagct cgaattgagt cagggtaaac acttcatttt gctcttttgc aggccattta     57180
     tacttggctt tttcaaggcg tttataccaa agcgcaaagc cagttttatc ccagtacagc     57240
     actttgattt tgtcgcgctg tttattggtg aacaggaaca gtgcgccgct tcccaagggt     57300
     aaatcggtgt cactttcgat aatcgccgcg aggccattga tggactttct aaaatcgaca     57360
     ctctcacgat acagataaat ctctggtgcg ctgagcatat gtttcatgac aaggctccaa     57420
     tgagttctgc caggtaggca gcgggcgtgc cttgaggaat gctcaactcc acatcattga     57480
     tgagaagtgt catgttagcg gtggctattt gagcttgata tttcgttgtc ttttcgacga     57540
     cctctgctcg tacaaagcct tgagagacat ctgctttttt gagttgctgg cgcttagcat     57600
     aaaacgtcga gggattgagt tcattaagct tacaaaatgc aagcgttgac aatgaactcg     57660
     attcagactg ctcgatgagc gtttgccatt cttgattagt gtgtcgtttt cccatttcaa     57720
     atctcctcat ggttggagac ttgatcttat tcttcgcgct aggcgattag aatgcgggtt     57780
     ttatggagcg cttacgttct atttagactc ttaggtatta ggaaaagtaa ggataacgct     57840
     cgacttcttt tagcatcacc cttcatgata cttccaatat ttacttatat aaggtggctt     57900
     gggcttgtcc aacacttcgg ataggtgtcg gcttcgcgac acatatcctt atttgttagc     57960
     cgtacatttc ccaacggaaa tacggacgct gaccatccat ccgttcaact tctgcaccta     58020
     actttttgta gaactcatga gctttcgtgt tgtgtgggct ggctgtccat gaaatatgag     58080
     tagttaatga cttctgagct tccgacttca atgcgtgcat aagttctgca ccgtatccct     58140
     ttgaccgata cttaccaata actagcagat catctagcca aatagacggc tctccgcgaa     58200
     aggatgaata acgataatga aacaaagcaa aaccctgaac ttcgccatcg acttccaata     58260
     gcaaagcgtg ggcaaacgga tagtcaccaa ataacgtccg ttcaatcttc tctttagtcg     58320
     tggagatttc accgtcgaac cctttcatac ttcggtcaaa ttcagctttg tgtccgataa     58380
     gttctaacaa tttacctgag tcttgcttga tcgctttcct tacgttcact ttgttctcca     58440
     taactcaaat ttctggttat cagctaacag tatattaata agcattctta ctttcgcgca     58500
     aaaatacacg cataaacaac ctttatcata ctagatataa tctatatata tcatgaagtt     58560
     gataacaatt tttcacgcct gacgctcaat gagaggatgt gataagtaag aaatgtattt     58620
     aatcagtctt attaaataca aactgaaatg tcaaatgata taattttcaa ttagttatga     58680
     tttaacttct gtttttaaca agaaatattt cttattaaaa acagaactaa agcgataaaa     58740
     tcaccacgtt tcattataac tgttgatata tacagtaaat aaaactaatc caaaatcacg     58800
     ttaacgaaat atgaacgagc aaaagcacta agaaggaatg gggcaagctc gtgctagaac     58860
     tggttggctt gacacgagtt tggacaaaag ttacttagac taaatactta aattagaaaa     58920
     aagcggataa cttttgttat agaaaatcgc ttaatgagat gtccagtctc actgatacag     58980
     cccagatctg agctagttaa gggtcgctag cacgaagctg gacaaacggt ttaaattagc     59040
     aacccataaa ttacgttgga tatggaaaat atgcctaatc gtttgtcttg cattaatgat     59100
     acagttcaaa tttaatagta acgtttatct gtcgagcgac aacaatagca acaggttaag     59160
     aagaaccata atatgctcat atttaattgc acaaaagcag cagcaaattt cctatcgcca     59220
     cataagtcca aagaatcaaa gccactaatt caagcagtac ctgactttga cattgaggat     59280
     gttggctcac ctcaagcccc tatttcacaa tggcttgttc agcacacgaa acagttaggc     59340
     caagatatac tgtatgtttg ccatgtacaa catcggttca caatggtatt tactggggtt     59400
     gaaaaaggta attggttaca gtttatgcag tgcttctggg agcgccttgt gaaccacttt     59460
     tgttggctta ttgaagaact atctcttaat atcaatagtt caccgcaaaa ctgggtggat     59520
     aatatccgaa cgttgcatag tcagaatggt gagcgcccca ttttttgcct gcgttatagc     59580
     ccaagcgtga atgccagtgc tgcacgattt cgttctacct ttgaaactgc gttgtatgag     59640
     attggctgtt tacctaatga tgaagaggct ggggaatttg aatttcatga aaactcccgc     59700
     atccatttct caggatgcaa agaaaatatg ttctatcctg cacatgaatt actctgtaac     59760
     ggcttagaaa tgtatatgga cgttagtggt aatgacttag acgcatttaa gtcgttgtct     59820
     tttaattact ttgagcaaac gttaagtgat atgtttaatg tgtcaactat tacccctgaa     59880
     gatgtagcta tggttttgaa cacattaact actgaaaagg gaaccaataa cagatgatgc     59940
     attgtcctta gcacaactga gcttttggca ttagaaattt ggtagggaaa acgaacgccc     60000
     ctaaaatgag tagagcattt gatctaagtg gaaaaggggc aaaagttagt caattgaagc     60060
     ttgctaactc gagggtaaaa agaagaagac tgatggctgg ctttcgtcaa gtgataataa     60120
     gcaaaatcac atcaatacaa ataacgttaa caccattcgg tgtatatcat tgcttttatc     60180
     ataagcaagg ttcccaagaa tggtaaacac cggtaacggt agatagcctt tttcagatat     60240
     tcagcactaa aagtatcttg tctataagat tcatttgaac cacagcgtgg acactactga     60300
     tgatttctgg cgatggttgt gggccaaata cagttaaaca tttgtgatac gtttttttat     60360
     cgcctcgatc tcctacccta agcctcaaac tacgactttt aaaaaaagat cccactacgg     60420
     gatctttttt taatatcggg gggttgagta ccaatctcac atcggccact ttaaaaagaa     60480
     cattaaacaa actataaaaa cagaaaaacc aatcgaaaaa taaccacaag ccgtagctaa     60540
     cttcatatac ctcggattat cttttatatc acgcctatcc aaaacaccag tgcgccccca     60600
     atgtaaaaac ttcagtcctc cataaaaaaa aacagccgca accaaaagca caccaaggct     60660
     gtcttgcaac cacaccataa aattatcaat gctcaataga tctccccccc tcaccatcta     60720
     cacgactagt gcgtccttcg cgctcgttat acccatctct acgatttcca tccccgcgct     60780
     ccgactcatt acttgaagtc ctcgttgtat aaacaacagt actctctgtc acagagagat     60840
     ctacatcaat agcgcttcca aagccaacac taatccctgc tccaatcaac tcattatttg     60900
     agttataact tagcgcgccg ccaacattca ctgcactgcc aagctcccca ctcaccgttg     60960
     tggaggttcc tgaagtcaca ctttccaatg aatctgtcgc gaaccccatc actgacgcat     61020
     taatctctag atcagtattg cttatagcta ccccaccact aaaagcaaca tcaatatcct     61080
     taaaatcact cgttacagtg ccaacaactt ccacctgccg aacctgaaca ctcaccccta     61140
     cctgaacgac gggtcttata tctggcatat tgctagctct tatgtacgac tccactgttg     61200
     gtttgtatac atcccatact ttggctgcat tttgaacgcc agtatattta gcgagaacag     61260
     caggcgcctc aacagactta gaggagttag aatttgcatt aaatgcagtc aaaacaatat     61320
     aaggtactgc gtctttatct ttaaggttcc aatgtgtcat gagatctatc gtactgaaaa     61380
     cctcaaaata ctctcgacca ccactttttt tatacccgta actaagaaag tcatcagaat     61440
     cactctttaa gcgcagcgca ccctttgagt cgcgagtaat ctttattgaa tgcttaacaa     61500
     actttgtttc acaggtttct tgactaggac caccaaacac aactttagtg tgacaacttc     61560
     gatgcgtaac aaagcgagag cggtcaggtg taagaaattt cacttcaaaa atagcctcat     61620
     cccccaacgt gaaatcttcc gaattcttaa attcaaaaaa caaccccgtc ctagaggatg     61680
     atttaatcgt gcctggctca tcctcaaagt aatacgtatt tgtaaaccta gagactctta     61740
     tctttgcagc taaatccgta aaatccacgc ttgctaagcg ctccccttgc gcccactcca     61800
     agtcacgacc atcagggctt gtcactttat caacataaac tctctgaggt ggcggcactg     61860
     tcgcccccgc acttgaataa aacggcataa ccaaaggttg tttttgtgac tacaacatct     61920
     ttttatcagt atgatagaag gtagagagca acaatccgcc ccaacaattt ggacaccgat     61980
     ttaagtgagt acaattacta acgaagagat ctgccaaggt agcatgctaa ttggcattgg     62040
     ctaagaacct aaaaataagt ttaagtatgg caagttcaga ataactagat ttgagtgagt     62100
     aaaagctcta acgagaagtg gggcaaaagt ttgctagcta gagcctagaa tccatttgcc     62160
     attagtgaag agttatggac atcttcaatt tagaaaaagc catcactcca gcaccttata     62220
     caccgtcgtc cgactgcacc cgagttcttt actgatcgcg tgcttgttca ttccctgttc     62280
     tgcaagctcc tgtatgcgtg aatgtaaggt cttattagga aatcggccga ggtgcctccc     62340
     ttccgctctg gcgcgctccc taccctcatt acagcgctgt aaaatacgtt ttctttccat     62400
     ctctgcgaac gcggaaatag tggtatagat aacacgacca acatcgctat tgatatccaa     62460
     atctccgaga tcatgaaata ccaaccctgc ccctttattt gcaagctgat cggcaatttg     62520
     taatgcatct atcgtattgc gcgcaattcg atcaaccttg gtcacgtgaa ccacatcccc     62580
     ttctctggcg aagtcgatta acttgttcaa tgcttcacgt tcggaagatt taccactggc     62640
     tttatcttga aatatcttct cacaaccaat tttttcgagt tgagaaagct gtacatcaag     62700
     attttgatca tcagtactga ctcgtgcgta accaagattc atatttatac ctagaagtga     62760
     acattaagag cccattttat tagtgtacat gttcattaat tttttataag actaaatgaa     62820
     cagttttgtg atatgacctt tacactgtcc ataaaggtac acctttctga acaatgcccc     62880
     acttcattcg cttcaaatga ttcgtatgaa tcgaacgatt cgtttataat gaacaaaaaa     62940
     ggagcacaca atgcaatcat taaccgcaaa tacagcaaaa actaaatttg gtgacttact     63000
     gatgaaagta cagcgagagc cagtacaaat cagcaagaat ggttcacctg tagcagttgt     63060
     tatgtcatgt gaagaatacg aggaactaga agccttgaag atggcgatgg tgaaatcacg     63120
     ttttgagcaa gcggaacgag acatcgtgaa tggagatttg gtggatggtg agaccttcat     63180
     gaacgagtta gattcaggca agtttgacta atgacacgat acaaactttc tcccgcagcc     63240
     caaacggacc taatcgacat tcgccgttat acgcttgaaa actggggagg cgcacagtgg     63300
     accaattatt ttggagagtt aaaacaatca atggcgttgt tagcgagcaa tgagttgatt     63360
     ggcattgaca tgccggaact tggaactggt tactgccgct ttccgttaaa gcatcatgtc     63420
     atctattaca tcaggaaacc ggaccatatt gttattgccg ctgtcctagg gcgtaacatg     63480
     tcaccggcta agcactttca gcgacagtta tagcttttaa gcctctgcgt ttgatgtaat     63540
     ctcgtaatgt acttggggct tcatcaataa gctttgctgt aggacgaatc cccagtcaca     63600
     tccctaagta tttttcaatt tgatcccttt tgggatcgag cttaagcttt tccgcctcac     63660
     ctttaggtct accaagagta acaccggctt tttttcttgc agctaaagcc tctttagttc     63720
     tcatcgaaat aaactcgcgt tctatctctg ctgcgagacc aagtaccgtt gcggtccact     63780
     tctgtgattt ttgcttgcat ggaaccatct agctgcatgt tctgtttagc aatgtagaca     63840
     tcgatgccct tggccataca tacctcaagt acttcaagaa cctgaagtgt agaacgcgca     63900
     attcgactga cctccgcaaa gatcagtttg tcaccaacct ccattccatc aataagttca     63960
     cctagtttac gttcatgcca cttctttttg cctgtaacga catcttcgat aaagcataag     64020
     ttaactattc cgacacgatt gcaatactcg tagataccat gtttctggtt tgctacatct     64080
     tggctatctg aagaaactcg aaggtaggcg tattgtggca ttgatcaaat cctcatctaa     64140
     atgatgaagt acttatagca agccttgacc ttatttttga tatccatcac ctagattgtg     64200
     acagttagaa aagaataaaa agaaagaaat gaaactgttt ctaatgaggg taactgtgta     64260
     aatctttgat tttccagtta tccacattag ctataaagat ctatatcctc tatttaaaac     64320
     tataaacact atgaaaacta taagatctat aggtgttgta agttactgaa taaaaagaac     64380
     ttaaatgccc gtcctgatca tttcttaggt gtatagataa cactatttag gtgttaatga     64440
     tcttttttta ggtcttaatg atcatctact aggtggaagc ctgacacaat ttaggtgttg     64500
     atgatcgtat ttaaggttta tagatgacat attttaggta ggttacaggc taaaataacg     64560
     aatattaggt atctccgccc tatattcaca gtgatcttga ttaggcatct tctaatgcga     64620
     cacattttag gtcttacatc atctaaagta cctaaaatgt gtcacttatc acagtaggag     64680
     acctgatttt tgtcagtaat gggattgtct cacttaatat gtgtcatcta gtaatcaggg     64740
     ttatcactaa tctcagataa ggtatcgatt ttatcgagga gcgagtccac ctcgctttga     64800
     tggtcattat caacttctgg ctctcggttt aagtgtcgct tagagagact ttcttctacc     64860
     ttcagagcat gctgctcttt gccgatatag cggtaagcaa tggccaacgc ttcaagctcg     64920
     gcctctgtca gctttatctt gtcttgtagg cgttttagct ctagctctcg aatggttttt     64980
     aacgcatcgt gttggttcag ctcttcaata gtaccaagct ttatccagcg gaacaggaac     65040
     ttgataccgg tgatagttcg acctttttta attacctcaa aacccttctc cccattttcg     65100
     ccttccaaga acagcagctc ttttcggatt tgagggtgtt cagtaagctc tttgatgctc     65160
     tcacgaatac agcgtttcat gaatacactg ttatttttga atgagctttt gtctttcttg     65220
     agtttgcagg cctcatcgag tagtccaaag acccctttta actcatcaag cttctgttga     65280
     tgcatttcaa agcctttgtc tttaaatcgg ctaagtaatt cgtagaggcg ttttgaatat     65340
     tcttttttta catcaaagaa attgcgagtg ttaatgagcg caaagccctg gttgtactcg     65400
     atgtactcag atttgagcat gtcattaggc accatggtca aggtgccatt tttgtatgcg     65460
     atgtgtttga aaagcggacg gtaatcgaat tcaatatccc cttttcctgt ttctattttt     65520
     ataccgattt ttcggctcgc aaggcgattg gctactgggc ttaaattact cccgatatgc     65580
     ttagattcta cacctaacca ttcagatagc tgatgtgacg tgaactcata atgaggggta     65640
     ctgcgctccc agtcgttcgc tttcatgtgt gcgatcatca atgcaaacat gtctgcttct     65700
     cgagcagaga gatcctggcg actaaatacc agttgatgac ctttctttat atgtttcggt     65760
     aagttatcac ttacgactgg gtaaaagtac tcttcatcac tcataccacg attcctttaa     65820
     ataacacaat ctaggtaatt atgacatatt ttaggtgtag tggaagtcta attacctaaa     65880
     tgatgtcact aatgtggtgt gtaattgata tgatcatcat attcaaagat caaaaccttg     65940
     atcggatact ctcttctgaa tctgtagcac gttcaaatct cgttatacct tcttgcgttt     66000
     gaatttttta ggaggattgc caacgagaag ctttaaagct gaggaactta ctctctctgt     66060
     cgttgcagat gaaaaacgcc agcgacgtga aataagtggg agggaatcaa gcttgcttgg     66120
     ttgcaaaaag agtaagtgac aacgtgatgt cgtctacggg ggacgtgatt gatcaatggt     66180
     gtggtatgaa caatcaataa acaggtttta tggtgatatg cctgtctgtt aggttggtta     66240
     agtcgttaca caaaccagaa caggaaacgg gagagattaa cgcctcgacc tgcagcggtg     66300
     tggcgagccg tgtgactagg cccagcccta actaatctgt cacagaaagt gcacacctga     66360
     taaaacatca cgaagaagaa ccaacatact atttatcttt gatggaaagc aggattgatg     66420
     ttaacgcttt aacatggcat cacccagccc cgtcatagac cctttgtgcg cgaaaaatac     66480
     ggtcgtttat gtcacccacc ctataccgct attcgtcatg atgttctgta atcgattgtt     66540
     taccccttac cttcggctaa aaattttccg cgccgcgcga atttaacagc ggagccttgc     66600
     ccccctaccc ccatttaaat tgttttactt ttgagacgat aaacaacgca gttacatttt     66660
     cattatgggt cgcacgcaag ctatttgctt actctttcat tgctgcgatg agtttgtatt     66720
     ctgtcggtgt aaggatggag caccatgcga tttttgaaac taagaaccga tcataaccga     66780
     gtacgcagag acggaacgcg ttacgttact ccgctcatcg tggactcacc gaggcgtttt     66840
     gcgccgagcc gtgatcgtaa agaaaccagc ttgcgtcgga aacagtgtca attaatcaca     66900
     ggcgcgcatg attcggggaa gagccgttgg ctcacgcgcc tgaaagataa tcgacacgaa     66960
     atctggggaa aaaaaccgca gcctgttttg cttgaggggc taatgccact ctcaagttgg     67020
     gtggaagtga aagggataga caagtgaaac caagagaggc aagaagaggg tgtaacttac     67080
     acaccatgga gcagactcaa cttacagctc aaggccgacc tattggctga ctatttaatg     67140
     gaaacccaat ccttactctt tatcgacgat gcgcacaagt taaccgggcg caaagcacaa     67200
     atcgcacgta agtgcttgat gtctgccaag ctgtggctga tgacgtgtag cgaagaaggg     67260
     cgccttcccc cttctattcg tcctattgtc gaacggcgcg aaccccagcg tatcaactta     67320
     gaaagtgacg tgagttacga cacgaccaaa gcgctggttt ggtttatggt tgcactatgt     67380
     gtggtttctg gcgcttggga agcgggcgct gtgattggcg gcttacaaat gcttggcagc     67440
     ggacggaggt cgacgcgtgc agattaagta tggcctttta atgctgtgtc ccttgctcta     67500
     ctcagcggct tatgccaatg attggggcat tgctacacta tgggatgaac ccactgcgca     67560
     acctcctgag attaagccat ttgaattacc aacattgaag ggggatacgc cccactacaa     67620
     cacccctact cctgcgttaa aacctgcacc taagattgac ccagatgcca tctttcagac     67680
     cgtactcaac tgctacccag aaaagagcaa attcaaactc gacttgaacc tagtagctgg     67740
     aatacggacc aacttagatg aatacaacag cgatgattgg ccggagatct cagaacacta     67800
     tgtcgggata gtgggaaaaa tgccgctcta ctctactaca gagcaatctc gcgagaggca     67860
     atgggaatat cagcgtcgaa ctgccaccgc gacatcagtc gcctccttca cccaagcatt     67920
     ggctgacaga aactacgctt accgattgat gggactctac ctatctcttg aagctcgttc     67980
     acagcagcgg gtcacccaag gtgtagcgaa cgtgaacgaa caagtggcac tacttgaaaa     68040
     agtcgccagt tcgcatcgag acgttttagc tcatgaagcg aaaatcgtag agcaccgact     68100
     ggctttagtt gcgctgtgtg agagttccta cagcgacaga gtgaatctgt atttgcaaaa     68160
     gctggcctat ctcccaccgc atgccaagcc gaaggttgct caatgaagtg gctgaatcat     68220
     ggcctgattg caggcgctat ttgtgcagtt gtctcccctc ctcatgtgcc tatttgtgtt     68280
     gccggtgcga ccgcaccgga ttggatggag tttgtggcta aaggactcgg gcgcaacatt     68340
     aaacatcgcg gaccaacgca catctttacc cactggttga ttgtagccct ggtctttact     68400
     ttggtttggg attaccaagg tattgggata gcctttgcct ggggaggcgt cagccacata     68460
     ctcaccgacg caatgaccgt atcggggggg cctttctccc catacagtga cagacgcttt     68520
     catttatttg gtgggcggtt tagaaccggt gacccagtgg agtacgcaat ctctgctggc     68580
     gtagtgatag tttgtattgg cctttctcat attacaggcg gacaaggctt tgcaccgttc     68640
     ttttacgatt gggcaggcat gtatgagcaa ggcttaattg atgccttaga gtggaagacc     68700
     aaccgattta gattgattta aatgacctac agaatgtcat tattcaggct gaatattgac     68760
     agcggttgcg ggaaaaaagg aaagaatttt gaatagggtg ttgaacagag gctttaccct     68820
     gattgagtta ctcataacaa tttgtgttct cagtgtctta ctaatatttg cggctccaag     68880
     cttttctaac ttgtttgaaa gtagtcgaat gaaaactgct caagacgaac tgatggggtt     68940
     cgttatcatg gcaaaaagtg aagcggtatt taggaacact cctgtttaca ttcactttag     69000
     agagttggcc aacgtaaacc cagacgaacg ctgcatggtt ctatcgttgt cggatagcat     69060
     ttccgactgt acaacaaacg taatctatac attgcatggt cgcgtctttg atggcctaac     69120
     gttggagcaa acctactcac aaaatgtgat agaggttgat ccagtaagtg gctggccttt     69180
     gcttagtcac tcaacatttg atagtgaaag taatagtgaa cttcttaaat tctttgcaag     69240
     aggtgaccaa aagattgcct ttaaaatgca tatcaccgga agagtgagtt tttgtggtat     69300
     tggaggggat tggtatcgca ctgaggcttg ttaaactgtc attattcagg ctgaatattg     69360
     acaagtttac gaggagtagt ttcctcctgt ggatgtggtg gctcttacaa gctactgtcg     69420
     agtagacgac acctgttacc aagtgtcgtc cctctaagaa cccagcatgc aactttcacc     69480
     gcactaggct caagccttca cgaaggcacc gattggcacc cagcaactta taaagcagtg     69540
     agagcaggtt cataccaaga gttacggcat tgcttctttg attttctctt agccaagtat     69600
     tcttggtatt gaggatcaaa aggtgtagcg gcactcctga ttttcacatg cctctctatt     69660
     ggcaccttag ctatttgaaa cagattgaac tgacaatcca tattcatgat cttctgccaa     69720
     ccgtgaaatt gccattgacc ttgacggttg atgaagtatt taagggcgat ccaagttcta     69780
     gattttgttg gatgacgcct tttagcccaa tgccataacg catggaatag cttgtgacct     69840
     acatatccga atacctgttt cgcaacgcag tgtcgatagt aattcgacca gcccctgagt     69900
     ttcgggttta tcaacttgat aagatcgttc acagggatgg ttgcgtgctt tttgatgagt     69960
     tcacgcaagt tactcaagaa cagtagtgtg ttggatttgc tcggtttaat gagcaacttc     70020
     cctttgtact tcctatgatt aaaacctagg aaatcaaaac ctctgctgat gtgggtaatg     70080
     tgcgttttct cttcggagag tgttaagcct ctttctgtta agaaatcagc aatcaacggt     70140
     ttgatatcgt tctccagcac ttcctttgaa gcacaagtga cgacgaaatc gtcggcgtat     70200
     ccaataaagt tggctcttgc accctttttg agtgcggtag actttatgcg ttgctcaagc     70260
     cctgtaagag tcattagcat caaggttggg gatatgaccc caccttgtgg cgttccctcg     70320
     tcagtgcgat agaacaagcc tttatccata aaaccagact ttaaccattg ttccaacata     70380
     cgtttatcga tggcaatgtt atccatcagc cattgatgtc cgatcttatc gaaacaagct     70440
     ttgatgtcac cctcaagaac ccattgagca gagcgtttca tagccaagca cttgaagcac     70500
     tgcgcaatag catcagcagt gcttcggttt ggtctaaatc catagctgtt agggtcggca     70560
     agtgtttctg atactggctc tagtgcaaga agatgaagcg cttgctgcgc tctatcgatc     70620
     atacacggga tacccagtgg tctgagcttg ccgtttttct tggggatgta gatacgcttg     70680
     agcggttttg cttgataagc ttttctgctc aattgattgg ctgctttcat gcggcgcgta     70740
     tctgtattcc agataacgcc gtcaattcca ggcgttttac tgcctttgtt ttgtgacacc     70800
     cgcttaacag caagaagttt tgctgagcgc gagtgagtca gtatccactg caatgctttc     70860
     actttgccgt gtttaccttc tcgtgttgcc tttgcaatac gcatctgaag ctttaaaaca     70920
     tgggattcaa cggctttcca gtttatggat tgccactgag cactgtcagg agaggcacta     70980
     atctcttttg gaatcatcat ttgcatttct ccttgaataa agttcttcaa attctcttgc     71040
     aacggaagac ccgtcggaag tcagctcact ttcgtgccag ataaggatct gtatctgcat     71100
     cgttacaatg cagctttcgc tttttccaac atcctatacc tgcatcacta tcggtcgcag     71160
     agactttccc agagggagtg atacaggctt accgtgttcc gtatgtcgcg caatgtcagg     71220
     gtagatgccc gctatggtgc ggagagttca acgatcacga aagagcatgg ggcaatctct     71280
     ttccgactct cttgcctttt tggctacagc gtattaacca cttccgctgt ttacacgtat     71340
     aacgcacctt acacggattc acgtatgttc atcatacaga ctacctagca cttacccgac     71400
     tcgtggttgt caggaggata gtcttctcac gatttcgatc ccgattggca aatgccaacc     71460
     ttcgttacat tgtcagactc gctactttat tcagagtctt aggttcatct ggtgatacag     71520
     atggttcact cgttaagcgg tgaacagcgc ttcatacgac ttcacgtcgc acgcccctct     71580
     actgcttagt gcctttactc attcacatcc tgttcatgca cttttgccct actaaaagtt     71640
     atccaaattt agcaaaccta gaagtatgac ccacagagca acttaactcg ttatcccttt     71700
     gactaatcaa ttgattataa attgaagtat tcaacgaaag actgcactac ttcaggactt     71760
     atttgtttct gcgccttgaa ataatataca accatcacca tatcttgatc gtctatttca     71820
     caggataaca ttatgaatac taagaaaacc tctaaatcag ttgcttcgaa agcagctaaa     71880
     gccctttctg accctaacgc ttcaaagatt cagaaatcac tagctgcaag cgcaatggct     71940
     caagctgata agtcaaagca aactggcaaa gatatggagg ctaaagcctc aaaggttctt     72000
     cagtcagaca aatacagtga tgaaacaaaa gaattcgctg cttcagtatt agctcaatcg     72060
     aacaagaaac gataggaggt ttttatgtca acgtgtcaaa gtgaacatcg acattaccct     72120
     gagtttgaac aattacccca tgaccaaggt ggtatggggc gtcataagtg ctgcggttgt     72180
     gcttatgaac gaggttacgc tctgggtcta gaacgccaag aagaactcaa tatcgatatt     72240
     gactctttgc cagttagcca agccggaaca gttcgacaca aaagccctca cgcagcgttt     72300
     gcaataggct atcaagatgg cgttcgtgcc tcatacaatc aataagaggt ttgaatgaaa     72360
     ggtacccttc agtattacga tatcgataaa ctcggcattt acaaaagagg ctctgatgag     72420
     cagttgtttg attcaagtga ggctgtatta gattcattaa ttggctggtt caagcaaaga     72480
     cccaatctag taaacacgag tacaagaaaa gctgataaag cagtagggca atcgaacgtc     72540
     tattgttatg acatcgatgg tgcaaatggt gagtacgtct ttgtgctttg gaatgagtta     72600
     accaatgctg atgacgagat tcttactcta tcgaaagact caaagcctgg taaagcaaag     72660
     gtgaagtctg gtgttgactc caatacagtt ataccgggct tgccaagcta ctattggatt     72720
     tcattgaatc atgacctttt agcaacaatt cactatgacc acgcaatgac atcgcttgta     72780
     gctttaagaa actacattac cggatatatg cagaactatt cagaatttgc agttacgcat     72840
     aaagataatg aagataaagt tataggctat cgacatcctg atgataaaga tggagacttg     72900
     ggttatttca agcttgacct gaagcgtaaa actgatgaat cgacgattga agaactaaca     72960
     caaaaacacg ataaaataac taagattgtt cgtagaactc aaaaacaagc tgaagacgtt     73020
     gaacttgtag gttggtttca taatctagcg agtcaagccg ttggtcgtgg attgcctaaa     73080
     gccaaagaag tgcatgttga agttgaactt gattttacgc ctgcgaccgc aaatgacttt     73140
     ttggatatcg taacagctta tcaaaaggaa attattgacc ctgacaagta caacaacctt     73200
     ggttttgtgc ttaaaggtga gagtggtaga aagattttct tagatggtaa gtatctcaaa     73260
     acagaacacg ctttcgagat tcaacgtatt ggtaaaaacc catttggtgc atctgagttg     73320
     cttgattaca ttggcacaaa gcaggtcaga ttggtaccta gaaaacctaa taagagaaaa     73380
     gcagcatgac cgataaaaaa gctagtttcg gctggctaaa atttggttta tgggtagcgt     73440
     ttcttgttgg ctacgtaatt gttgccaaca agtatctatt tgatttcgca tttactctca     73500
     aagtagagtt aataaaatct cagataggaa tattagttaa tgtatcggca atcttgtttg     73560
     gtgtaattgg agcttggtta gctctaattt atccgactgc attgcaaaaa gtacaaggaa     73620
     aggaaaacat agggctagct tttagtggtg tagacctaag cgttctaaag agcttggtac     73680
     tggttttgct ttttagtacc acgtcgctaa tagcgtcttt actttgtgat ttaacattaa     73740
     ctttctcaac gcacgcctca atagttcaga taattagtgc gggcaaaatt aaagcagtat     73800
     gcgcgttaat agtttggctc ttattcgcag tacaaatttc tgcaatatca tccttattgt     73860
     tttcgtcatt caaactggtt tatgacttgt ttattagtaa agcatataca gacctacacc     73920
     acttacttgg acgaaataaa accaaatagt tgtaggttcc ttgccagagg atctttttta     73980
     cttgatctgc ccgcttaaat caaacccaga caaagattgg tgataaggtg gtttttccat     74040
     acctaaacta atttattgat ggctaattta gcaaaaccac tgatgcgttt ctgtccaaac     74100
     tcgtgtcaag ccaaccagtt ctagcacgag cttgccccat agtttgttag tgctaatact     74160
     catacgagct ttattcattt gagttttcca tataaaaact aatgtgtgtt taatggataa     74220
     gacagaacta agtacatcta atggggagct ctggagagta aagtgtcagt aaattgttga     74280
     aaagtaactc gacactctgc aagattgatt tatgttgact acctgtaaca gactgattat     74340
     acgcatattg cttaaagaca ttacctaaaa actctgttag atttttcgag taattctaca     74400
     cccttttacc tcagaaaaat gactgctgcc tatgtgttcg aagctatatt tacagcgtag     74460
     actttcaaat gaaaataaga ctttctcaga agtagagctc ttagctgctt caaattacgt     74520
     tgtcgtgtta gccgaacctg gaggtggtaa aaccgaactt cttggaagtt tggctcaaca     74580
     gttgggtaca tcttcagtta ccgcaaacat gttcgtacaa ttaggcgcta gacatgagaa     74640
     tacaccactt gttattgatg cttttgatga actggccaaa attgatcaaa gtggcataca     74700
     taaacttctg gcaaagataa cgatagcgaa gcctagccat gttgttattt ctagcagatc     74760
     tagtgagtgg gatatatctg ccacaaatgc agttaagaat tttttggaaa ttgaaccatt     74820
     ggtggttagg ctttgcgagt tcggtgattc tgagcaacgt gcgatctttg agcaccatgc     74880
     tccaggagaa gacttcacta ggttctattc agaagtatgt agatttgatc tggaagccct     74940
     cctgccgaat cctcagttct tgaaaatgtt tgctgacgct tatcttgaaa gcgagagaaa     75000
     ctttgcagat aaacaatcta ttttcaaact tgcagtggaa cgtttagcta gagaagtaag     75060
     tcaaacgtcc tcaagaacca gcctatcact ttccgcaagt caaaaagtcg atatctcgtc     75120
     agaggtattt gtcaaactgc tattgtctgg atcagaagga gtaagcgtca gcgaaatcga     75180
     agaaaaccgc atatatcctt tgcttacatc acttgctggt aatgaaccat cagttttcaa     75240
     tatccttgct actcggcttt tcaagccagg ggatagtact gaccaccacc gtccagtcca     75300
     caaaatcgta gctgagtatt gtgcagccgc ccaccttaca aagcgaatag cagacccagc     75360
     agatgctcta acactacacc aatgcctacc aattattgcg cccaattcta ccgtaagaga     75420
     tgaacttcgt gggttactgg gctggatggc tgctttgggg aataaggctg tccagcatgc     75480
     tgcaattgaa ctcgaccctt acgcagtcct tgcaaacggc gacccctctc agctagcccc     75540
     gtcatcaaag caattacttt tgactaaact gaaggaaatc gaggaaacgg atccatattt     75600
     taggagaagt gatttttggc gtcggtttag tgttgcaggc tttttcacag aagatattat     75660
     cttagatatc aaagcactgc ttaacagcca agacgatggg cacctacgta atctaattct     75720
     tgaactattg attgaatctc ctatcgccca tctattgata gatgaattgc gtcagatcct     75780
     cttggattct caagaagaca agtataatcg catttatgca attaaatgtc ttttgggctg     75840
     tactacttat gcgtatgaat cagacttgac gaagctttta tctgaagcca ctccagcgtc     75900
     acttgaggtg gcggctaaag gaatggagct ccttgattta aatatgtttg agttagcgtt     75960
     tcttgaaacg tactttttgg cttgtgcaaa tttatatcca agcaataagc ttcgatctga     76020
     acgagtgatt ggagctcgtt attttataaa gtctataatt ttcagattaa atcaagaaaa     76080
     cgttgagcag ctgttagata cactaactcg agaccttacc tgtacctgtg gcttaaaatc     76140
     ctataaatgt gattgtcgaa acgggataag taagattgtc ggatatatgc tcgaccgtta     76200
     ttttgatacg gcgttaccac catatgaacc actgcgtgtt tggggctggg ttgaaaattt     76260
     aaacttccat agaagtatgg agccaaaaga cagtcgttct gttcaagtac tatacgaaaa     76320
     tagcgagtta cggcaaggta ttcttacaca tgttttcagt gggttaactg gaagtgacca     76380
     aatatttgag actaaacgac ataagttcgg tattcaatca cactcaggtc tccgcttatt     76440
     taaagaagac tatcagttta ttgttgatct agcatttgac acagataacc ctgaactatg     76500
     ggtaagcttt attgtgagac atgatagaca ccgaaaacca gaggaaaaag gctcagatga     76560
     tttgcgacgc cacatgcgaa ctcaggcatt ggagaagccg atgtttatgc gagagtgggc     76620
     taaatgcaat agagcttatt cgctatttgt gaaggaagaa tataagcgat gggaagctag     76680
     aagtaatcga atgtctcgcc gctataaaca gcgccaaaaa aatatccatg ctgaaaacat     76740
     tcaatatatc caagaaaata gagagcttat tgaaagtggc cgtcattgga gttttttagt     76800
     tcattttgcg cagaccatac ttacagaacc aaaagatatt gttctgaaat ttggcgatga     76860
     agaaattgtg aaaaacgctc tcaggaattg ccacaaattc atagaaccag aagtccctga     76920
     cttgagtaaa ctggccgagt tgcgatgctc ctctaaaggg ttatatgttg aaacgatact     76980
     ttttgcttct tgcgttgaaa taatgcgaaa acatggaagt ctaaacagcg ttaagccaga     77040
     attactccta gtactaaaga cccatttcaa tgttcattat gatgcggttg atgaaaccga     77100
     gtataacgct ctaaaagcgg aagttgatcg cttactgttc accaataatg aatccactga     77160
     acaatttctt cgttcttatg tcgaacctca gttggcaaat tctcagtgct ctcatccgag     77220
     agtagatatg ttgaagtatg atgaaatatt cactcacttg cgggcaaagc tgtcaattga     77280
     atggcttgaa cgtttcgatg agttaggttt ttccacactc gatacgctat tcgatctcgc     77340
     aacgcagttt ggagatagaa atatgcttaa tgacatcatt cgaactcgct gttctgatta     77400
     tttgtctaag tttcctgaac agacagatga tgaaaatatc gaacaaaggc gcaaattttg     77460
     gttcgttcga gcattctatt ttctggattt agaaatagcg aagccatatt ttgattggct     77520
     taaaagcgat agcaactcac tgcttctgtt tgagggccgc tcaggtagaa tgaatagaga     77580
     tagttcctct tactggccaa acttgacatc cactaagata gaattaattt taataatttt     77640
     ctttcatcaa tggccaaagg ttcacctccc tagctgttgg ggaactggaa gtccaaaagg     77700
     agaaactgca tatcgtttcc tcaccgaaat tatttggtca ataggtagcg atacacctga     77760
     tgaagcaatt cccgtcctta atcgccttat tcaagatcat acttttagtg atattcagag     77820
     agagttgaaa agtataaaag cggagcagct gaggaaaaag tcactgagag atttcgagcc     77880
     acctactcca gaaaaaattg tggatttatt ggacaataac gctgttgtta cagtggaagg     77940
     attacgacaa cttgttcttc aaaaactaga agactatcag aaggatatag atggagggga     78000
     attcaatgct gctacgcgat attatacgaa agatgataac gggaaagtta tacaccgaaa     78060
     tgaagttagt tgcgttgaga taattgccga acgtctgaac ttagtacttt cccccaaaag     78120
     tattgctatt tcgtctgaat atcagactaa aaatcaaaat agaattgata taacagcagc     78180
     gaaaatgatt gaaggtaaaa gacgactact cgtaattgaa gctaaagggc aatggcacaa     78240
     ggacttgtat acagcagctt ccgctcagtt gtatcaacgc tattcaattc accctgatgc     78300
     agaacagcag ggtatatatc ttgtcatatg gtttggtgct aatgaagcta ttgctgggcg     78360
     taaaaatatt ggaattactt gtgcacagga tctcaaatta agtattgaag aaaggttacc     78420
     accagaaatc aaagggctga tagatgtatt tgtcttagat gtctcgcttt cctaaagcca     78480
     ctagagtttg agattatttt agatcgagag tggaatagcc atctagcttt tagactgtaa     78540
     caagccactt tttcccaatt tcaacttatc cgaaaccatc ggcttagtgc gcaaactcta     78600
     agacgttttt gtccaaaagc ttcccacaag ttggataaca gcccgctatc caacttacta     78660
     gtgatgctac aaaagactat ttctcttcca aaaccttagc aatcgctgaa tccaacttgt     78720
     cttgcatttc tttagacaag cgcccgaact cataagagaa gttacggccc ttcacacgct     78780
     tgcgtgcaaa catgcctttg ctatcgaatt gggcgagggg agtgacttcc gctttgtctg     78840
     actctttctt cgcttctgcg acttttagct cagctttgat agtcgtaaca atttcgtctt     78900
     tctgatcctc aagcgaatat tcagcctgaa tattgacaag acttttctca attttcttta     78960
     cgaagccagc aatctgcttt ttatcttcac aggtcttcat caccttatct agcaaagcat     79020
     agtctggatg tgaaagggca ttaacaactg gaaatagctt aaccaacttc ttgtctatgc     79080
     tggcagcttt catcgcttta cttacacctg cctgactaag cccaacttgc ttcgcaatct     79140
     cagcttgagt tatctctgcg tttgccgatt tgatggctat acattgttgt ccaatctcac     79200
     gcaggttgtg ttctttagcc gtttgtaact gcttagctag agcctgagca tcactgacgg     79260
     agatttcatc ctgagtgaca aggatacgga atgttttgac gtggccttct tgaagtaaga     79320
     accaagcacg gcggcgtgag ccatccaaca catcaatctt gccttcaatt tctcggccta     79380
     cggcaggata gaactgttga aactccagcg aatttagatc agatagggac tccgcagtaa     79440
     gaagcgattg atcgcgtcca ttcacatcga aagtaacaaa cgtctcatca cgaacttgtt     79500
     cgtatgacag tgtcacttcg ttaaacgtcg cagtattacc tgatgctaac tgccaaacca     79560
     tgctctggcc gacagattca agaccaaact gttctcgcaa gtactcagcg gcattggtgc     79620
     ctgctttatc cagctctgcc gtcaattgct gcgttaaagt ggtcaggttc gctttagccg     79680
     ctgattgctg tgcttcttga gaacctggtg cgttacctaa agggctaccg ccgcgttttt     79740
     tcgccattat gcttgctcct gttcgcgcca cacattaaga atgtcgcgct gaatttgact     79800
     ggttacctca tacccgtttt gctgcgccgt ttggaacgtc gacttacttt ttgggtactc     79860
     gctctttgac atatcaaaaa cggttgaaag tagggaagaa gcttgtctga tggcttcgct     79920
     gtgtttgaac tccttagagt acaaataagg tgcaaagtgg tcgtaaagac tgttcatcaa     79980
     ctcagttgtg gtcgagctgt cacgatggtt ggtaagcaag atcttcatga agtcgtaccc     80040
     atcatgattc gcattggcta gcagcgccca tacttgcgga atgtagctga agtatgaaca     80100
     ggtcgcatcg atgtcgttct ccgtaatcga cagcgggaat accacactcg ttgcggcaaa     80160
     gtaggcgttg taagtggcgt aacctagtga tggcggtgta tcgatgatga tgatgtcgaa     80220
     ttcatctttc acagcatcga tgatctcagc caagatagag tagggggatg gcaatttatg     80280
     gctgaagact tgttcatgga accagccttc aatagctcgg tcactctgcg ctgctggcag     80340
     aattcgtaag ttaggaatgg tggtttctag gaacgcctca gatactgctt gctcaaacgt     80400
     ttcatcctca tccaagtcaa agttacgcat aatgagatca cccacagaca agttgccttc     80460
     ctggtctgcc tctggcgcgt aatacataga gagggtcgcc tggccatcca tatctattaa     80520
     gcctacacgg tactcttgat ggaactctgt agctaaacca gatgcgacag tcgcggcaga     80580
     cacagtttta ccaacgccac ctttctggtt ttgaataacg atgacttgcg ctgattgttg     80640
     ttcgctacgc gagaactttg gctctttacg taatgcctct ggcaacaagt cacgtacacg     80700
     gtacatttcc gcaatatcaa tcgaccactg agagtcttca tgacgacgag gatcaatctc     80760
     cgcagcggtt acatatttat ccagcgtttt agcatcgatg cctaagtaag cggaggcttc     80820
     tgcacgggta aaattgcgta actctttgcg atgattcgcc agtaagcgct ggttgcggcg     80880
     cttaatgtaa gcatcggctc cttgcttaag ggattgaagg tgtgacgtgg tttgttgagt     80940
     atccatttct gtctccgtgt aggaattgga aatagtatat cccttagttt ttaattcgtg     81000
     tagtcaaaat taaggggttt gtatgttttt tgtcattttt gggatgctgt ctttgaaagg     81060
     ccaagactaa aaaaccacca taaggtggct tttgatatga ttacgcttgg ataatctcac     81120
     tcgatatctg actgttagag cagttgtcga actaccgccg tcatacttac atgaacatta     81180
     gcctcaccat cactgtacac ctttttcgta tttagagtcg tgggcttatc ccattctagc     81240
     agcgtttggt tagttaaatg tttagtgatt ggcagctcga tctctagctc ttttctaact     81300
     gcgataggga atgctaggtc atagctgaac catacccctt tttgttccgg gcgaagtggg     81360
     ttttgccaaa cagaatatcc gctattacaa acatcatcgg caaagttaca catttcaaag     81420
     ctagcttctg atggcagctg tgacacatac agtgaaacag tgaagttttg gtactctgga     81480
     gctgcgtcag agttgtgata agtcagttca attacgctgt ttgcgctttc tttagagccg     81540
     atatccacgt agttcatagt cggttcttct ggctgagaag tacacccgag cataagaaaa     81600
     gaaaatgctg ttgctagaat gagtcgtttc ataagtttcc cttttactgt ataaaaacac     81660
     agcatgtaaa cttaagtttt ataaatcaag caaatatttt catgtgattg atactttagg     81720
     gtgatgttaa cttcagcact taacctgagg caaatctgtc caacatgtcg tgtactgcgg     81780
     tgtcagaagt tgacgccgca tttgccactt ttgctcaatg ccttgagcgc caaggaatac     81840
     cgtgttctgg ccataacgtt gatttaggcc atcaaacacc gacatcaacg acgagttgtt     81900
     tggcgtaggg ttaaataaat ccgcttgctc ttgccgcccg tcgactaaat ccaataggcc     81960
     aacgcccacc ttgtaaaagc ggacaccttc agaaaagagt tggtcggtta gctcagagac     82020
     cactttagtt aactgagtga catctgccgt cgggtagggg aaccgatgca cgactcggcg     82080
     actgtaagac acatcatcaa acggcgagct tgatgcaaag cacatcagca ccttacataa     82140
     ggattgctgc tttctcgctt tacgcgaagc gatgcccgcg tggtggcaca acgcctggcg     82200
     caacgaggtt tcatcctcta tccgttcgcc aaagctgcgc gtcgaaaaaa tctgcttttt     82260
     gtctgctctc gcctcatccc actgcttaca aacttggccg ttaagctcgc gcactgtacg     82320
     ctctaactct acgttaaaca ccttgcgtgc caatggcgcc gggtacttgg ccagttgcaa     82380
     tgcggtggtg atacctagtt gctttaggtg ggtagtgagc cgtttgccga cgccccacac     82440
     atcactcacg gccagctgcg cgagcacact ttctcgctcg gttacaccat caagcacgca     82500
     cacaccatta aacccagcga tcttcttggc ggcatggttg gcgattttgg ccagagttaa     82560
     cgtcggcccc atcccgacac aaacgggtaa ccggcattca cgccacaccg attttctgag     82620
     catttggcca tgctcacgga gacacgggat cgccgctgtg gttcgctcaa aagagaggaa     82680
     agattcatca atagagtaga tgtgctgctc tggggcaaat cggccaatga ccgccatcat     82740
     cttgctcgac aagtctgcgt atagctcata gttagaggag agggcaataa cgccgcgctg     82800
     ctcgcacagt gccttcatct gaaagtaggg cttaaatttc tcgatcccgc actctttggc     82860
     ttggcggttc gcggcgacca cacaaccatc gttattggaa agtaccacga taggcttacc     82920
     acgccattct gggcggaaga cctgctctgc gctgcagtaa aacgcgttgg catcaaccag     82980
     ggcgaacatt acgcctgtcc caacaaatga ctggctcggt gacagcgtat cgaacgtatg     83040
     acgacaccct caaccgtgaa aatatcacaa tcctgcacca gaaccggcac atggttaggg     83100
     tgagcagaaa gcagctgacg gtgcttgata tcaatcagct tacaaacgaa ctcgccgttc     83160
     aggttagcga caatcacatc catattattc aaagtgacat ggcgatcgac aatgagaata     83220
     tcgccatcga aaatccccac gccttgcatc gagtccccgc ttgcccggcc caaaaaagtc     83280
     gcgcttgggt gctcgatcaa taactcatcc aaatcgagcg agagttggcg gtactctgca     83340
     gctggtgact caaagccggt gatgccagca cgggctgaaa taggaataac gttcataaat     83400
     tatactgttt atatatacag tataattatg ggtaaaaaga gccttaagcg caagtgatag     83460
     gttgggggat gtaggttgat ctggcacatt aatgtttaat gcgttaattc aaattattgt     83520
     tttaaatgct tatttttaat tgttgttaaa aataaagaaa tggaacgcag tcgattgacg     83580
     atggggagat gaccgaaggg tagtgaattt ttggacaact atcattttcg taaaactata     83640
     aattatagaa tcatgaataa ctacaattac aagttgaagc ggctgtagca tcattgcccg     83700
     acaaaacctt taatatctca acaataggca gatttcgctc tgatacaccc gtcgattaca     83760
     ttggtcaccg ctacttaaca aatgcattcg aacaaagcac ttcacaacat ctattattaa     83820
     ttacttcact gggttgtgat gatagttggc aatacctttc agatcgtgca aaagagggtt     83880
     tcgaaacgca gtacgtgaaa aacactcgct gaagcttggc tacaaagcag caaattgaat     83940
     tacacgattc taagatctgg cgggctgaaa gatggtgagc caacccagat aagcgagtta     84000
     tcacaacata aagaagttca cggcccgatt acacggggag aagccgcacg attaagccat     84060
     gaattgctgt taagaaataa tgctaatggt cagattttcc agtgtgttga tcccagcatc     84120
     gcaacttgtt aaccacaccg ggttattagc aagtaaaaat tagaaagaat agatgaaaaa     84180
     acccgcttta aatttattaa tcgggttttc ttattacttg atagaaagag attccaaccc     84240
     ctttcatgct tccactacca gccctcattt agctctttcg tgcgctgaat agtttctgta     84300
     attaggcagt cgtgtaaatc ctctaaccca ccagagccac tttcactatg ataaaacatg     84360
     tcacacttag catctctgta ttgaatccat aatcgttggg tttttcttaa atcttcttta     84420
     cgaaaatctt ggattctcgc catgtattgc ttataagccg tattgagcaa cttatccctt     84480
     ttcgataatt cctcattcat acatttaaca acggctggac tataggctcc cgacgtatca     84540
     atgcactgat caaactcttt actgtaatcg gcaaacgcaa tgttaaagga ggttagtaaa     84600
     ataaaagcag caaccattgg gtaataaaac cattttttca tcataattcc ttgttctctt     84660
     tcaacggatt agatttggta gggaaaacgc gtgcccctaa aattagtgga tcttttattc     84720
     tatcttattc tggggcgtgc gacgtgaggt cgtatgaagc gctgttcacc gctcaacgag     84780
     tgaaccatct gtatcaccag atgaacctag gactctgaat aaagtagcga gtctgacaat     84840
     gtaacgaagg ttggcatttg ccaatcggga tcgaaatcgt gagaagacga tcctcctgat     84900
     aaccacgagt cgggtaagtg ctaggtagtc agtatgatga acatatgtga atccgtgtaa     84960
     ggtgcgttat gtgatgaaac agcggaagtg gttaatacgc tgtagccaaa aggcaagaga     85020
     gtcggaaaga gattgcccca tgctctttcg tgatcgttga actctccgca ccatagcggg     85080
     catctaccct gacattgcgc gacatacgga acacggtaag cctgtatcac tccctctggg     85140
     aaagtctttg cgaccgatag tgatgcaggt agaggaggtt ggaaaaagcg aaggctgcat     85200
     tgtaacgata cagatacaga tccttatctg gcacgaaagt gggctgactt ccgactggtc     85260
     ttccgttgca agagaatttg aagaacttta ttcaaggaga aacgcaaatg atgatttcaa     85320
     aagagattag tgcctctcct gacagtgctc agtggcaatc cataaattgg aaagccgttg     85380
     aatcccatgt tttaaagctt cagatgcgta ttgcaaaggc aacacgagaa ggtaaacacg     85440
     gcaaagcgaa agcattgcag tggatactga ctcactcgcg ctcagcaaaa cttcttgctg     85500
     ttaagcgggt atcacaaaat aaaggcagta aaacgcctgg aattgacggc gttatctgga     85560
     atacagatac gcgccgcatg aaagcagtca atcaattgag cagaaaagct tatctagcca     85620
     aaccgctcaa gcgtatctac atccccaaga aaaacggcaa actcagacca ctgggtatcc     85680
     cctgtatggt cgatagagcg cagcaagcgc ttcatcttct tgcactagag ccagtatcag     85740
     aaacacttgc cgatcctaac agctatggat ttagaccaaa tcgaagcact gctgatgcta     85800
     tcgcgcagtg cttcaagtgt ctggcactaa agaaatcagc tcagtgggta cttgagggag     85860
     acatcaaagc ctgtttcgac aagattgggc atcaatggct tatgaacaac attgccgtgg     85920
     ataaacgcat gttggaacaa tggttaaagt ctggttttat ggacaaaggg ctgttctatc     85980
     gtacagatga gggaacacct caaggcgggg ttatatcccc caccttgatg ctaatgaccc     86040
     ttgcaggaat tgagcagcgc ataaagtcta ccgctctcaa aaagggggca agagctaact     86100
     ttattggata cgccgacgat ttcgtcgtca cctgtgcttc aaaggaagtg ctggagaacg     86160
     atatcaaacc gttgattgct gatttcttag cagaaagagg cttaacactc tccgaagaga     86220
     aaacgcacat tactcatatc agtcgtggtt ttgatttcct aggttttaac cataggaagt     86280
     acaaaggaaa attgctcatt aaaccgagta aatccaacac actgttgttc ttgggtaact     86340
     tgcgcgaact catcaaaaag cacgcaacta tccccgtcaa cgatttaatc aaattgataa     86400
     atccgaaact acggggctgg tcgaattact atcgacactg cgtggccaaa caggtattcg     86460
     gatatgtagg tcacaagcta ttccatacgc tatggtactg ggctaaaagg cgtcatccaa     86520
     ccaaatcgag aacttggatc gctcttaagt acttcatcaa ccgtcaaggc caatggcaat     86580
     ttcacgattg gcagaagatc atgaatatgg attgtcagtt caatctgttt caaatagcca     86640
     aggtgccaat agagagacat gtgaaaatca ggagtgccgc aacgcctttt gaccctcaat     86700
     accaagaata cttggcaaag agaaagtcaa aaaggcaatg tcgtaactct tggcatgagc     86760
     ctgctctcgc tgctttataa gttgctgggt gccaataggt gccttcgtga aggcttgagc     86820
     ctagtgcggt gaaagttgca cgctgggttc ttagagggac ggcacttggt aacaagtgtc     86880
     gtctactcga caatttatga ggtagctcat gtctcgcaag tcacaccttt aaaggtcgaa     86940
     aatgatcaaa ctatattgta attaaacagt cttaattgga atgactcaaa cgtatgcgcc     87000
     ccatgaaccc acggggcggt gttgttaatg tttgaagttc caaggtagga gcgcatcgat     87060
     atcaggctca gctttcgcga gctctttcat gcacttgacc atgtagtcgt agaggataag     87120
     gccgttggct ttcgctgtct cgacgatgct gtaaagcatc gcgctcgcat cagcaccatt     87180
     tggtgtgttt gagaacagcc aattttttct gccaatgacc agcggtttaa tggcgcgttc     87240
     agcacgatta ttatcgatag ataaatgacc gtcatcgata tagcggatga gcttgggcca     87300
     ttggccgagc gtatacttaa tcgcttttcc taatggacta tacccgtgat cattgaagat     87360
     gcttgaattt ctttagaatc aggatcatgc tacgcaccat gaaaattaca ctgactcctc     87420
     aacagaaact gcaactcgaa caaatgcacg atattgaacg tgatagtcga gtttgcgacc     87480
     gtattaaggc tgttttactg gcttctgaag actggagtca ggctatgatt tcacaagccc     87540
     ttcgcattca tgaatcgacc gttgctcgtc acctcagtga ctacgttctt tctgaaaaac     87600
     tgaagcctga aaatggtgga agtcaaagca agctttctgc cactcaaacc atgcagttaa     87660
     tcgagcattt gactgagaaa acctattccc acacccatca aattgtcgcc tacgttaaag     87720
     agacatttgg acttgattac acggtctcag gaatgaacaa atggcttcac cacaatggtt     87780
     ttagctacaa gcaaccgaaa ggcgttccac acaaatttga tgaagcaaaa cagcaagctt     87840
     tcatcgaggc ttatgaagcg ctaaaggcaa gctgtggcga ggatgaatcg atagtcttta     87900
     ttgatgcagt tcacccaaca ttatcaacaa aaatatctca tggctggata cgaactggtc     87960
     aggataaagt gattgaaaca acaggtaatc gtagccgatt gaacattatt ggtgcactga     88020
     acctatcgga tatcggtgca accattgttc acgactatga gaacattaac agtgaaacga     88080
     ttgttcgctt tttctgtaag ttaagagaga gttatccgtt aacccataag cttcatatca     88140
     tcttagatgg tgcggggtat caccgcagtg acttagtcaa agatgcggcg tttgtcctga     88200
     atattgaact gcattatctt ccaccttaca gcccaaacct caacccaata gagcggctat     88260
     ggaaagtaat gaatgagaag tcgaggaaca acgtttactt caaaagtaaa cgggacttca     88320
     aggcggcaat agaccaattt tttactgtga cacttccaga gatcgcaggc tctttggcat     88380
     ctcgaattaa tgataatttt caggttctca agcctgcatc ttcaagttga ttcggtatag     88440
     agcttattac ttgttgagac gtcatccagt cgtgcagctc atccagtatc ggcttggcat     88500
     gctgttgacg ttctgctttt cgtgtttcga cagtcgcacc ttttaagcgc gattctatcc     88560
     catagagctt ctggattttg gccagcgctt tatctgcttt gcctgactta cctttacctt     88620
     gaagcttctt agcatccatg aacttacgcc gtgcatgcgc caagcaacca acattggtta     88680
     cgtgatgaag accatcatag gcaccatagc catcggtttg cagataacca ctgtaattcc     88740
     ccaagaaggc aacagggcat gccctcgcgc gactgttttg atagtcgtac aaggcgatat     88800
     tcttcacatt cggcagtgca gcgtcgggcg agtctgcgcc cgagcagtag agccacatat     88860
     aacactgttt atcttctttg aggacattga gcggcgtttc atccgcctga accaccactt     88920
     gttgaagtag atgctctttt aaggcggcat agaggggttt gaacttctca ctgacttgga     88980
     taacccacct tgccatggta gttcgcga                                        89008
//

If you have problems or comments...

PBIL Back to PBIL home page